WO2018129092A1 - Antibody fragments for the treatment of biofilm-related disorders - Google Patents

Antibody fragments for the treatment of biofilm-related disorders Download PDF

Info

Publication number
WO2018129092A1
WO2018129092A1 PCT/US2018/012255 US2018012255W WO2018129092A1 WO 2018129092 A1 WO2018129092 A1 WO 2018129092A1 US 2018012255 W US2018012255 W US 2018012255W WO 2018129092 A1 WO2018129092 A1 WO 2018129092A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
polypeptide
fragment
seq
biofilm
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/012255
Other languages
English (en)
French (fr)
Inventor
Lauren O. Bakaletz
Steven D. Goodman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Nationwide Childrens Hospital Inc
Original Assignee
Nationwide Childrens Hospital Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Nationwide Childrens Hospital Inc filed Critical Nationwide Childrens Hospital Inc
Priority to EP18701391.7A priority Critical patent/EP3565834B1/en
Priority to AU2018206560A priority patent/AU2018206560B9/en
Priority to US16/475,654 priority patent/US12098188B2/en
Priority to JP2019556568A priority patent/JP7661008B2/ja
Priority to CA3049114A priority patent/CA3049114A1/en
Publication of WO2018129092A1 publication Critical patent/WO2018129092A1/en
Anticipated expiration legal-status Critical
Priority to JP2023001681A priority patent/JP2023033394A/ja
Priority to JP2025016938A priority patent/JP2025067928A/ja
Priority to JP2025104762A priority patent/JP2025126236A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/50Isolated enzymes; Isolated proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/0208Specific bacteria not otherwise provided for
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/085Staphylococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/102Pasteurellales, e.g. Actinobacillus, Pasteurella; Haemophilus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/104Pseudomonadales, e.g. Pseudomonas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/02Nasal agents, e.g. decongestants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/02Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/1214Pseudomonadaceae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/1242Gram-negative bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1271Micrococcaceae (F); Staphylococcaceae (F), e.g. Staphylococcus (G)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911Bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/52Bacterial cells; Fungal cells; Protozoal cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/195Assays involving biological materials from specific organisms or of a specific nature from bacteria
    • G01N2333/285Assays involving biological materials from specific organisms or of a specific nature from bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present disclosure generally relates to methods and compositions to lessen and/or cure bacterial biofilms and treat diseases or disorders associated with biofilms using novel antibody fragments and compositions containing these fragments.
  • At least one protein from the DNABII family of proteins is found in all known eubacteria and are naturally found outside of the bacterial cell. While the family elicits a strong innate immune response, host subjects fail to naturally produce specific protective antibody to family members as a result of infection.
  • the DNABII protein and extracellular DNA (eDNA) contribute to the lattice structure of a "biofilm.”
  • the major problem with bacterial biofilms is the inability of the host immune system and/or antibiotics and other antimicrobials to gain access to the bacteria protected within the biofilm.
  • Biofilms are present in an industrial setting as well.
  • biofilms are implicated in a wide range of petroleum process problems, from the production field to the gas station storage tank.
  • sulfate reducing biofilm bacteria produce hydrogen sulfide (soured oil).
  • biofilm activity develops slimes which impede filters and orifices.
  • Biofilm and biofilm organisms also cause corrosion of pipeline and petroleum process equipment.
  • biofilms are found in or on any surface that supports microbial growth, e.g., in drains, on food preparation surfaces, in toilets, and in swimming pools and spas.
  • Biofilms are implicated in a wide range of water processes, both domestic and industrial. They can grow on the surface of process equipment and impede the performance of the equipment, such as degradation of heat transfer or plugging of filters and membranes.
  • Biofilms growing on a cooling tower fill can add enough weight to cause collapse of the fill. Biofilms cause corrosion of even highly specialized stainless steels. Biofilms in a water process can degrade the value of a final product such as biofilm contamination in a paper process or the attachment of even a single cell on a silicon chip. Biofilms growing in drinking water distribution systems can harbor potential pathogenic organisms, corrosive organisms or bacteria that degrade the aesthetic quality of the water.
  • SEQ ID NO. 1 Full Length Wild type (wt) 86-028NP Haemophilus influenzae IhfA;
  • SEQ ID NO. 2 Full Length Wild type (wt) 86-028NP Haemophilus influenzae IhfB;
  • SEQ ID NO. 3 Full Length wt 86-028NP Haemophilus influenzae HU, Genbank Accession No. : YP_248142.1, last accessed Mar. 21, 2011 :
  • SEQ ID NO. 4 Full Length wt R2846 Haemophilus influenzae IhfA, Genbank Accession No. : AD096375, last accessed Mar. 21, 2011 :
  • SEQ ID NO. 5 Full Length wt Rd Haemophilus influenzae IhfA; Genbank Accession No. : AAC22959.1, last accessed Mar. 21, 2011 : M ATITKLDIIE YL SDK YHL SKQDTKN VVE FLEEIRL SLE S GQD VKL S GF G FELRDK S SRPGRNPKTGD VVP VS ARRVVTFKPGQKLRARVEKTK.
  • SEQ ID NO. 6 Full Length wt E. coli K12 IhfA; Genbank Accession No. : AAC74782.1, last accessed Mar. 21, 2011 :
  • SEQ ID NO. 7 Full Length wt E. coli K12 Ihffi; Genbank Accession No. : BAA35656, last accessed May 19, 2015:
  • SEQ ID NO. 8 E. coli hupA, Genbank Accession No. : AP_003818, Last accessed Mar. 21 , 2011 :
  • SEQ ID NO. 9 E. coli hupB, Genbank Accession No. : AP 001090.1, Last accessed Mar. 21, 2011 :
  • SEQ ID NO. 10 Full Length wt P. aeruginosa PA 01 IhfA; Genbank Accession No.:
  • SEQ ID NO. 11 Full Length wt P. aeruginosa PA 01 IhfB; Genbank Accession No.:
  • SEQ ID NO. 12 Haemophilus influenzae IhfA, A-3 fragment:
  • SEQ ID NO. 13 Haemophilus influenzae IhfA, A5 fragment:
  • RPGRNPKTGDVVPVSARRVV SEQ ID NO. 14: Haemophilus influenzae HU, A5 fragment: RTGRNPQTGAEIQIAASKVP.
  • SEQ ID NO. 15 Haemophilus influenzae IhfB, B2 fragment: TLSAKEIENMVKDILEFISQ.
  • SEQ ID NO. 16 Haemophilus influenzae IhfB, B4 fragment:
  • SEQ ID NO. 17 Haemophilus influenzae IhfB, modified B4 (mB4) fragment:
  • SEQ ID NO. 18 Haemophilus influenzae IhfA, A-l fragment:
  • SEQ ID NO. 19 Haemophilus influenzae IhfA, A2 fragment:
  • SEQ ID NO. 20 Haemophilus influenzae IhfA, A4 fragment:
  • SEQ ID NO. 21 Haemophilus influenzae IhfA, A6 fragment:
  • SEQ ID NO. 22 Haemophilus influenzae IhfB, Bl fragment:
  • SEQ ID NO. 23 Haemophilus influenzae IhfB, B3 fragment:
  • SEQ ID NO. 24 Haemophilus influenzae IhfB, B5 fragment:
  • SEQ ID NO. 25 Haemophilus influenzae IhfB, B6 fragment:
  • SEQ ID NO. 26 Haemophilus influenzae IhfA, A tip fragment:
  • SEQ ID NO. 27 Haemophilus influenzae IhfB, B tip fragment:
  • SEQ ID NO. 29 Haemophilus influenzae HU, fragment: KKQAKAALEATLDAITASLKEG.
  • SEQ ID NO. 30 Haemophilus influenzae HU, fragment: SLKEGEPVQLIGFGTFKVNERA.
  • SEQ ID NO. 32 Haemophilus influenzae HU, fragment: IQIAASKVPAFVSGKALKDAIK.
  • SEQ ID NO. 33 Haemophilus influenzae HU, A3 fragment:
  • SEQ ID NO. 34 Human IgD constant region, Uniprot: P01880:
  • SEQ ID NO. 35 Human IgGl constant region, Uniprot: P01857:
  • SEQ ID NO. 36 Human IgG2 constant region, Uniprot: P01859:
  • SEQ ID NO. 37 Human IgG3 constant region, Uniprot: P01860:
  • SEQ ID NO. 38 Human IgM constant region, Uniprot: P01871 :
  • SEQ ID NO. 39 Human IgG4 constant region, Uniprot: P01861 :
  • SEQ ID NO. 40 Human IgAl constant region, Uniprot: P01876:
  • SEQ ID NO. 41 Human IgA2 constant region, Uniprot: P01877:
  • ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQD ASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSL HRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVS SVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNE LVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVA AEDWKKGDTFSCMVGHEALPLAFTQKTIDRMAGKPTHVNVSVVMAEVDGTCY.
  • SEQ ID NO. 42 Human Ig kappa constant region, Uniprot: P01834:
  • Non- ⁇ limiting exemplary linker GPSLKL.
  • SEQ ID NO. 44 Non- ⁇ limiting exemplary linker: GGG.
  • Non- ⁇ limiting exemplary linker GPSL.
  • SEQ ID NO. 46 Non- ⁇ limiting exemplary linker: GPS.
  • SEQ ID NO. 47 Non- ⁇ limiting exemplary linker: PSLK.
  • SEQ ID NO. 48 Non- ⁇ limiting exemplary linker: GPSLK.
  • SEQ ID NO. 49 Non- ⁇ limiting exemplary linker: SLKL.
  • SEQ ID NO. 50 Non- ⁇ limiting exemplary heavy chain variable region nucleotide sequence
  • SEQ ID NO. 51 Non-limiting exemplary heavy chain variable region amino acid sequence, IhfA5 fragment:
  • SEQ ID NO. 52 Non-limiting exemplary heavy chain variable region nucleotide sequence, IhfmB4 fragment:
  • SEQ ID NO. 53 Non-limiting exemplary heavy chain variable region amino acid sequence, IhfmB4 fragment:
  • SEQ ID NO. 54 Non-limiting exemplary light chain variable region nucleotide sequence, IhfA5 fragment:
  • SEQ ID NO. 55 Non-limiting exemplary light chain variable region amino acid sequence, IhfA5 fragment:
  • SEQ ID NO. 56 Non-limiting exemplary light chain variable region nucleotide sequence, IhfmB4 fragment:
  • SEQ ID NO. 57 Non-limiting exemplary light chain variable region amino acid sequence, IhfmB4 fragment: DVVMTQIPLTLSVTIGQPASISCKSSQSLLDSNGKTYLNWLFQRPGQSPKRLIYLVSKL DSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQSTHFPHTFGGGTKLEIK.
  • SEQ ID NO. 58 Partial non-limiting exemplary CDRHl sequence, IhfA5 fragment:
  • SEQ ID NO. 59 Partial non-limiting exemplary CDRHl sequence, IhfA5 fragment:
  • SEQ ID NO. 60 Partial non-limiting exemplary CDRHl sequence, IhfA5 fragment:
  • SEQ ID NO. 61 Partial non-limiting exemplary CDRHl sequence, IhfA5 fragment:
  • SEQ ID NO. 62 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 63 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 64 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 65 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 66 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 67 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 68 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 69 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • SEQ ID NO. 70 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment:
  • LGVIWAGGSTN SEQ ID NO. 71 : Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: WLGVIWAGGSTN.
  • SEQ ID NO. 72 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: IWAGGSTNY.
  • SEQ ID NO. 73 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: VIWAGGSTNY.
  • SEQ ID NO. 74 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: GVIWAGGSTNY.
  • SEQ ID NO. 75 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: LGVIWAGGSTNY.
  • SEQ ID NO. 76 Partial non-limiting exemplary CDRH2 sequence, IhfA5 fragment: WLGVIWAGGSTNY.
  • SEQ ID NO. 77 Partial non-limiting exemplary CDRH3 sequence, IhfA5 fragment: REDS.
  • SEQ ID NO. 78 Partial non-limiting exemplary CDRH3 sequence, IhfA5 fragment: AREDS.
  • SEQ ID NO. 79 Partial non-limiting exemplary CDRL1 sequence, IhfA5 fragment: QNVGTN.
  • SEQ ID NO. 80 Partial non-limiting exemplary CDRL1 sequence, IhfA5 fragment: QNVGTNV.
  • SEQ ID NO. 81 Partial non-limiting exemplary CDRL1 sequence, IhfA5 fragment: QNVGTNVA.
  • SEQ ID NO. 82 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: SAS.
  • SEQ ID NO. 83 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: YSAS.
  • SEQ ID NO. 84 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: IYSAS
  • SEQ ID NO. 85 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: LIYSAS.
  • SEQ ID NO. 86 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: ALIYSAS.
  • SEQ ID NO. 87 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: SASY.
  • SEQ ID NO. 88 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: YSASY.
  • SEQ ID NO. 89 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: IYSASY.
  • SEQ ID NO. 90 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: LIYSASY.
  • SEQ ID NO. 91 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: ALIYSASY.
  • SEQ ID NO. 92 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: SASYR.
  • SEQ ID NO. 93 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: YSASYR.
  • SEQ ID NO. 94 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: IYSASYR.
  • SEQ ID NO. 95 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: LIYSASYR.
  • SEQ ID NO. 96 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: ALIYSASYR.
  • SEQ ID NO. 97 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: SASYRY.
  • SEQ ID NO. 98 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: YSASYRY.
  • SEQ ID NO. 99 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: IYSASYRY.
  • SEQ ID NO. 100 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: LIYSASYRY.
  • SEQ ID NO. 101 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: ALIYSASYRY.
  • SEQ ID NO. 102 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: SASYRYS.
  • SEQ ID NO. 103 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: YSASYRYS.
  • SEQ ID NO. 104 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: I YSASYRYS.
  • SEQ ID NO. 105 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: LIYSASYRYS.
  • SEQ ID NO. 106 Partial non-limiting exemplary CDRL2 sequence, IhfA5 fragment: ALIYSASYRYS.
  • SEQ ID NO. 107 Non-limiting exemplary linker: GGSGGS.
  • SEQ ID NO. 108 Partial non-limiting exemplary CDRL3 sequence, IhfA5 fragment: QQYNSYP.
  • SEQ ID NO. 109 Partial non-limiting exemplary CDRL3 sequence, IhfA5 fragment: QQYNSYPT.
  • SEQ ID NO. 110 Partial non-limiting exemplary CDRH1 sequence, IhfmB4 fragment: FNIKDYY.
  • SEQ ID NO. 112 Partial non-limiting exemplary CDRH1 sequence, IhfmB4 fragment: FNIKDYYMH.
  • SEQ ID NO. 113 Partial non-limiting exemplary CDRH1 sequence, IhfmB4 fragment: GFNIKDYY.
  • SEQ ID NO. 1 14 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IDPENDDT.
  • SEQ ID NO. 1 15 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: WIDPENDDT.
  • SEQ ID NO. 1 16 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: GWIDPENDDT.
  • SEQ ID NO. 117 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IGWIDPENDDT.
  • SEQ ID NO. 1 18 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: WIGWIDPENDDT.
  • SEQ ID NO. 1 19 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IDPENDDTE.
  • SEQ ID NO. 120 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: WIDPENDDTE.
  • SEQ ID NO. 121 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: GWIDPENDDTE.
  • SEQ ID NO. 122 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IGWIDPENDDTE.
  • SEQ ID NO. 123 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: WIGWIDPENDDTE.
  • SEQ ID NO. 124 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IDPENDDTEY.
  • SEQ ID NO. 125 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: WIDPENDDTEY.
  • SEQ ID NO. 126 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: GWIDPENDDTEY.
  • SEQ ID NO. 127 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment: IGWIDPENDDTEY.
  • SEQ ID NO. 128 Partial non-limiting exemplary CDRH2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 129 Partial non-limiting exemplary CDRH3 sequence, IhfmB4 fragment:
  • SEQ ID NO. 130 Partial non-limiting exemplary CDRL1 sequence, IhfmB4 fragment:
  • SEQ ID NO. 131 Partial non-limiting exemplary CDRL1 sequence, IhfmB4 fragment:
  • SEQ ID NO. 132 Partial non-limiting exemplary CDRL1 sequence, IhfmB4 fragment:
  • SEQ ID NO. 133 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LVS.
  • SEQ ID NO. 134 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 135 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 136 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 137 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 138 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 139 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 140 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 141 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • SEQ ID NO. 142 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment:
  • RLIYLVSK SEQ ID NO. 143 : Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LVSKL.
  • SEQ ID NO. 144 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: YLVSKL.
  • SEQ ID NO. 145 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: IYLVSKL.
  • SEQ ID NO. 146 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LIYLVSKL.
  • SEQ ID NO. 147 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: RLIYLVSKL.
  • SEQ ID NO. 148 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LVSKLD.
  • SEQ ID NO. 149 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: YLVSKLD.
  • SEQ ID NO. 150 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: IYLVSKLD.
  • SEQ ID NO. 151 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LIYLVSKLD.
  • SEQ ID NO. 152 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: RLIYLVSKLD.
  • SEQ ID NO. 153 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LVSKLD S
  • SEQ ID NO. 154 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: YLVSKLD S.
  • SEQ ID NO. 155 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: IYLVSKLDS.
  • SEQ ID NO. 156 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: LIYLVSKLD S.
  • SEQ ID NO. 157 Partial non-limiting exemplary CDRL2 sequence, IhfmB4 fragment: RLIYLVSKLDS.
  • SEQ ID NO. 158 Partial non-limiting exemplary CDRL3 sequence, IhfmB4 fragment: WQSTHFPH.
  • SEQ ID NO. 159 Partial non-limiting exemplary CDRL3 sequence, IhfmB4 fragment: WQSTHFPHT.
  • Table 1 is a listing of hybridomas producing non-limiting exemplary antibodies.
  • Table 2 is a non-limiting list of exemplary antibodies and their corresponding CDRs.
  • Table 3 is a non-limiting list of exemplary antibodies and their corresponding heavy chain and light chain variable regions.
  • Table 4 is a summary of the scoring methodology used in the otitis media model of Example 3 to generate a mucosal biomass score.
  • Table 5 is a summary of the efficacies of IgG Fab fragments versus intact rabbit polyclonal and mouse monoclonal IgG.
  • the DNABII proteins are DNA binding proteins that necessarily bend DNA substrates upon binding. Similarly, DNA that is already in a bent conformation is an exemplary substrate as the energy required for bending is rendered unnecessary.
  • the DNABII family is a member of a class of proteins referred to as nucleoid associated proteins (NAPs), bacterial proteins that, in part, shape the intracellular bacterial nucleoid (Browning et al. (2010) Curr. Opin. Microbiol. 13 :773-780). In addition, this family is ubiquitous, expressed by virtually all eubacteria. All characterized family members to date function as either a homodimer or heterodimer of subunits. The family is divided into two types, HU (histone-like protein) and IHF (integration host factor).
  • HU histone-like protein
  • IHF integration host factor
  • HU binds DNA in a sequence independent manner
  • IHF binds a consensus sequence (WATCAANNNNTTR where W is A or T and R is a purine and N is any base (SEQ ID NO. 160)) conserved across genera (Swinger et al. (2004) Curr. Opin. Struct. Biol. 14:28-35).
  • All DNABII proteins bind to and bend DNA considerably, e.g., E. coli IHF can bend DNA into a virtual U-turn (Rice et al. (1996) Cell 87: 1295-1306).
  • DNABII proteins function as accessory factors facilitating all intracellular DNA functions, including gene expression, recombination, repair and replication (Swinger et al. (2004) Curr. Opin. Struct. Biol. 14:28-35).
  • Applicants provide an antibody or antigen binding fragments of antibodies that are specific to DNABII polypeptides.
  • the antibody or antigen binding fragments upon administration to the host, will reduce or eradicate an existing or pre-formed biofilm.
  • this disclosure relate to one or more antibody or antigen bindng fragments that specifically bind to a DNABII polypeptide and their use in dissolving, remediating, or disrupting a biofilm in vitro or in vivo.
  • the antibody or antigen binding fragment is described as an isolated polypeptide that comprises, or alternatively consists essentially of, or yet further consists of a Fab fragment of an antibody that specifically recognizes and binds a
  • conformational tip region of a DNABII binding polypeptide produced by any appropriate organism e.g., an Haemophilus influenzae IHF alpha, IHF beta or an HU polypeptide.
  • any appropriate organism e.g., an Haemophilus influenzae IHF alpha, IHF beta or an HU polypeptide.
  • Non- limiting examples of such are selected from the group of the conformational tip regions designed an A5 or mB4 peptide fragment, or an equivalent of each thereof.
  • the fragment is derived from an mIhfB4 NH -n antibody or an equivalent of the antibody.
  • the fragment is of derived from an IHF A5 antibody or an equivalent of the antibody.
  • the disclosure relates to an isolated polypeptide comprising, or alternatively consisting essentially of a Fab fragment of an mIhfB4 N THi antibody or A5 antibody or an equivalent of each of these polypeptides.
  • the disclosure relates to an isolated polypeptide consisting essentially of a Fab fragment of an IHF fragment B4, a mIhfB4 or A5 antibody or an equivalent of each of the polypeptide.
  • the antibody fragment or antigen binding fragment is derived from polyclonal sera.
  • the antibody fragment or antigen binding fragment is not derived from a polyclonal antibody.
  • the antibody fragment or antigen binding fragment is derived from a monoclonal antibody.
  • Table 1 lists non-limiting exemplary monoclonal antibodies that can derive the fragments and polypeptides containing the fragments of this disclosure and the hybridomas that produce them.
  • the hybridoma cell lines that produce monoclonal antibodies that specifically recognize and bind Haemophilus influenzae IhfA fragment A5 (SEQ ID NO. 13) or IhfB fragment B4 (SEQ ID NO. 16), and IhfB fragment mB4 (SEQ ID NO. 17) were deposited with American Type Culture Collection (ATCC) under the listed Accession Numbers in Table 1 and pursuant to the provisions of the Budapest Treaty on July 30, 2015.
  • Non-limiting exemplary antibodies include those that specifically recognize and bind Haemophilus influenzae IhfA fragment A3 (SEQ ID NO. 12) or IhfB fragment B2 (SEQ ID NO. 15) produced by hybridoma cell lines IhfA3 NTHI 9B10.F2.H3, IhfB2 NTHI 7A4.E4.G4, and IhfB2 NTHI 7A4.E4.G11 (deposited with American Type Culture Collection (ATCC) under the Accession Numbers listed in Table 1 and pursuant to the provisions of the Budapest Treaty on August 1, 2016); and antibodies that specifically recognize or bind a polypeptide comprising a polypeptide selected from the group of: SEQ ID NO. 31, SEQ ID NO. 33, a DNA BII polypeptide comprising the amino acid sequence NPXT (wherein X is any amino acid or alternatively X is selected from the amino acids Q, R, K, S, or T), or an equivalent of each thereof.
  • the antibodies and fragments derived from the antibodies of this disclosure can be from a mammalian polyclonal antibody.
  • the mammalian polyclonal antibody is selected from the group of a rabbit polyclonal antibody, a murine polyclonal antibody, a sheep polyclonal antibody, an equine polyclonal antibody, a canine polyclonal antibody, or a human polyclonal antibody.
  • the antibody is monoclonal antibody.
  • the antibody is a monoclonal antibody, a humanized antibody or a human antibody.
  • mammalian monoclonal antibody is selected from the group of a rabbit monoclonal antibody, a murine monoclonal antibody, a sheep monoclonal antibody, an equine monoclonal antibody, or a canine monoclonal antibody.
  • the antibody is a monoclonal antibody produced by a hybridoma listed in Table 1.
  • the antibodies can be of any isotype, e.g., IgM or IgG.
  • the isolated antibody fragments further comprising a detectable and/or a purification label.
  • compositions comprising, consisting essentially of, or yet further consisting of, the polypeptide as described herein and a carrier, non-limting examples of such include a preservative or a stabilizer.
  • the composition is processed for ease of transport, e.g., lyophilization.
  • an isolated polynucleotide encoding the antibody fragment or a polypeptide as described herein.
  • the isolated polynucleotide further comprises a detectable and/ or a purificiaton label.
  • the detectable label is not a conjugated naturally occurring flourescnet polynucleotide.
  • the isolated polynucleotide is operably linked to one or more regulatory elements for replication and/or expression, that optionally is contained within an expression vector or a host cell.
  • composition comprising, consisting essentially of, or yet further consisting of, the isolated polynucleotide as described herein and a carrier.
  • the carrier comprises a preservative or stabilizer.
  • a vector and/or host cell comprising the isolated polynucleotide, that optionally comprises an expression or replication vecor as described herein.
  • the host cell is a prokaryotic cell or a eukaryotic cell, non-limiting examples of such are disclosed herein.
  • a method for producing a polypeptide as described herein comprising, or alternatively consisting essentiall of, or yet further consisting of, culturing the isolated host cell disclosed herein under conditions that allow for the expression of polynucleotide to a polypeptide.
  • the method further comprises isolating the polypeptide expressed from the polypeptide from the host cell or cell culture medium.
  • the host cell can be a eukaryotic or a prokaryotic cell.
  • a method to prevent formation of or to disrupt a biofilm associated with an industrial process comprising treating a surface susceptible to or containing a biofilm with the antibody fragment, antigen binding fragment, or polypeptide as described herein.
  • a method to identify a binding moiety e.g., an antibody, antigen binding fragment, small molecule or an other agent, that disrupts a biofilm, comprising contacting a candidate binding moiety with a biofilm component and with the at least one polypeptide as described herein and assaying for the binding of the binding moiety to the DNABII in the biofilm as compared to the binding of the polypeptide as described herein to the DNABII in the biofilm, wherein a binding moiety with substantially the same or greater binding as compared to the binding of the polypeptide is a binding moiety that disrupts a biofilm.
  • a binding moiety e.g., an antibody, antigen binding fragment, small molecule or an other agent
  • an agent e.g., an antibody, an antigen binding agent, a small molecule, a polynucleotide or other therapeutic or diagnostic agent, that reverses drug resistance in multiple species of bacteria
  • evaluating an agent for activity in disrupting biofilms produced by multiple species wherein an agent which disrupts the biofilms with substantial equivalent activity as an antibody fragment, antigen binding fragment or a polypeptide described herein (and optionally wherein an agent that binds a multiplicity of said proteins) is identified as an agent that reverses drug resistance.
  • the agent will be effective against biofilms derived from at least two bacterial species, including gram positive and gram negative species, non-limiting examples of such include S. aureus, P. aeruginosa, and B. cenocepacia.
  • a method to treat a condition in a subject characterized by the formation of a biofilm and/or to detect the formation of a biofilm in the subject comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject in need thereof or treating the subject in need thereof with the antibody fragment, antigen binding fragment or the polypeptide as described herein.
  • the amount to be administered must be an effective amount to disrupt or detect the biofilim.
  • the method further comprises imaging and/or monitoring biofilm formation and/or disruption in the subject before, during and after administration of the composition containing the antibody fragment, antigen binding fragment or polypeptide as described herein.
  • the antibody fragment, antigen binding fragment or polypeptide when the biofilm is to be detected, is chemically modified. In one aspect, when the biofilm is to be detected, the antibody fragment, antigen binding fragment or polypeptide is conjugated to a diagnostic agent or detectable label or agent. In one aspect, when the biofilm is to be detected, the method further comprises observing complexation of the antibody fragment, antigen binding fragment or polypeptide as described herein with any biofilm present.
  • the condition to be treated is selected from the group of: chronic non-healing wounds, including venous ulcers and diabetic foot ulcers, ear infections, sinus infections, urinary tract infections, pulmonary infections, cystic fibrosis, chronic obstructive pulmonary disease, catheter-associated infections, infections associated with implanted prostheses, or periodontal disease.
  • a method to monitor the development or progression of a condition in a subject characterized by the formation of a biofilm comprising treating or administering to the subject the antibody fragment, antigen binding fragment or polypeptide as described herein.
  • the method further comprises observing complexation of the antibody fragment, antigen binding fragment or polypeptide as described herein with any biofilm present.
  • the polypeptide is chemically modified.
  • the polypeptide is conjugated to a diagnostic agent or detectable label or agent.
  • a method to monitor the treatment of a condition in a subject characterized by the formation of a biofilm comprising, or alternatively consisting essentially of, or yet further consisting of, administering the subject the antibody fragment, antigen binding fragment or polypeptide as described herein.
  • the method further comprises imaging and/or monitoring biofilm formation and/or disruption in the subject.
  • the polypeptide is chemically modified.
  • the amino acids are amino acids that are amino acids that are antibodies to be administered to the subject.
  • polypeptide is conjugated to a detectable label or a diagnostic agent.
  • a method to prevent formation of or to disrupt a biofilm in a subject in need thereof comprising, or alternatively consisting essentially of, or yet further consisting of administering to the subject an effective amount of antibody fragment, antigen binding fragment or polypeptide as decribed herein.
  • provided herein is one or method(s) such as: to treat a subject infected with a organism that produces a biofilm, to disrupt a biofilm in a subject, and/or to treat a subject suffering from a condition associated with the presence of a biofilm, comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject an effective amount of the antibody fragment, antigen binding fragment or polypeptide as described herein, and further wherein the antibody fragment, antigen binding fragment or polypeptide induces the production of anti-inflammatory cytokines in the subject.
  • the anti-inflammatory cytokine comprises one or more of IL-4, IL-13, or IL-10.
  • the subject is a mammal.
  • the mammal is a human.
  • the subject is a pediatric patient.
  • kits comprising the isolated antibody fragment, antigen binding fragment or polypeptide as described herein and instructions for use.
  • the kit may be used for diagnostic or therapeutic use and therefore comprise the isolated antibody fragment, antigen binding fragment or polypeptide as described herein and instructions for use.
  • the kit may be used to monitor biofilm formation and/or disruption.
  • the kit further comprises an effective amount of a detectable or diagnostic label and/or an antibiotic.
  • FIG. 1 depicts the generation of Fabs by digestion of monoclonal antibodies.
  • Fab fragments were generated by digestion of murine monoclonal antibodies with ficin in the presence of cysteine (see Mariani et al., A new enzymatic method to obtain high-yield F(ab)2 suitable for clinical use from mouse IgGl, Molec. Immunol. (1991) Jan-Feb; 28(l-2):69-77. PMID: 2011130).
  • Fab fragments were purified and the purity of each preparation was assessed using 10% Bis-Tris PAGE (BioRad) and Coomassie Fluor Orange.
  • FIG. 2 depicts the disruption of biofilms formed by Haemophilus influenzae (NTHI) 86-028 P upon incubation with mAb mIhfB4 NTH i Fab (also referred to in this disclosure as IHF mB4 or alternatively as mB4).
  • NTHI biofilms were incubated with medium (control), mAb IgGl Fab (control), mAb IhfB2 N THi Fab, and mAb mIhfB4 N THi Fab.
  • FIG. 3 depicts the disruption of biofilms formed by Haemophilus influenzae (NTHI) 86-028NP, S. aureus 29213, P. aeruginosa 27853, and B. cenocepacia K56-2 upon incubation with mAb mIhfB4 NTH i Fab.
  • cenocepacia K56-2 were incubated with murine IgGl, Murine IgGl Fab, mAb 3 ⁇ 41 ⁇ 2 ⁇ , mAb IhfB2NTHi Fab, mAb mIhfB4NTHi, and mAb mIhfB4 N THi Fab.
  • FIG. 4 depicts the method by which the disruption of biofilms formed by
  • Haemophilus influenzae (NTHI) 86-028NP was analyzed in the middle ear of adult chinchillas. At day zero (0), 1000 colony forming units (CFU) Haemophilus influenzae (NTHI) 86-028NP were inoculated into the middle ear of adult chinchillas. At day 4, 83- 100% of ears develop a mucosal biofilm, as shown. At days 4 and 5, Fab fragments were administered by direct delivery into the middle ear (342 nM).
  • FIG. 5(A) depicts the mean otoscopy scores at days 4, 5, and 6 after Haemophilus influenzae (NTHI) 86-028 P challenge for chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab.
  • NTHI Haemophilus influenzae
  • FIG. 5(A) depicts the mean otoscopy scores at days 4, 5, and 6 after Haemophilus influenzae (NTHI) 86-028 P challenge for chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab.
  • NTHI Haemophilus influenzae
  • FIG. 5(B) shows representative otoscopy images at day 0, day 4, and day 6 after Haemophilus influenzae (NTHI) 86-028NP challenge for chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab.
  • NTHI Haemophilus influenzae
  • middle ear fluid is seen in chinchillas administered IgGl Fab (control) and thickening of the tympanic membrane can be seen in chinchillas administered IhfB2 NTH i Fab, which indicate the presence of otitis media in these animals.
  • a non-inflamed tympanic membrane is seen in chinchillas administered mAb mIhfB4NTHi Fab.
  • FIG. 6(A) shows quantitations of colony forming units (CFU) Haemophilus influenzae (NTHI) 86-028NP per milligram (mg) of mucosal biofilm in chinchillas administered either IgGl Fab, IhfB2 NTHI Fab, or murine mAb mIhfB4 NTHI Fab after
  • FIG. 6(B) shows quantitations of colony forming units (CFU) Haemophilus influenzae (NTHI) 86-028NP per milligram (mg) of middle ear fluid in chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab after
  • NTHI Haemophilus influenzae 86-028NP challenge and biofilm formation.
  • FIG. 7(A) shows quantitations of mass (grams, g) of middle ear mucosa and mucosal biofilm collected from chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4N TH i Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation. Quantitations were performed on day 6 after Haemophilus influenzae (NTHI) 86-028 P challenge (treatments were performed on days 4 and 5).
  • FIG. 7(A) shows quantitations of mass (grams, g) of middle ear mucosa and mucosal biofilm collected from chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4N TH i Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation. Quantitations were performed
  • FIG. 7(B) shows quantitations of volume (microliters, mL) of middle ear fluid (MEF) retrieved from chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation.
  • MEF middle ear fluid
  • FIG. 8(A) shows mucosal biomass scores reviewed blindly by 7 individuals for chinchillas administered either IgGl Fab, IhfB2 NTHI Fab, or mIhfB4 NTHI Fab after
  • Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation A mucosal biofilm score scale was used to rank the residual biofilm within the middle ear space.
  • a score of 0 to 4 was assigned to each image, as follows: zero (0): no biofilm visible; 1 : biofilm fills >0 to ⁇ 25% of middle ear space; 2: biofilm fills >25% to ⁇ 50% of middle ear space; 3 : biofilm fills >50% to ⁇ 75% middle ear space; and 4: biofilm fills >75% to ⁇ 100% middle ear space.
  • FIG. 8(B) depicts representative middle ear images obtained by otoscopy 1 day after receipt of final dose of either IgGl Fab, IhfB2 N THi Fab, or murine mAb mIhfB4 N THi Fab after
  • NTHI Haemophilus influenzae 86-028NP challenge and biofilm formation.
  • FIG. 9 shows the relative quantity of a panel of pro- and anti-inflammatory cytokines in clarified middle ear fluids (IL- ⁇ , IL-6, IL-8, IL-10, IL-17A, IL-12p70, and TNF) in chinchillas administered either IgGl Fab, IhfB2 N THi Fab, or mIhfB4 N THi Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation. Quantitation was performed to provide picogram (pg) cytokine per milliliter (ml) MEF.
  • FIG. 10 shows a histologic analysis of the middle ear in chinchillas.
  • the image on the left shows the middle ear from an animal administered murine IhfB2 N THi Fab control.
  • the image on the right shows the middle ear from an animal administered murine
  • FIG. 11 depicts the method by which the disruption of biofilms formed by
  • Haemophilus influenzae (NTHI) 86-028NP was analyzed in the middle ear of adult chinchillas using Fab fragments generated from polyclonal rabbit anti-IhfB2 N THi, anti- mIhfB4 N THi, and naive rabbit serum. Experiments included cohorts using naive rabbit serum IgG Fab fragments, rabbit anti-IhfB2 N THi Fab fragments, and rabbit anti-mIhfB4 N THi Fab fragments. On day zero (0), Haemophilus influenzae (NTHI) 86-028 P was inoculated into the middle ear of chinchillas.
  • Fab fragments were administered by direct delivery into the middle ear (342 nM).
  • three (3) chinchillas per cohort were sacrificed either on day 6 or day 12.
  • three (3) chinchillas per cohort were sacrificed on day 13.
  • chinchillas were imaged, middle ear mucosa was collected, adherent biofilm was assessed, middle ear fluids were collected, quantitation of bacteria was performed, and middle ear fluids were assessed using a cytokine multiplex assay.
  • each Fab preparation is also shown (3 separate preparations: naive, IhfB2, and mIhfB4), as confirmed by 10% Bis-Tris PAGE (BioRad) and SYPRO Orange Protein Gel stain (Invitrogen).
  • FIG. 12 shows quantitations of colony forming units (CFU) Haemophilus influenzae (NTHI) 86-028NP per milligram (mg) of mucosal biofilm in chinchillas administered either rabbit IgGl Fab, rabbit IhfB2 NTH i Fab, or rabbit mIhfB4 NTHI Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation.
  • Quantitations were performed in three different experiments, as follows: (1) two doses of the respective Fabs were administered, followed by sacrifice 1 day later; (2) two doses of the respective Fabs were administered, followed by sacrifice 7 days later; and (3) three doses of the respective Fabs were administered, followed by sacrifice 7 days later.
  • Doses of Fabs were administered on days 4 and 5 (two doses) or on days 4, 5, and 6 (three doses) after
  • Haemophilus influenzae (NTHI) 86-028NP challenge The P value is shown: ** P ⁇ 0.01.
  • FIG. 13 shows quantitations of colony forming units (CFU) Haemophilus influenzae (NTHI) 86-028NP per milliliter (ml) of middle ear fluid in chinchillas
  • FIG. 14 shows mean mucosal biofilm scores (7 blinded reviewers) for chinchillas administered either rabbit IgGl Fab, ⁇ ⁇ 2 ⁇ Fab, or ⁇ ⁇ 4 ⁇ Fab after Haemophilus influenzae (NTHI) 86-028 P challenge and biofilm formation. Quantitations were performed in three different experiments, as follows: (1) two doses of the respective Fabs were administered, followed by sacrifice 1 day later; (2) two doses of the respective Fabs were administered, followed by sacrifice 7 days later; and (3) three doses of the respective Fabs were administered, followed by sacrifice 7 days later.
  • Fabs were administered on days 4 and 5 (two doses) or on days 4, 5, and 6 (three doses) after Haemophilus influenzae (NTHI) 86-028NP challenge.
  • a mucosal biofilm score scale was used to rank the residual biofilm within the middle ear space.
  • a score of 0 to 4 was assigned to each image, as follows: zero (0): no biofilm visible; 1 : biofilm fills >0 to ⁇ 25% of middle ear space; 2: biofilm fills >25% to ⁇ 50% of middle ear space; 3 : biofilm fills >50% to ⁇ 75% middle ear space; and 4: biofilm fills >75% to 100% middle ear space.
  • P values are shown: *P ⁇ 0.05 and * *P ⁇ 0.01.
  • FIG. 15 shows the relative quantity of a panel of pro- and anti-inflammatory cytokines in clarified middle ear fluids in chinchillas administered either naive rabbit IgG Fab, rabbit anti-mIhfB2NTHi IgG Fab, or rabbit anti-mIhfB4NTHi IgG Fab after Haemophilus influenzae (NTHI) 86-028NP challenge and biofilm formation.
  • compositions and methods include the recited elements, but do not exclude others.
  • Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the intended use.
  • compositions consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives (e.g., sodium benzoate, potassium sorbate, and methyl hydroxybenzoate), and the like.
  • pharmaceutically acceptable carriers such as phosphate buffered saline, preservatives (e.g., sodium benzoate, potassium sorbate, and methyl hydroxybenzoate), and the like.
  • Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Embodiments defined by each of these transition terms are within the scope of this disclosure.
  • a "biofilm” intends an organized community of microorganisms that at times adhere to the surface of a structure, that may be organic or inorganic, together with the polymers such as DNA that they secrete and/or release.
  • the biofilms are very resistant to microbiotics and antimicrobial agents. They live on gingival tissues, teeth and restorations, causing caries and periodontal disease, also known as periodontal plaque disease. They also cause middle ear infections. Biofilms can also form on the surface of dental implants, stents, catheter lines and contact lenses. They grow on pacemakers, heart valve replacements, artificial joints and other surgical implants. The Centers for Disease Control) estimate that over 65% of nosocomial (hospital-acquired) infections are caused by biofilms.
  • Biofilms also are involved in numerous diseases, including but not limited to those caused by Aggregatibacter actinomycetemcomitans, Borrelia burgdorferi (e.g., B31), Bordetella pertussis (e.g., Tohama I), Burkholderia pseudomallei (e.g., 668), Burkholderia cenocepacia (e.g., HI2424), Escherichia coli (e.g., K12 MG1655), Enterococcus
  • faecalis e.g., V583
  • Haemophilus influenzae e.g., Rd KW20
  • Helicobacter pylori e.g., 26695
  • Klebsiella pneumoniae Moraxella catarrhalis
  • Mycobacterium smegmatis e.g., MC2
  • Mycobacterium tuberculosis e.g., CDC 1551
  • gonorrhoeae e.g., FA1090
  • Neisseria meningitidis e.g., MC58
  • Pseudomonas aeruginosa Porphyromonas gingivalis (e.g., W83)
  • Prevotella intermedia e.g., 17
  • Prevotella melaninogenica e.g., ATCC ® 25845
  • Staphylococcus aureus e.g., MW2
  • Staphylococcus epidermidis e.g., RP62A
  • Streptococcus agalactiae e.g., 2603 V/R
  • Streptococcus bovis Streptococcus gallolyticus
  • Streptococcus gordonii e.g., NCTC 7868 (Challis)
  • Streptococcus mutans e.g., UA159
  • cystic fibrosis patients have Pseudomonas infections that often result in antibiotic resistant biofilms.
  • Other diseases associated with biofilms include, but are not limited to, lung infections of cystic fibrosis patients, otitis media, post-tympanostomy tube ottorhea, chronic suppurative otitis media, native valve infectious endocarditis, osteomyelitis, rhinosinositis, prostatitis, urinary tract infection, wounds, dental caries and periodontitis.
  • Foodborne pathogens such as but not limited to some of the above listed organisms (e.g., Listeria monocytogenes, Escherichia coli, Salmonella enterica) may also form biofilms on the food which they contaminate.
  • Disease causing biofilms in animals e.g., Escherichia coli, Salmonella, and Shigella species
  • biofilms need not be of one homogeneous microbial population and may incorporate other pathogens and even host cells.
  • biofilms are often causes of industrial contamination, most notably in relation to process waters and surfaces in contact therewith.
  • biofilms Complications involving organisms that form biofilm as industrial contaminants include but are not limited to biocorrosion, biofouling, and equipment damage as a result of biofilm formation.
  • Non-limiting exemplary organisms associated with biofilms in industrial settings include those disclosed in Ferrera et al. (2015) Biofouling 31(2): 173-180 and Desulfovibrio species. Additional details regarding biofilms may be found in, for example, Donlan (2002) Emerging Infectious Diseases 8(9): 881-890.
  • the terms "to prevent formation of or "to disrupt a biofilm” intends a prevention, reduction, or disruption in the formation of, or structure of, the DNA/protein matrix that is a component of a microbial biofilm.
  • nucleoid associated protein refers to a class of proteins that affect the dynamic spatial organization of nucleic acids in the nucleoid of prokaryotic cells. These proteins organize the genome through effecting DNA bending, binding and aggregation. Certain NAPs are DNA binding proteins and may be associated with the biofilm including, DNABII proteins, DPS (Genbank Accession No.: CAA49169), H- NS (Genbank Accession No.: CAA47740), Hfq (Genbank Accession No.: ACE63256), CbpA (Genbank Accession No.: BAA03950) and CbpB (Genbank Accession No.: NP_418813).
  • DNABII proteins are distinct and generally have strong sequence identity with alpha helical dimerization domains and may comprise anti-parallel beta ribbons, which often have NPXT (wherein X is any amino acid or may be selected from amino acids Q, R, K, S, or T) comprising tips that bind and intercalate into the minor groove of DNA and kink it.
  • NPXT wherein X is any amino acid or may be selected from amino acids Q, R, K, S, or T
  • the functional protomer is a dimer of identical or homologous subunits.
  • a "DNABII polypeptide or protein” intends a DNA binding protein or polypeptide that is composed of DNA-binding domains and thus have a specific or general affinity for microbial DNA. In one aspect, they bind DNA in the minor grove.
  • Non-limiting examples of DNABII proteins are an integration host factor (IHF) protein and a histone-like protein (HU).
  • IHF protein is a bacterial protein that is used by bacteriophages to incorporate their DNA into the host bacteria. They also bind extracellular microbial DNA. The genes that encode the IHF protein subunits in E. coli are himA
  • HMGB1 is a high mobility group box (HMGB) 1 protein that is reported to bind to and distort the minor groove of DNA and is an example of an agent. Recombinant or isolated protein and polypeptide are commercially available from Atgenglobal, ProSpecBio, Protein 1 and Abnova.
  • HU or "histone-like protein” refers to a class of heterodimeric proteins typically associate with E. coli. HU proteins are known to bind DNA junctions. Related proteins have been isolated from other microorganisms. The complete amino acid sequence of E. coli HU was reported by Laine et al. (1980) Eur. J. Biochem 103(3):447-481. The genes that encode the HU protein subunits in E. coli are hupA and hupB corresponding to SEQ ID NOs. 8 and 9, respectively. A Haemophilus influenzae homolog derived from non-typeable Haemophilus influenzae (NTHI) corresponds to SEQ ID NO. 3.
  • surface antigens or "surface proteins” refers to proteins or peptides on the surface of cells such as bacterial cells that are at least in part exposed to the extracellular environment.
  • surface antigens are outer membrane proteins such as OMP P5 (Genbank Accession No.: YP_004139079.1), OMP P2 (Genbank Accession No.:
  • Haemophilus influenzae refers to pathogenic bacteria that can cause many different infections such as, for example, ear infections, eye infections, and sinusitis. Many different strains of Haemophilus influenzae have been isolated and have an IhfA gene or protein. Some non-limiting examples of different strains of Haemophilus
  • influenzae include Rd KW20, 86-028NP, R2866, PittGG, PittEE, R2846, and 2019.
  • Microbial DNA intends single or double stranded DNA from a microorganism that produces a biofilm.
  • a conformational tip domain of a polypeptide refers to a polypeptide that comprises a primary amino acid sequence wherein the structure has a anti-parallel beta ribbon with a sharp turn that is typically mediated by a proline residue.
  • Treating an infection intends a reduction in the number of microbes, e.g., bacteria, associated with the formation of a biofilm.
  • Methods to determine if the number of microbes has been reduced are known in the art and include in vivo and ex vivo assays, as well as a reduction in the clinical symptoms of an infection. Because bacteria are protected by the biofilms, the bacteria become resistance to the use of antibacterials. By breaking down the biofilm one can reduce or inhibit bacterial resistance to antibacterial and other agents as well as treat the bacterial infection.
  • a "bent polynucleotide” intends a double strand polynucleotide that contains a small loop on one strand which does not pair with the other strand.
  • the loop is from 1 base to about 20 bases long, or alternatively from 2 bases to about 15 bases long, or alternatively from about 3 bases to about 12 bases long, or alternatively from about 4 bases to about 10 bases long, or alternatively has about 4, 5, or 6, or 7, or 8, or 9, or 10 bases.
  • Polypeptides that compete with DNABII proteins in DNA binding intend proteins or peptides that compete with IHF or HU in binding bent or distorted DNA structures but do not form a biofilm with the DNA. Examples, without limitation, include fragments of IHF that include one or more DNA binding domains of the IHF, or the biological equivalents thereof.
  • the term "specifically recognize or bind” intends that the binding agent, e.g., Fab (fragment antigen binding) or monoclonal antibody, is more likely than not to bind to its intended target or binding partner.
  • a "subject" of diagnosis or treatment is a cell or an animal such as a mammal, or a human.
  • Non-human animals subject to diagnosis or treatment and are those subject to infections or animal models, for example, simians, murines, such as, rats, mice, chinchilla, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets.
  • protein protein
  • peptide and “polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
  • the subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc.
  • a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and
  • polynucleotide and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
  • polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment disclosed herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
  • a polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA.
  • A adenine
  • C cytosine
  • G guanine
  • T thymine
  • U uracil
  • polynucleotide sequence is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.
  • isolated or recombinant refers to molecules separated from other DNAs or RNAs, respectively that are present in the natural source of the macromolecule as well as polypeptides.
  • isolated or recombinant nucleic acid is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
  • isolated is also used herein to refer to polynucleotides, polypeptides and proteins that are isolated from other cellular proteins and is meant to encompass both purified and
  • the term "isolated or recombinant" means separated from constituents, cellular and otherwise, in which the cell, tissue, polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof, which are normally associated in nature.
  • an isolated cell is a cell that is separated from tissue or cells of dissimilar phenotype or genotype.
  • An isolated polynucleotide is separated from the 3' and 5' contiguous nucleotides with which it is normally associated in its native or natural environment, e.g., on the chromosome.
  • a non- naturally occurring polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof does not require "isolation" to distinguish it from its naturally occurring counterpart.
  • an equivalent polynucleotide is one that hybridizes under stringent conditions to the
  • an equivalent antibody or antigen binding polypeptide or Fab intends one that binds with at least 70%, or alternatively at least 75%o, or alternatively at least 80%>, or alternatively at least 85%>, or alternatively at least 90%), or alternatively at least 95% affinity or higher affinity to a reference antibody or antigen binding fragment.
  • the equivalent thereof competes with the binding of the antibody or antigen binding fragment to its antigen under a competitive ELISA assay.
  • an equivalent intends at least about 80%> homology or identity and
  • a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%>, 85%>, 90%, or 95%) of "sequence identity" to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a non-limiting exemplary alignment program is BLAST, using default parameters.
  • Homology refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An "unrelated" or “non-homologous" sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present disclosure.
  • Homology or “identity” or “similarity” can also refer to two nucleic acid molecules that hybridize under stringent conditions.
  • Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
  • the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
  • the complex may comprise two strands forming a duplex structure, three or more strands forming a multi- stranded complex, a single self-hybridizing strand, or any combination of these.
  • a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
  • Examples of stringent hybridization conditions include: incubation temperatures of about 25° C. to about 37° C; hybridization buffer concentrations of about 6> ⁇ SSC to about lOxSSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4xSSC to about 8xSSC.
  • Examples of moderate hybridization conditions include: incubation temperatures of about 40° C. to about 50° C; buffer concentrations of about 9xSSC to about 2xSSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5xSSC to about 2x SSC.
  • Examples of high stringency conditions include: incubation temperatures of about 55° C. to about 68° C; buffer concentrations of about I xSSC to about O.
  • SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.
  • expression refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in an eukaryotic cell.
  • encode refers to a polynucleotide which is said to "encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
  • the terms “treating,” “treatment” and the like are used herein to mean obtaining a desired pharmacologic and/or physiologic effect.
  • the effect may be prophylactic in terms of completely or partially preventing a disorder or sign or symptom thereof, and/or may be therapeutic in terms of a partial or complete cure for a disorder and/or adverse effect attributable to the disorder.
  • Methods to determine if treatment has occurred are known in the art and briefly described herein.
  • To prevent intends to prevent a disorder or effect in vitro or in vivo in a system or subject that is predisposed to the disorder or effect.
  • An example of such is preventing the formation of a biofilm in a system that is infected with a microorganism known to produce one.
  • composition is intended to mean a combination of active agent and another compound or composition, inert (for example, a detectable agent or label) or active, such as an adjuvant.
  • a "pharmaceutical composition” is intended to include the combination of an active agent with a carrier, inert or active, making the composition suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo.
  • “Pharmaceutically acceptable carriers” refers to any diluents, excipients, or carriers that may be used in the compositions disclosed herein.
  • Pharmaceutically acceptable carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances, such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium
  • carboxymethylcellulose polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, microspheres, microparticles, or nanoparticles (comprising e.g., biodegradable polymers such as Poly(Lactic Acid-co-Glycolic Acid)), and wool fat.
  • Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences, Mack Publishing Company, a standard reference text in this field. They may be selected with respect to the intended form of administration, that is, oral tablets, capsules, elixirs, syrups and the like, and consistent with conventional pharmaceutical practices.
  • a "biologically active agent" or an active agent disclosed herein intends one or more of an isolated or recombinant polypeptide, an isolated or recombinant polynucleotide, a vector, an isolated host cell, or an antibody, as well as compositions comprising one or more of same.
  • administering or "delivery” of a therapeutic or other agent can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated, and target cell or tissue. Non-limiting examples of route of administration include oral administration, nasal administration, inhalation, injection, and topical application. Administration can be for use in industrial as well as therapeutic applications.
  • An agent (antibody or fragment thereof, polypeptide or polynucleotide, or cell) of the present disclosure can be administered for therapy by any suitable route of administration. It will also be appreciated that the optimal route will vary with the condition and age of the recipient, and the disease being treated.
  • the agent may be used in industrial settings and for the treatment of animals. When used in industrial settings, the biofilm is contacted with the agent, e.g., Fab (fragment antigen binding) or antibody.
  • the term "effective amount" refers to a quantity sufficient to achieve a desired effect. In the context of therapeutic or prophylactic applications, the effective amount will depend on the type and severity of the condition at issue and the characteristics of the individual subject, such as general health, age, sex, body weight, species, and tolerance to pharmaceutical compositions. In the context of this disclosure, in some embodiments the effective amount is the amount sufficient to result a reduction in biofilm mass or in breaking down a biofilm. In other aspects, the amount is effective to treat a bacterial infection associated with a biofilm in a subject. In other embodiments, in the context of a Fab
  • the effective amount is the amount sufficient to result in breaking down, dimininishing or disrupting a biofilm.
  • the effective amount of an agent or an immunogenic composition is the amount sufficient to result in antibody generation against the antigen.
  • the effective amount is the amount required to confer passive immunity on a subject in need thereof. With respect to compositions, in some embodiments the effective amount will depend on the intended use, the health/responsiveness of the subject's immune system, in addition to the factors described above. The skilled artisan will be able to determine appropriate amounts depending on these and other factors.
  • the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the in vitro target and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations.
  • the effective amount may comprise one or more administrations of a composition depending on the embodiment.
  • potency as it relates to the potency of a drug, such as an antibiotic refers to to a measure of drug activity expressed in terms of the amount required to produce an effect of given intensity.
  • a highly potent drug evokes a given response at low concentrations, while a drug of lower potency evokes the same response only at higher concentrations.
  • the potency depends on both the affinity and efficacy.
  • conjugated moiety refers to a moiety that can be added to an isolated chimeric polypeptide by forming a covalent bond with a residue of chimeric polypeptide.
  • the moiety may bond directly to a residue of the chimeric polypeptide or may form a covalent bond with a linker which in turn forms a covalent bond with a residue of the chimeric polypeptide.
  • a “peptide conjugate” refers to the association by covalent or non-covalent bonding of one or more polypeptides and another chemical or biological compound. In a non- limiting example, the "conjugation" of a polypeptide with a chemical compound results in improved stability or efficacy of the polypeptide for its intended purpose. In one
  • the polypeptide of this disclosure is conjugated to a carrier, wherein the carrier is a liposome, a micelle, or a pharmaceutically acceptable polymer.
  • Liposomes are microscopic vesicles consisting of concentric lipid bilayers.
  • a liposome is an example of a carrier, e.g., a pharmaceutically acceptable carrier. Structurally, liposomes range in size and shape from long tubes to spheres, with dimensions from a few hundred Angstroms to fractions of a millimeter. Vesicle-forming lipids are selected to achieve a specified degree of fluidity or rigidity of the final complex providing the lipid composition of the outer layer.
  • PC phosphatidylcholine
  • PE phosphatidylethanolamine
  • PI phosphatidylinositol
  • SM sphingomyelin
  • DOPE dioleoylphosphatidylethanolamine
  • lipids capable of producing a stable liposome are phospholipids, such as hydrogenated soy phosphatidylcholine (HSPC), lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanol-amine,
  • HSPC hydrogenated soy phosphatidylcholine
  • lecithin phosphatidylethanolamine
  • lysolecithin phosphatidylethanolamine
  • phosphatidyl serine phosphatidylinositol
  • sphingomyelin cephalin
  • cardiolipin phosphatidic acid
  • cerebrosides distearoylphosphatidylethan-olamine (DSPE)
  • DOPC dioleoylphosphatidylcholine
  • DPPC dipalmitoylphosphatidylcholine
  • PPC palmitoyloteoylphosphatidylcholine
  • POPE palmitoyloleoylphosphatidylethanolamine
  • DOPE-mal dioleoylphosphatidylethanolamine 4-(N-maleimido-triethyl)cyclohexane-l- carboxylate
  • Additional non-phosphorous containing lipids that can become incorporated into liposomes include stearylamine, dodecylamine, hexadecylamine, isopropyl myristate, triethanolamine-lauryl sulfate, alkyl-aryl sulfate, acetyl palmitate, glycerol ricinoleate, hexadecyl stereate, amphoteric acrylic polymers, polyethyloxylated fatty acid amides, and the cationic lipids mentioned above (DDAB, DODAC, DMRIE, DMTAP, DOGS, DOTAP (DOTMA), DOSPA, DPTAP, DSTAP, DC-Chol).
  • DDAB DODAC
  • DMRIE DMTAP
  • DOGS DOGS
  • DOTAP DOTMA
  • DOSPA DPTAP
  • DSTAP DC-Chol
  • Negatively charged lipids include phosphatidic acid (PA), dipalmitoylphosphatidylglycerol (DPPG), dioteoylphosphatidylglycerol and (DOPG), dicetylphosphate that are able to form vesicles.
  • PA phosphatidic acid
  • DPPG dipalmitoylphosphatidylglycerol
  • DOPG dioteoylphosphatidylglycerol and (DOPG), dicetylphosphate that are able to form vesicles.
  • liposomes can be divided into three categories based on their overall size and the nature of the lamellar structure. The three classifications, as developed by the New York Academy Sciences Meeting, "Liposomes and Their Use in Biology and Medicine,"
  • MLVs multi-lamellar vesicles
  • SUVs small uni-lamellar vesicles
  • LUVs large uni-lamellar vesicles
  • the biological active agents can be encapsulated in such for administration in accordance with the methods described herein.
  • a "micelle” is an aggregate of surfactant molecules dispersed in a liquid colloid.
  • a typical micelle in aqueous solution forms an aggregate with the hydrophilic "head” regions in contact with surrounding solvent, sequestering the hydrophobic tail regions in the micelle center.
  • This type of micelle is known as a normal phase micelle (oil-in-water micelle).
  • Inverse micelles have the head groups at the center with the tails extending out (water-in-oil micelle).
  • Micelles can be used to attach a polynucleotide, polypeptide, antibody or composition described herein to facilitate efficient delivery to the target cell or tissue.
  • pharmaceutically acceptable polymer refers to the group of compounds which can be conjugated to one or more polypeptides or antibodies described here. It is contemplated that the conjugation of a polymer to the polypeptide or antibody is capable of extending the half-life of the polypeptide in vivo and in vitro.
  • Non-limiting examples include polyethylene glycols, polyvinylpyrrolidones, polyvinylalcohols, cellulose derivatives, polyacrylates, polymethacrylates, sugars, polyols and mixtures thereof.
  • the biological active agents can be conjugated to a pharmaceutically acceptable polymer for administration in accordance with the methods described herein.
  • a "gene delivery vehicle” is defined as any molecule that can carry inserted polynucleotides into a host cell.
  • Examples of gene delivery vehicles are liposomes, micelles biocompatible polymers, including natural polymers and synthetic polymers; lipoproteins; polypeptides; polysaccharides; lipopolysaccharides; artificial viral envelopes; metal particles; and bacteria, or viruses, such as baculovirus, adenovirus and retrovirus, bacteriophage, cosmid, plasmid, fungal vectors and other recombination vehicles typically used in the art which have been described for expression in a variety of eukaryotic and prokaryotic hosts, and may be used for gene therapy as well as for simple protein expression.
  • a polynucleotide disclosed herein can be delivered to a cell or tissue using a gene delivery vehicle.
  • Gene delivery “gene transfer,” “transducing,” and the like as used herein, are terms referring to the introduction of an exogenous polynucleotide (sometimes referred to as a "transgene") into a host cell, irrespective of the method used for the introduction.
  • Such methods include a variety of well-known techniques such as vector-mediated gene transfer (by, e.g., viral infection/transfection, or various other protein-based or lipid-based gene delivery complexes) as well as techniques facilitating the delivery of "naked" polynucleotides (such as electroporation, "gene gun” delivery and various other techniques used for the introduction of polynucleotides).
  • vector-mediated gene transfer by, e.g., viral infection/transfection, or various other protein-based or lipid-based gene delivery complexes
  • techniques facilitating the delivery of "naked" polynucleotides such as electroporation, "gene gun” delivery and various other techniques used for the introduction of polynucleotides.
  • the introduced polynucleotide may be stably or transiently maintained in the host cell.
  • Stable maintenance typically requires that the introduced polynucleotide either contains an origin of replication compatible with the host cell or integrates into a replicon of the host cell such as an extrachromosomal replicon (e.g., a plasmid) or a nuclear or mitochondrial chromosome.
  • a replicon of the host cell such as an extrachromosomal replicon (e.g., a plasmid) or a nuclear or mitochondrial chromosome.
  • a number of vectors are known to be capable of mediating transfer of genes to mammalian cells, as is known in the art and described herein.
  • eDNA refers to extracellular DNA found as a component to pathogenic biofilms.
  • a "plasmid" is an extra-chromosomal DNA molecule separate from the
  • Plasmids provide a mechanism for horizontal gene transfer within a population of microbes and typically provide a selective advantage under a given environmental state. Plasmids may carry genes that provide resistance to naturally occurring antibiotics in a competitive environmental niche, or alternatively the proteins produced may act as toxins under similar circumstances.
  • Plasmids used in genetic engineering are called "plasmid vectors". Many plasmids are commercially available for such uses. The gene to be replicated is inserted into copies of a plasmid containing genes that make cells resistant to particular antibiotics and a multiple cloning site (MCS, or polylinker), which is a short region containing several commonly used restriction sites allowing the easy insertion of DNA fragments at this location.
  • MCS multiple cloning site
  • Another major use of plasmids is to make large amounts of proteins. In this case, researchers grow bacteria containing a plasmid harboring the gene of interest. Just as the bacterium produces proteins to confer its antibiotic resistance, it can also be induced to produce large amounts of proteins from the inserted gene.
  • a "yeast artificial chromosome” or “YAC” refers to a vector used to clone large DNA fragments (larger than 100 kb and up to 3000 kb). It is an artificially constructed chromosome and contains the telomeric, centromeric, and replication origin sequences needed for replication and preservation in yeast cells. Built using an initial circular plasmid, they are linearized by using restriction enzymes, and then DNA ligase can add a sequence or gene of interest within the linear molecule by the use of cohesive ends.
  • Yeast expression vectors such as YACs, Yips (yeast integrating plasmid), and YEps (yeast episomal plasmid), are extremely useful as one can get eukaryotic protein products with posttranslational modifications as yeasts are themselves eukaryotic cells, however YACs have been found to be more unstable than BACs, producing chimeric effects.
  • a "viral vector” is defined as a recombinantly produced virus or viral particle that comprises a polynucleotide to be delivered into a host cell, either in vivo, ex vivo or in vitro.
  • viral vectors include retroviral vectors, adenovirus vectors, adeno-associated virus vectors, alphavirus vectors and the like.
  • Infectious tobacco mosaic virus (TMV)-based vectors can be used to manufacturer proteins and have been reported to express Griffithsin in tobacco leaves (O'Keefe et al. (2009) Proc. Nat. Acad. Sci. USA 106(15):6099-6104).
  • Alphavirus vectors such as Semliki Forest virus-based vectors and Sindbis virus-based vectors, have also been developed for use in gene therapy and immunotherapy. See,
  • a vector construct refers to the polynucleotide comprising the retroviral genome or part thereof, and a therapeutic gene. Further details as to modern methods of vectors for use in gene transfer may be found in, for example, Kotterman et al. (2015) Viral Vectors for Gene Therapy: Translational and Clinical Outlook Annual Review of Biomedical Engineering 17.
  • retroviral mediated gene transfer or “retroviral transduction” carries the same meaning and refers to the process by which a gene or nucleic acid sequences are stably transferred into the host cell by virtue of the virus entering the cell and integrating its genome into the host cell genome.
  • the virus can enter the host cell via its normal mechanism of infection or be modified such that it binds to a different host cell surface receptor or ligand to enter the cell.
  • retroviral vector refers to a viral particle capable of introducing exogenous nucleic acid into a cell through a viral or viral-like entry mechanism.
  • Retroviruses carry their genetic information in the form of RNA; however, once the virus infects a cell, the RNA is reverse-transcribed into the DNA form which integrates into the genomic DNA of the infected cell.
  • the integrated DNA form is called a provirus.
  • a vector construct refers to the adenovirus (Ad) or adeno-associated virus (AAV).
  • Ads Adenoviruses
  • Ads are a relatively well characterized, homogenous group of viruses, including over 50 serotypes. See, e.g., PCT International Pat. Application Publication No. WO 95/27071. Ads do not require integration into the host cell genome. Recombinant Ad derived vectors, particularly those that reduce the potential for recombination and generation of wild-type virus, have also been constructed. See, PCT International Pat. Application Publication Nos. WO 95/00655 and WO 95/11984, Wild-type AAV has high infectivity and specificity integrating into the host cell's genome. See, Hermonat & Muzyczka (1984) Proc. Natl. Acad. Sci. USA 81 :6466-6470 and Lebkowski et al. (1988) Mol. Cell. Biol. 8:3988-3996.
  • Vectors that contain both a promoter and a cloning site into which a polynucleotide can be operatively linked are well known in the art. Such vectors are capable of transcribing RNA in vitro or in vivo, and are commercially available from sources such as Stratagene (La Jolla, Calif.) and Promega Biotech (Madison, Wis.). In order to optimize expression and/or in vitro transcription, it may be necessary to remove, add or alter 5' and/or 3' untranslated portions of the clones to eliminate extra, potential inappropriate alternative translation initiation codons or other sequences that may interfere with or reduce expression, either at the level of transcription or translation. Alternatively, consensus ribosome binding sites can be inserted immediately 5' of the start codon to enhance expression.
  • Gene delivery vehicles also include DNA/liposome complexes, micelles and targeted viral protein-DNA complexes. Liposomes that also comprise a targeting antibody or fragment thereof can be used in the methods disclosed herein.
  • direct introduction of the proteins described herein to the cell or cell population can be done by the non-limiting technique of protein transfection, alternatively culturing conditions that can enhance the expression and/or promote the activity of the proteins disclosed herein are other non-limiting techniques.
  • antibody includes whole antibodies and any antigen binding fragment or a single chain thereof.
  • antibody includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule.
  • antibody includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule.
  • immunoglobulin also include immunoglobulins of any isotype, fragments of antibodies which retain specific binding to antigen, including, but not limited to, Fab, Fab', F(ab) 2 , Fv, scFv, dsFv, Fd fragments, dAb, VH, VL, VhH, and V-NAR domains; minibodies, diabodies, triabodies, tetrabodies and kappa bodies; multispecific antibody fragments formed from antibody fragments and one or more isolated.
  • CDR complementarity determining region
  • a heavy or light chain or a ligand binding portion thereof a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework (FR) region, or any portion thereof, at least one portion of a binding protein, chimeric antibodies, humanized antibodies, species-ized antibodies, single- chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein.
  • the variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues.
  • anti-IHF when used before a protein name, anti-IHF, anti-HU, anti-OMP P5, for example, refers to a monoclonal or polyclonal antibody that binds and/or has an affinity to a particular protein.
  • anti-IHF refers to an antibody that binds to the IHF protein.
  • the specific antibody may have affinity or bind to proteins other than the protein it was raised against.
  • anti-IHF while specifically raised against the IHF protein, may also bind other proteins that are related either through sequence homology or through structure homology.
  • the antibodies can be polyclonal, monoclonal, multispecific (e.g., bispecific antibodies), a diabody, and antibody fragments, so long as they exhibit the desired biological activity.
  • Antibodies can be isolated from any suitable biological source, e.g., a human, a murine, rat, sheep and canine.
  • monoclonal antibody refers to an antibody obtained from a substantially homogeneous antibody population. Monoclonal antibodies are highly specific, as each monoclonal antibody is directed against a single determinant on the antigen.
  • the antibodies may be detectably labeled, e.g., with a radioisotope, an enzyme which generates a detectable product, a fluorescent protein, and the like.
  • the antibodies may be further conjugated to other moieties, such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like.
  • the antibodies may also be bound to a solid support, including, but not limited to, polystyrene plates or beads, and the like.
  • Monoclonal antibodies may be generated using hybridoma techniques or recombinant DNA methods known in the art.
  • a hybridoma is a cell that is produced in the laboratory from the fusion of an antibody -producing lymphocyte and a non-antibody producing cancer cell, usually a myeloma or lymphoma.
  • a hybridoma proliferates and produces a continuous sample of a specific monoclonal antibody.
  • Alternative techniques for generating or selecting antibodies include in vitro exposure of lymphocytes to antigens of interest, and screening of antibody display libraries in cells, phage, or similar systems.
  • human antibody as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the human antibodies disclosed herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term “human antibody” as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • human antibody refers to an antibody in which substantially every part of the protein (e.g., CDR, framework, C L , C H domains (e.g., C HI , C H 2, C H3 ), hinge, (VL, VH)) is substantially non-immunogenic in humans, with only minor sequence changes or variations.
  • antibodies designated primate monkey, baboon, chimpanzee, etc.
  • rodent mouse, rat, rabbit, guinea pig, hamster, and the like
  • other mammals designate such species, sub-genus, genus, sub-family, family specific antibodies.
  • chimeric antibodies include any combination of the above.
  • a human antibody is distinct from a chimeric or humanized antibody. It is pointed out that a human antibody can be produced by a non- human animal or prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (e.g., heavy chain and/or light chain) genes. Further, when a human antibody is a single chain antibody, it can comprise a linker peptide that is not found in native human antibodies.
  • an Fv can comprise a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain.
  • linker peptides are considered to be of human origin.
  • a human antibody is "derived from” a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, e.g., by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library.
  • a human antibody that is "derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequence of human germline
  • a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
  • a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
  • a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene.
  • the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
  • a "human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences. The term also intends recombinant human antibodies. Methods to making these antibodies are described herein.
  • recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of human
  • Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. Methods to making these antibodies are described herein.
  • chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from antibody variable and constant region genes belonging to different species.
  • humanized antibody or “humanized immunoglobulin” refers to a human/non-human chimeric antibody that contains a minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a variable region of the recipient are replaced by residues from a variable region of a non-human species (donor antibody) such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity and capacity.
  • donor antibody such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity and capacity.
  • Humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody.
  • the humanized antibody can optionally also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin, a non-human antibody containing one or more amino acids in a framework region, a constant region or a CDR, that have been substituted with a
  • Fc immunoglobulin constant region
  • humanized antibodies are expected to produce a reduced immune response in a human host, as compared to a non-humanized version of the same antibody.
  • the humanized antibodies may have conservative amino acid substitutions which have substantially no effect on antigen binding or other antibody functions.
  • Conservative substitutions groupings include: glycine-alanine, valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, serine- threonine and asparagine-glutamine.
  • the term "species-ized” refers to antibodies that have been modified in the same or a similar manner for a non-human species.
  • polyclonal antibody or “polyclonal antibody composition” as used herein refer to a preparation of antibodies that are derived from different B-cell lines. They are a mixture of immunoglobulin molecules secreted against a specific antigen, each recognizing a different epitope. In some embodiments, the antibody or antigen binding fragment is not a polyclonal antibody.
  • antibody derivative comprises a full-length antibody or a fragment of an antibody, wherein one or more of the amino acids are chemically modified by alkylation, pegylation, acylation, ester formation or amide formation or the like, e.g., for linking the antibody to a second molecule.
  • This disclosure also provided antibody derivatives of the antibody fragments, e.g., the polypeptides conjugaged to another molecule, e.g., PEG or further modified by acylation.
  • immunoconjugate comprises an antibody fragment or a antibody derivative associated with or linked to a second agent, such as a cytotoxic agent, a detectable agent, a radioactive agent, a targeting agent, a human antibody, a humanized antibody, a chimeric antibody, a synthetic antibody, a semisynthetic antibody, or a multispecific antibody.
  • a second agent such as a cytotoxic agent, a detectable agent, a radioactive agent, a targeting agent, a human antibody, a humanized antibody, a chimeric antibody, a synthetic antibody, a semisynthetic antibody, or a multispecific antibody.
  • label intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., N-terminal histidine tags (N-His), magnetically active isotopes, e.g., 115 Sn, 117 Sn and 119 Sn, a non-radioactive isotopes such as 13 C and 15 N, polynucleotide or protein such as an antibody so as to generate a "labeled" composition.
  • N-terminal histidine tags N-His
  • magnetically active isotopes e.g., 115 Sn, 117 Sn and 119 Sn
  • a non-radioactive isotopes such as 13 C and 15 N
  • polynucleotide or protein such as an antibody so as to generate a "labeled” composition.
  • the term also includes sequences conjugated to a polynucleotide that will provide a signal upon expression of the inserted sequences, such as green
  • label generally intends compositions covalently attached to the composition to be detected, in one aspect it specifically excludes naturally occurring nucleosides and amino acids that are known to fluoresce under certain conditions (e.g., temperature, pH, etc.) when positioned within the polynucleotide or protein in its native environment and generally any natural fluorescence that may be present in the composition to be detected.
  • the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
  • the labels can be suitable for small scale detection or more suitable for high-throughput screening. As such, suitable labels include, but are not limited to
  • a response that is simply detected generally comprises a response whose existence merely is confirmed, whereas a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
  • a quantifiable e.g., numerically reportable
  • the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
  • luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence.
  • Detectable luminescence response generally comprises a change in, or an occurrence of a luminescence signal. Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6 th ed). Examples of luminescent probes include, but are not limited to, aequorin and luciferases.
  • fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, CASCADE BLUETM, and Texas Red.
  • fluorescein rhodamine
  • tetramethylrhodamine eosin
  • erythrosin erythrosin
  • coumarin methyl-coumarins
  • pyrene Malacite green
  • stilbene Lucifer Yellow
  • CASCADE BLUETM Lucifer Yellow
  • Texas Red Texas Red
  • the fluorescent label is functionalized to facilitate covalent attachment to a cellular component present in or on the surface of the cell or tissue such as a cell surface marker.
  • Suitable functional groups including, but not are limited to,
  • isothiocyanate groups amino groups, haloacetyl groups, maleimides, succinimidyl esters, and sulfonyl halides, all of which may be used to attach the fluorescent label to a second molecule.
  • the choice of the functional group of the fluorescent label will depend on the site of attachment to either a linker, the agent, the marker, or the second labeling agent.
  • Eukaryotic cells comprise all of the life kingdoms except monera. They can be easily distinguished through a membrane-bound nucleus. Animals, plants, fungi, and protists are eukaryotes or organisms whose cells are organized into complex structures by internal membranes and a cytoskeleton. The most characteristic membrane-bound structure is the nucleus.
  • the term "host” includes a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells. Non-limiting examples of eukaryotic cells or hosts include simian, bovine, porcine, murine, rat, avian, reptilian and human.
  • Prokaryotic cells that usually lack a nucleus or any other membrane-bound organelles and are divided into two domains, bacteria and archaea. In addition to
  • chromosomal DNA these cells can also contain genetic information in a circular loop called on episome.
  • Bacterial cells are very small, roughly the size of an animal mitochondrion (about 1-2 ⁇ in diameter and 10 ⁇ long).
  • Prokaryotic cells feature three major shapes: rod shaped, spherical, and spiral. Instead of going through elaborate replication processes like eukaryotes, bacterial cells divide by binary fission. Examples include but are not limited to Bacillus bacteria, E. coli bacterium, and Salmonella bacterium.
  • a "native" or “natural” antigen is a polypeptide, protein or a fragment which contains an epitope, which has been isolated from a natural biological source, and which can specifically bind to an antigen receptor, in particular a T cell antigen receptor (TCR), in a subject.
  • TCR T cell antigen receptor
  • antigen and “antigenic” refer to molecules with the capacity to be recognized by an antibody or otherwise act as a member of an antibody-ligand pair.
  • Specific binding refers to the interaction of an antigen with the variable regions of immunoglobulin heavy and light chains. Antibody-antigen binding may occur in vivo or in vitro.
  • macromolecules including proteins, nucleic acids, fatty acids, lipids, lipopolysaccharides and polysaccharides have the potential to act as an antigen.
  • nucleic acids encoding a protein with the potential to act as an antibody ligand necessarily encode an antigen.
  • antigens are not limited to full-length molecules, but can also include partial molecules.
  • antigenic is an adjectival reference to molecules having the properties of an antigen.
  • the term encompasses substances that are immunogenic, i.e., immunogens, as well as substances which induce immunological unresponsiveness, or anergy, i.e., anergens.
  • Altered antigen is one having a primary sequence that is different from that of the corresponding wild-type antigen.
  • Polypeptide mB4 (SEQ ID NO. : 17) is an example of an altered antigen (SEQ ID NO. : 16).
  • Altered antigens can be made by synthetic or recombinant methods and include, but are not limited to, antigenic peptides that are differentially modified during or after translation, e.g., by phosphorylation, glycosylation, cross-linking, acylation, proteolytic cleavage, linkage to an antibody molecule, membrane molecule or other ligand (Ferguson et al. (1988) Ann. Rev. Biochem. 57:285-320).
  • a synthetic or altered antigen disclosed herein is intended to bind to the same TCR as the natural epitope.
  • a "self-antigen” also referred to herein as a native or wild-type antigen is an antigenic peptide that induces little or no immune response in the subject due to self-tolerance to the antigen.
  • An example of a self-antigen is the melanoma specific antigen gplOO.
  • Immuno response broadly refers to the antigen-specific responses of lymphocytes to foreign substances.
  • immunogen and “immunogenic” refer to molecules with the capacity to elicit an immune response. All immunogens are antigens; however, not all antigens are immunogenic.
  • An immune response disclosed herein can be humoral (via antibody activity) or cell-mediated (via T cell activation). The response may occur in vivo or in vitro.
  • macromolecules including proteins, nucleic acids, fatty acids, lipids, lipopolysaccharides and polysaccharides have the potential to be immunogenic.
  • nucleic acids encoding a molecule capable of eliciting an immune response necessarily encode an immunogen.
  • immunogens are not limited to full- length molecules, but may include partial molecules.
  • Passive immunity refers to the transfer of immunity from one subject to another through the transfer of antibodies. Passive immunity may occur naturally, as when maternal antibodies are transferred to a fetus. Passive immunity may also occur artificially as when antibody compositions are administered to non-immune subjects. Antibody donors and recipients may be human or non-human subjects. Antibodies may be polyclonal or monoclonal, may be generated in vitro or in vivo, and may be purified, partially purified, or unpurified depending on the embodiment. In some embodiments described herein, passive immunity is conferred on a subject in need thereof through the administration of antibodies or antigen binding fragments that specifically recognize or bind to a particular antigen. In some embodiments, passive immunity is conferred through the administration of an isolated or recombinant polynucleotide encoding an antibody or antigen binding fragment that specifically recognizes or binds to a particular antigen.
  • the term "inducing an immune response in a subject” is a term well understood in the art and intends that an increase of at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 100-fold, at least about 500-fold, or at least about 1000- fold or more in an immune response to an antigen (or epitope) can be detected or measured, after introducing the antigen (or epitope) into the subject, relative to the immune response (if any) before introduction of the antigen (or epitope) into the subject.
  • An immune response to an antigen includes, but is not limited to, production of an antigen-specific (or epitope-specific) antibody, and production of an immune cell expressing on its surface a molecule which specifically binds to an antigen (or epitope).
  • Methods of determining whether an immune response to a given antigen (or epitope) has been induced are well known in the art.
  • antigen-specific antibody can be detected using any of a variety of immunoassays known in the art, including, but not limited to, ELISA, wherein, for example, binding of an antibody in a sample to an immobilized antigen (or epitope) is detected with a detectably-labeled second antibody (e.g., enzyme-labeled mouse anti-human Ig antibody).
  • ELISA immunoassays known in the art, including, but not limited to, ELISA, wherein, for example, binding of an antibody in a sample to an immobilized antigen (or epitope) is detected with a detectably-labeled second antibody (e.g., enzyme-labeled mouse anti-human Ig antibody).
  • anti-inflammatory cytokines includes immunoregulatory molecules that control the proinflammatory cytokine response. Cytokines act together with specific cytokine inhibitors and soluble cytokine receptors to regulate the human immune response.
  • Major anti-inflammatory cytokines include interleukin (IL)-l receptor antagonist, IL-4, IL-6, IL-10, IL-11, and IL-13.
  • Specific cytokine receptors for IL-1, tumor necrosis factor-alpha, and IL-18 also function as proinflammatory cytokine inhibitors.
  • Methods of measuring cytokine, including anti-inflammatory cytokine, levels are well known in the art. For example, serum cytokine levels can be measured using commercially available enzyme- linked immuno-sorbent assay (ELISA) kits.
  • the term "effective amount” refers to a quantity sufficient to achieve a desired effect. In the context of therapeutic or prophylactic applications, the effective amount will depend on the type and severity of the condition at issue and the characteristics of the individual subject, such as general health, age, sex, body weight, and tolerance to
  • the effective amount is the amount sufficient to result in a protective response against a pathogen. In other embodiments, the effective amount of an immunogenic composition is the amount sufficient to result in antibody generation against the antigen. In some embodiments, the effective amount is the amount required to confer passive immunity on a subject in need thereof. With respect to immunogenic compositions, in some embodiments
  • the effective amount will depend on the intended use, the degree of
  • the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the in vitro target and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations.
  • the effective amount may comprise one or more administrations of a composition depending on the embodiment.
  • solid phase support or “solid support”, used interchangeably, is not limited to a specific type of support. Rather a large number of supports are available and are known to one of ordinary skill in the art.
  • Solid phase supports include silica gels, resins, derivatized plastic films, glass beads, cotton, plastic beads, alumina gels.
  • solid support also includes synthetic antigen-presenting matrices, cells, and liposomes. A suitable solid phase support may be selected on the basis of desired end use and suitability for various protocols.
  • solid phase support may refer to resins such as polystyrene (e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPE® resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol
  • polystyrene e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.
  • POLYHIPE® resin obtained from Aminotech, Canada
  • polyamide resin obtained from Peninsula Laboratories
  • An example of a solid phase support include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
  • the nature of the carrier can be either soluble to some extent or insoluble.
  • the support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to a polynucleotide, polypeptide or antibody.
  • the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
  • the surface may be flat such as a sheet, test strip, etc. or alternatively polystyrene beads.
  • suitable carriers for binding antibody or antigen or will be able to ascertain the same by use of routine experimentation.
  • This disclosure provides an antibody fragment (e.g., a Fab fragment or an antigen binding fragment).
  • This disclosure also provides an isolated polypeptide tht comprises, or alternatively consists essentially of, or yet further consists of the amino acid sequence of the Fab fragment or antigen binding fragment (e.g., a Fab fragment) wherein the fragment or the polypeptide binds and/or specifically recognizes a DNABII polypeptide and/or biofilm component comprising a DNABII protein or polypeptide.
  • the antibody fragments or isolated polypeptides comprising, consisting essentially of, or yet further consisting of the antibody fragments, can be any of the Fab fragments from a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a human antibody, a veneered antibody, a diabody, a humanized antibody, an antibody derivative, or a
  • the antibody can be from any appropriate species, e.g., a mammalian species, e.g., a murine, a feline, a canine, a rabbit, or a human.
  • Methods to prepare Fab antibody fragments are known in the art and briefly described herein. One exemplary method is outlined in FIG. 1.
  • the antibody fragments are derived from or produced from antibodies that specifically recognize and bind a DNABII protein, non-limiting examples of such include IHF alpha, IUFbeta, and HU. Non-limiting examples of such polypeptides and antibodies that bind such polypeptides are provided in US Patent No. 8,999,291, incorporated herein by reference.
  • the antibody specifically binds the "tip domain" of the DNABII polypeptide that contains a conformational epitope.
  • the DNABII polyeptide comprises, or consists essentially of, or yet further consists of one of SEQ ID NOS. : 1 to 33.
  • DNABII polypeptides include, for example, the conformational epitope within the tip domain of HTF alpha, HfFbeta or HU, e.g., provided in SEQ ID NOS.: 13, 14, 17, 26-32.
  • the SEQ ID NOS. 13, 14, 17 and 26-32 are contained within a larger polypeptide, that in one aspect, is not the wild-type native polypeptide, e.g., SEQ ID NOS. : 1 to 11.
  • the larger polypeptide can contain additional amino acids at the amine and/or the carboxy terminus, e.g., at least 3, or 4, or 5, or 10, or 15, or 20 or more amino acids at one or both termini.
  • antibodies can be generated against the "tip" region of an DNABII protein, that in one aspect contains or is altered to contain turn of the antiparallel beta ribbon and/or the sequence, NPXT wherein "X” refers to any amino acid, or alternatively X is selected from the amino acids Q, R, K, S, or T.
  • X refers to any amino acid, or alternatively X is selected from the amino acids Q, R, K, S, or T.
  • Such antibodies may be generated using a fragment of the DNABII protein comprising the NPXT sequence, optionally flanked by between about 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 amino acids on one or both sides of the sequence. Non-limiting examples of such are disclosed herein, i.e., those with the consensus amino acid sequence NPXT.
  • antibodies are generated against the tip region of a DNABII protein providing the consensus sequence NPXT, wherein "X" is any amino acid or alternatively X is selected from the amino acids Q, R, K, S, or T.
  • X is any amino acid or alternatively X is selected from the amino acids Q, R, K, S, or T.
  • the residue in the X position may be substituted with any amino acid - e.g., Q, R, K, S, or T. Examples include:
  • SEQ ID NO. 13 Haemophilus influenzae IhfA, A5 fragment:
  • SEQ ID NO. 14 Haemophilus influenzae HU, A5 fragment:
  • SEQ ID NO. 17 Haemophilus influenzae IhfB, modified B4 (mB4) fragment:
  • SEQ ID NO. 26 Haemophilus influenzae IhfA, A tip fragment:
  • SEQ ID NO. 27 Haemophilus influenzae IhfB, B tip fragment:
  • the polypeptide comprising NPXT is at least about 20 amino acids long and the NPXT is centrally in the sequence.
  • Non-limiting examples of such sequences include SEQ ID NOs. 13, 14, and 31.
  • the polypeptides having the NPXT motif e.g., as noted above
  • Applicants have determined that Fab fragments of antibodies raised against DNABII polypeptides lacking the NPXT motif are useful in diagnostic methods to image and monitor biofilm formation and/or disruption.
  • a kit comprising a Fab fragment of an antibody raised against or that binds a DNABII having the NPXT motif and a Fab fragment of an antibody raised against or binds a DNABII (e.g. a modified or naturally occurring polypeptide) that lacks the NPXT motif.
  • a kit can comprise an antibody that recognizes and bind the polypeptide A5, B4, or mB4 (therapeutic) can be combined in a kit wth an Fab fragment of an antibody that recognizes and bind the polypeptide A3 or B2 (diagnostic).
  • the kit is useful for diagnosis, treatment and monitoring biofilm treatment.
  • the isolated polypeptide comprises, or alternatively consists essentially of, or yet further consists of a Fab fragment of an mIhfB4 N THi antibody or an equivalent of the mIhfB4 N THi antibody, examples of such are provided herein.
  • the Fab fragment is prepared from an antibody that is produced by a hybridoma cell line, e.g. the hybridomas listed in Table 1.
  • this disclosure also provides an antibody fragment, antigen binding fragment or polypeptide that comprises, or consists essentially of, or yet consists of, a Fab fragment of an antibody disclosed in Table 1, e.g., an IhfmB4 NTHI antibody or an equivalent of the antibody.
  • the isolated polypeptide comprises, or alternatively consists essentially of, or yet further consists of a Fab fragment of an IhfA5 N THi antibody or an equivalent of the antibody.
  • the present disclosure provides an isolated antibody disclosed in Table 1 or antigen binding fragment of an antibody disclosed in Table 1 that is at least 85% identical, or altematvively at least 90%, or alternatively at least 95 %, or alternatively at least 100%) identical to an antibody fragment from an antibody disclosed in Table 1, or selected from the group consisting of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
  • the present disclosure provides an isolated antibody fragment, antigen binding fragment or polypeptide comprising the CDRs of (i) the antibody produced by hybridoma cell line disclosed in Table 1, e.g., IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
  • the present disclosure provides an isolated antibody fragment, antigen binding fragment or polypeptide from an antibody that has a CDR that is at least 85% or alternatvively at least 90%, or alternatively at least 95 %, or alternatively at least 100% identical to (i) the antibody produced by hybridoma disclosed in Table 1, e.g., the cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
  • the HC variable domain sequence of the antibody that provides such comprises the HC variable domain sequence of (i) the antibody produced by a hybridoma cell line disclosed in Table 1, e.g., IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line MIhfB4 NTHI 12E6.F8.D12.D5; and/or the LC variable domain sequence comprises the LC variable domain sequence of antibody disclosed in Table 1, e.g., (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D
  • the HC variable domain sequence of the antibody tht provides such sequence comprises a HC variable domain sequence at least 85% identical, or alternatvively at least 90%), or alternatively at least 95 %, or alternatively at least 100%> identical to a HC variable domain sequence of an antibody disclosed in Table 1, e.g.
  • the LC variable domain sequence comprises a LC variable domain sequence at least 85%> identical or alternatvively at least 90%, or alternatively at least 95 %, or alternatively at least 100%> identical to the of LC variable domain sequence an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI
  • the present disclosure provides Fab fragments comprising a heavy chain (HC) variable domain sequence and a light chain (LC) variable domain sequence, wherein the heavy chain and light chain immunoglobulin variable domain sequences form an antigen binding site that binds to an epitope of a DNABII protein.
  • the heavy chain variable region comprises a CDRHl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRHl of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRH2 of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI
  • the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRH3 of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence comprising the heavy chain variable region sequence of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • Table 1 e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F
  • the light chain variable region comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL1 of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • Table 1 e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NT
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL2 of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • Table 1 e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NT
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL3 of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • Table 1 e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NT
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • polynucleotide sequence comprising the light chain variable region sequence of any one of the following antibodies: an antibody disclosed in Table 1, e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • an antibody disclosed in Table 1 e.g. (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5, or an equivalent of each thereof.
  • the heavy chain variable region of the antibody or the fragment thereof comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising FSLTSYS (SEQ ID NO. 58), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of FSLTSYSV (SEQ ID NO. 59), FSLTSYSVH (SEQ ID NO. 60), GFSLTSYS (SEQ ID NO. 61), or an equivalent each thereof.
  • FSLTSYS SEQ ID NO. 58
  • the heavy chain variable region of the antibody or fragment thereof comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising FNIKDYY (SEQ ID NO. 110), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of FNIKDYYM (SEQ ID NO. 111), FNIKDYYMH (SEQ ID NO. 112), GFNIKDYY (SEQ ID NO. 113), or an equivalent each thereof.
  • the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising rWAGGST (SEQ ID NO. 62), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of VIWAGGST (SEQ ID NO. 63), GVIWAGGST (SEQ ID NO. 64), LGVIWAGGST (SEQ ID NO. 65), WLGVIW AGGS T (SEQ ID NO. 66), IWAGGSTN (SEQ ID NO. 67), VIWAGGSTN (SEQ ID NO. 68), GVIWAGGSTN (SEQ ID NO.
  • LGVIWAGGSTN SEQ ID NO. 70
  • WLGVIWAGGSTN SEQ ID NO. 71
  • IWAGGSTNY SEQ ID NO. 72
  • VIWAGGSTNY SEQ ID NO. 73
  • GVIWAGGSTNY SEQ ID NO. 74
  • LGVIWAGGSTNY SEQ ID NO. 75
  • WLGVIWAGGSTNY SEQ ID NO. 76
  • the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising IDPENDDT (SEQ ID NO. 114), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of WIDPENDDT (SEQ ID NO. 115), GWIDPENDDT (SEQ ID NO. 116), IGWIDPENDDT (SEQ ID NO. 117), WIGWIDPENDDT (SEQ ID NO. 118),
  • IDPENDDTE SEQ ID NO. 119
  • WIDPENDDTE SEQ ID NO. 120
  • GWIDPENDDTE SEQ ID NO. 121
  • IGWIDPENDDTE SEQ ID NO. 122
  • WIGWIDPENDDTE SEQ ID NO. 123
  • IDPENDDTEY SEQ ID NO. 124
  • WIDPENDDTEY SEQ ID NO. 125
  • GWIDPENDDTEY SEQ ID NO. 126
  • IGWIDPENDDTEY SEQ ID NO. 127
  • WIGWIDPENDDTEY SEQ ID NO. 128, or an equivalent each thereof.
  • the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising REDS (SEQ ID NO. 77), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of AREDS (SEQ ID NO. 78) or an equivalent thereof.
  • the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising TELGAY (SEQ ID NO. 129) or an equivalent thereof.
  • the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • CCTCA SEQ ID NO. 50 or an equivalent thereof.
  • the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QNVGTN (SEQ ID NO. 79), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QNVGTNV (SEQ ID NO. 80), QNVGTNVA (SEQ ID NO. 81), or an equivalent each thereof.
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QSLLDSNGKTY (SEQ ID NO. 130), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QSLLDSNGKTYL (SEQ ID NO. 131), Q SLLD SNGKT YLN (SEQ ID NO. 132), or an equivalent each thereof.
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising SAS (SEQ ID NO. 82), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of YSAS (SEQ ID NO. 83), IYSAS (SEQ ID NO. 84), LIYSAS (SEQ ID NO. 85), ALIYSAS (SEQ ID NO. 86), SASY (SEQ ID NO. 87), YSASY (SEQ ID NO. 88), IYSASY (SEQ ID NO. 89), LIYSASY (SEQ ID NO.
  • ALIYSASYRYS (SEQ ID NO. 106), or an equivalent each thereof.
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising LVS (SEQ ID NO. 133), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of YLVS (SEQ ID NO. 134), IYLVS (SEQ ID NO. 135), LIYLVS (SEQ ID NO. 136), RLIYLVS (SEQ ID NO. 137), LVSK (SEQ ID NO. 138), YLVSK (SEQ ID NO. 139), IYLVSK (SEQ ID NO. 140), LIYLVSK (SEQ ID NO.
  • YLVSKLD S (SEQ ID NO. 154), IYLVSKLD S (SEQ ID NO. 155), LIYLVSKLD S (SEQ ID NO. 156), RLIYLVSKLD S (SEQ ID NO. 157), or an equivalent each thereof.
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QQYNSYP (SEQ ID NO. 108), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QQYNSYPT (SEQ ID NO. 109), or an equivalent thereof.
  • the light chain variable region of the antibody or a fragment thereof comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising WQSTHFPH (SEQ ID NO. 158), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of WQSTHFPHT (SEQ ID NO. 159) or an equivalent thereof.
  • the light chain variable region of the antibody or fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the polynucleotide sequence:
  • the light chain variable region of the antibody or fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • ATCAAA SEQ ID NO. 56 or an equivalent thereof.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • Exemplary antibodies comprising the disclosed CDR sequences and heavy and light chain variable sequences from which the antibody fragments, antigen binding fragments or polypeptides are derived are disclosed in Table 2 and Table 3, respectively.
  • Alternate CDR predictions may be made based on the heavy and/or light chain sequences - e.g., based on the Kabat, Clothia, AbM, or contact definitions of CDR specificity; details of these CDR prediction methods are known in the art (see, e.g., bioinf.org.uk/abs/#cdrid) and/or commercially available.
  • Those disclosed in Table 2 are the result of utilizing the CDR prediction algorithms provided by the Ofran Lab (Paratome available at
  • the present disclosure provides antibody fragments (e.g., a Fab fragment) of an isolated antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95%, or 100% identical to an antibody selected from the group consisting of an antibody disclosed in Table 1, e.g. Ihf A5, Ihf mB4, or a biological equivalent of each thereof.
  • the present disclosure provides isolated antibody fragments comprising the CDRs of Ihf A5. In one aspect, the present disclosure provides isolated antibody fragments of an antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95 %, or 100% identical to Ihf A5 or a biological equivalent thereof.
  • the present disclosure provides isolated antibody fragments comprising the CDRs of Ihf mB4. In one aspect, the present disclosure provides isolated antibody fragments of an isolated antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95%, or 100% identical to Ihf mB4 or a biological equivalent thereof.
  • the HC variable domain sequence comprises a variable domain sequence of Ihf A5 and the LC variable domain sequence comprises a variable domain sequence of Ihf A5.
  • the HC variable domain sequence comprises a variable domain sequence of Ihf mB4 and the LC variable domain sequence comprises a variable domain sequence of Ihf mB4.
  • the antibody fragments include one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85%, or alternatively at least 90%, or alternatively at least 95 % or 100%) identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85%> , or alternatively at least 90%, or alternatively at least 95 %, or 100%) identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 85%> , or alternatively at least 90%, or alternatively at least 95 %, or 100% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 85% , or alternatively at least 90%, or alternatively at least 95 %, or 100% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • the antibody fragment, antigen binding fragment or polypeptides binds a DNABII protein with a dissociation constant (KD) of less than 10 "4 M, 10 "5 M, 10 "6 M, 10 “7 M, 10 “8 M, 10 “9 M, 10 "10 M, 10 "11 M, or 10 ⁇ 12 M.
  • KD dissociation constant
  • the antigen binding site specifically binds to a DNABII protein.
  • the affinity of the antibody or antigen binding fragment is less than or about 1000 picoMole (pM), 900 pM, 800 pM, 700 pM, 600 pM, 500 pM, 400 pM, 300 pM, 200 pM, about 100 pM, 50 pM, 40 pM , 30 pM, 20 pM, 10 pM, 9 pM, and 8 pM.
  • pM picoMole
  • the antibody fragment or antigen binding fragment is soluble Fab.
  • the polypeptide comprises, or alternatively consists essentially of, or yet further consists of, a soluble Fab of antibody disclosed herein, or an equivalent of the soluble Fab.
  • the antibody from which the antibody fragment, antigen binding fragment or polypeptide is a rabbit antibody.
  • the antibody from which the antibody fragment, antigen binding fragment or polypeptide is derived is a human or humanized antibody or is non-immunogenic in a human.
  • the antibody from which the antibody fragment, antigen binding fragment or polypeptide is derived comprises a human antibody framework region (e.g., a humanized antibody).
  • the antibody comprises an antibody framework region from a non- human species such as a simian, equine, feline, canine, bovine, porcine, caprine, or ovine.
  • the antibody is a chimeric antibody. In any one or more of these aspects, the antibody may further comprise one or more of the CDR regions and/or the heavy and/or light chains disclosed herein.
  • one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid.
  • the substitution may be
  • “conservative” in the sense of being a substitution within the same family of amino acids.
  • the naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families.
  • Amino acids with basic side chains lysine, arginine, histidine.
  • Amino acids with uncharged polar side chains asparagine, glutamine, serine, threonine, tyrosine.
  • Amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
  • one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
  • the constant regions of antibodies may also be varied.
  • antibodies may be provided with Fc regions of any isotype: IgA (IgAl, IgA2), IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4) or IgM.
  • the constant regions of antibodies may further be adapted for specific therapeutic indications, e.g., according to the teachings of Irani et al. (2015) Molecular Immunol.67: 171-182.
  • IgG subclasses vary, as do their response profiles to different infectious diseases, and these differences can be utilized in the development of effective therapeutic antibodies (Carter (2006) Nat. Rev. Immunol. 6:343- 357; Jefferis (2012) Arch. Biochem. Biophys. 526: 159-166). Although the heavy chains share greater than 90% sequence identity across IgG sub classes (Rispens and Vidarsson (2014) Nimmerjahn, M.E.A. (Ed.), Chapter 9 - Human IgG Subclasses. Academic Press. Boston, pp.159-177.), there are differences in surface exposed residues on the constant (CHI, CH2 and CH3) domains, as well as substantial variation within the hinge region.
  • FcyR activating and inhibitory Fey receptors
  • FcRn neonatal receptor for IgG
  • complement component Clq complement component
  • Non-limiting examples of constant region sequences include:
  • ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQD ASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSL HRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVS SVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNE LVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVA AEDWKKGDTFSCMVGHEALPLAFTQKTIDRMAGKPTHVNVSVVMAEVDGTCY.
  • the antibody fragments, antigen binding fragments or polypeptides are derived from antibodies specific to the IhfA fragment A5 (SEQ ID NO. 13) and comprise constant regions derived from IgM or IgG, such as but not limited to IgG2 (in certain aspects IgG2a).
  • IgG such as IgGl, IgG2, IgG3, and IgG4, IgM, IgA such as IgAl and IgA2, IgD, and IgE and can preferably include IgG and IgM.
  • the isotype and subclass of the monoclonal antibody can be determined by, for example, an Ouchterlony test, ELISA, or radio immunoassay (hereinafter, referred to as "RIA").
  • RIA radio immunoassay
  • a commercially available kit for identification e.g., Mouse Typer Kit; Bio-Rad Laboratories, Inc., and RAT MONOCLONAL ANTIBODY ISOTYPING TEST KIT: AbD Serotec
  • a commercially available kit for identification e.g., Mouse Typer Kit; Bio-Rad Laboratories, Inc., and RAT MONOCLONAL ANTIBODY ISOTYPING TEST KIT: AbD Serotec
  • the antibody fragments, antigen binding fragments or polypeptides are derived from antibodies specific to the IhfB fragment mB4 (SEQ ID NO. 17) or an equivalent thereof, and comprise constant regions derived from IgG, such as but not limited to IgGl .
  • the antibody fragments, antigen binding fragments or polypeptides are derived from an antibodies that comprise a heavy chain constant region that is at least 80% identical, or alternatively as least 85%, or alternatively at least 90%, or alternatively at least 95 % or alternatively at least 100% identical, to the heavy chain constant region sequence of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI
  • the antibody fragments, antigen binding fragments or polyeptides are derived from an antibody that comprises a light chain constant region that is at least 80% identical, or alternatively as least 85%, or alternatively at least 90%, or alternatively at least 95 % or alternatively at least 100% identical, to the light chain constant region sequence of any one of the following parental antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI
  • the parental antibody or Fab fragment antigen binding fragments bind to the epitope bound by DNABII antibodies.
  • the antibody fragment contains structural modifications to facilitate rapid binding and cell uptake and/or slow release.
  • the antibody fragments, antigen binding fragments and polypeptides and equivalents thereof can be combined with a detectable or purification label and/or a carrier, e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
  • a carrier e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
  • An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region.
  • the variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions.
  • Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
  • the hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen.
  • the binding specificity of a pair of heavy and light chains is defined by the sequence of CDRl, CDR2 and CDR3 of the heavy and light chains.
  • Antibodies for the production of the Fab fragments can be generated using conventional techniques known in the art and are well-described in the literature. Several methodologies exist for production of polyclonal antibodies. For example, polyclonal antibodies are typically produced by immunization of a suitable mammal such as, but not limited to, chickens, goats, sheep, guinea pigs, hamsters, horses, dogs, mice, rats, and rabbits. An antigen is injected into the mammal, and induces the B-lymphocytes to produce immunoglobulins specific for the antigen. Immunoglobulins may be purified from the mammal's serum.
  • a suitable mammal such as, but not limited to, chickens, goats, sheep, guinea pigs, hamsters, horses, dogs, mice, rats, and rabbits.
  • An antigen is injected into the mammal, and induces the B-lymphocytes to produce immunoglobulins specific for the antigen. Immunoglobulin
  • Antibodies specific to an IHFa and/or an IHFp subunit can be generated by injection of polypeptides corresponding to different epitopes of IHFa and IHFp.
  • antibodies can be generated using the 20 amino acids of each subunit such as SEQ ID NOs. 12 and 13 for IHFa (fragments A3 and A5 of IHF, respectively), SEQ ID NO. 14 for HU (fragment A5 of HU), SEQ ID NOs. 15 to 17 for IHFp (fragments B2, B4, and mB4 of IHF).
  • Variations of this methodology include modification of adjuvants, routes and site of administration, injection volumes per site and the number of sites per animal for optimal production and humane treatment of the animal.
  • adjuvants typically are used to improve or enhance an immune response to antigens. Most adjuvants provide for an injection site antigen depot, which allows for a stow release of antigen into draining lymph nodes.
  • Other adjuvants include surfactants which promote concentration of protein antigen molecules over a large surface area and immunostimulatory molecules.
  • Non-limiting examples of adjuvants for polyclonal antibody generation include Freund's adjuvants, Ribi adjuvant system, MPL derived adjuvants, those derived from the heat labile enterotoxin of E.
  • Polyclonal antibodies can be generated using methods known in the art some of which are described in U.S. Patent Nos. 7,279,559; 7, 119, 179; 7,060,800; 6,709,659; 6,656,746; 6,322,788; 5,686,073; and
  • Monoclonal antibodies can be generated using conventional hybridoma techniques known in the art and well-described in the literature.
  • a hybridoma is produced by fusing a suitable immortal cell line (e.g., a myeloma cell line such as, but not limited to, Sp2/0, Sp2/0-AG14, NSO, NS1, NS2, AE-1, L.5, P3X63Ag8,653, Sp2 SA3, Sp2 MAI, Sp2 SSI, Sp2 SA5, U397, MIA 144, ACT IV, MOLT4, DA-1, JURKAT, WEHI, K-562, COS, RAJI, NIH 313, HL-60, MLA 144, NAM AIWA, NEURO 2A, CHO, PerC.6, YB2/0) or the like, or heteromyelomas, fusion products thereof, or any cell or fusion cell derived there from, or any other suitable cell line as known in the art (see, those at the following web
  • antibody producing cells such as, but not limited to, isolated or cloned spleen, peripheral blood, lymph, tonsil, or other immune or B cell containing cells, or any other cells expressing heavy or light chain constant or variable or framework or CDR sequences, either as endogenous or heterologous nucleic acid, as recombinant or endogenous, viral, bacterial, algal, prokaryotic, amphibian, insect, reptilian, fish, mammalian, rodent, equine, ovine, goat, sheep, primate, eukaryotic, genomic DNA, cDNA, rDNA, mitochondrial DNA or RNA, chloroplast DNA or RNA, hnRNA, mRNA, tRNA, single, double or triple stranded, hybridized, and the like or any combination thereof.
  • cells such as, but not limited to, isolated or cloned spleen, peripheral blood, lymph, tonsil, or other immune or B cell containing cells, or any other cells expressing heavy or light chain
  • Antibody producing cells can also be obtained from the peripheral blood or, in particular embodiments, the spleen or lymph nodes, of humans or other suitable animals that have been immunized with the antigen of interest. Any other suitable host cell can also be used for expressing-heterologous or endogenous nucleic acid encoding an antibody, specified fragment or variant thereof, of the present disclosure.
  • the fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods.
  • Some embodiments disclosed herein relate to specific hybridomas that produce monoclonal antibodies to IHF fragments; non-limiting examples include IhfA5 NTHI 14G8.F5.G6 (ATCC No. PTA-122334), IhfB4 NTHI 4E11.E5.G2 (ATCC No. PTA-122336), mIhfB4 NTHI 12E6.F8.D12.D5 (ATCC No. PTA-122335).
  • Suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, cDNA, or the like, display library; e.g., as available from various peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, cDNA, or the like, display library; e.g., as available from various peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, cDNA, or the like, display library; e.g., as available from various peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonu
  • SAM selected lymphocyte antibody method
  • SLAM selected lymphocyte antibody method
  • gel microdroplet and flow cytometry Powell et al. (1990) Biotechnol. 8:333-337; One Cell Systems, (Cambridge, Mass.); Gray et al. (1995) J. Imm. Meth. 182: 155-163; and Kenny et al. (1995) Bio. Technol.
  • Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al. (1989) PNAS 86: 3833-3837; Winter et al. (1991) Nature 349: 293-299).
  • Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
  • linker peptide typically around 5 to 25 amino acids in length.
  • the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
  • scF v s may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
  • DNA encoding scF v can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above- mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
  • An expression vector containing the DNA encoding scF v and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
  • Antigen binding fragments for example the F(ab') 2 fragments, can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragments.
  • Fab fragments in particular murine Fab fragments produced from murine monoclonal antibodies, can also be produced by digestion of the antibody with the thiol protease ficin in the presence of cysteine.
  • Fab fragments in particular rabbit Fab fragments produced from rabbit polyclonal antibodies, may also be produced by digestion of the antibody with the protease papain in the presence of cysteine-HCl.
  • Fab expression libraries may be constructed to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity (Huse et al. (1989) Science 256: 1275-1281). Upon generation of the fragment, the fragment can be isolated and sequenced using conventional techniques and the amino acid sequence is determined.
  • Antibody derivatives of the present disclosure can also be prepared by delivering a polynucleotide encoding an antibody fragment, antigen binding fragment or polypeptide as disclosed herein to a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk.
  • a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk.
  • antibody derivative includes post-translational modification to linear polypeptide sequence of the antibody or fragment.
  • U.S. Patent No. 6,602,684 Bl describes a method for the generation of modified glycol-forms of antibodies, including whole antibody molecules, antibody fragments, or fusion proteins that include a region equivalent to the Fc region of an immunoglobulin, having enhanced Fe-mediated cellular toxicity, and glycoproteins so generated.
  • the parental antibodies from which the antibody fragments, antigen binding fragments and polypeptides asdisclosed herein, also include derivatives that are modified by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response.
  • Antibody derivatives include, but are not limited to, antibodies that have been modified by
  • Non-limiting examples of the modified antibodies contemplated herein are agylcosylated whole antibody molecules, antibody fragments, or fusion proteins that include a region equivalent to the Fc region of an immunoglobulin.
  • Such aglycosyltae forms can be generated, for example, in host cells that lack the ability to modify proteins with N-linked glycans or by mutating N-linked consensus sites on the antibody of interest.
  • the derivatives may contain one or more non-classical amino acids.
  • Antibody derivatives of the parental antibodies also can be prepared by delivering a polynucleotide disclosed herein to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom.
  • a polynucleotide disclosed herein to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom.
  • Transgenic maize have been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See, e.g., Hood et al. (1999) Adv. Exp. Med. Biol. 464: 127-147 and references cited therein.
  • Antibody derivatives have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers. See, e.g., Conrad et al. (1998) Plant Mol. Biol. 38: 101-109 and references cited therein.
  • scFv's single chain antibodies
  • Antibody derivatives of the parental antibodies also can be produced, for example, by adding exogenous sequences to modify immunogenicity or to reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic. Generally part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions are replaced with human or other amino acids.
  • isolated polypeptides comprising, or alternatively consisting essentially of, or yet further consisting of, the Fab fragment or antigen binding fragmet, or a polypeptide as disclosed herein tht further comprises a detectable or a purification label, as described herein.
  • Chimeric, humanized or primatized parental antibodies of the antibody fragments, antigen binding fragments or polypeptides of the present disclosure can be prepared based on the sequence of a reference monoclonal antibody prepared using standard molecular biology techniques. Such antibodies may be used to generate the antibody fragments (e.g., Fab fragment or antigen binding fragment) of the present disclosure.
  • DNA encoding the heavy and light chain immunoglobulins can be obtained from the hybridoma of interest and engineered to contain non-reference (e.g., human) immunoglobulin sequences using standard molecular biology techniques.
  • the murine variable regions can be linked to human constant regions using methods known in the art (U.S. Patent No. 4,816,567).
  • the murine CDR regions can be inserted into a human framework using methods known in the art (U.S. Patent No. 5,225,539 and U.S. Patent Nos. 5,530,101; 5,585,089; 5,693,762; and 6, 180,370).
  • the murine CDR regions can be inserted into a primate framework using methods known in the art (PCT International Pat. Application Publication Nos. WO 93/02108 and WO 99/55369).
  • Fully human antibody sequences are made in a transgenic mouse which has been engineered to express human heavy and light chain antibody genes. Multiple strains of such transgenic mice have been made which can produce different classes of antibodies. B cells from transgenic mice which are producing a desirable antibody can be fused to make hybridoma cell lines for continuous production of the desired antibody.
  • Jakobovits (1998) Exp. Opin. Invest. Drugs 7(4):607-614; Tsuda et al. (1997) Genomics 42:413-421; Sherman-Gold (1997) Genetic Engineering News 17(14); Mendez et al. (1997) Nature Genetics 15: 146-156; Jakobovits (1996) Weir's Handbook of Experimental
  • Chimeric antibodies are those in which the various domains of the antibodies' heavy and light chains are coded for by DNA from more than one species. See, e.g., U.S. Pat. No. 4,816,567.
  • the antibodies disclosed herein can also be modified to create veneered antibodies.
  • Veneered antibodies are those in which the exterior amino acid residues of the antibody of one species are judiciously replaced or "veneered" with those of a second species so that the antibodies of the first species will not be immunogenic in the second species thereby reducing the immunogenicity of the antibody. Since the antigenicity of a protein is primarily dependent on the nature of its surface, the immunogenicity of an antibody could be reduced by replacing the exposed residues which differ from those usually found in another mammalian species antibodies. This judicious replacement of exterior residues should have little, or no, effect on the interior domains, or on the interdomain contacts.
  • ligand binding properties should be unaffected as a consequence of alterations which are limited to the variable region framework residues.
  • the process is referred to as "veneering" since only the outer surface or skin of the antibody is altered, the supporting residues remain undisturbed.
  • Non-limiting examples of the methods used to generate veneered antibodies include EP 519596; U.S. Pat. No. 6,797,492; and described in Padlan et al. (1991) Mol. Immunol. 28(4- 5):489-498.
  • the antibody fragments, antigen binding fragments and polypeptides as disclosed herein can be recovered and purified from recombinant cell cultures by known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography.
  • HPLC High performance liquid chromatography
  • Antibodies for the preparation the antibody fragments, antigen binding fragments or of the present disclosure include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells, or alternatively from a prokaryotic host as described above.
  • a eukaryotic host including, for example, yeast, higher plant, insect and mammalian cells, or alternatively from a prokaryotic host as described above.
  • a number of antibody production systems are described in Birch & Radner (2006) Adv. Drug Delivery Rev. 58:671-685.
  • an antibody fragment being tested binds with protein or polypeptide, then the antibody fragment being tested and the antibody fragment sprovided by this disclosure are equivalent. It also is possible to determine without undue experimentation, whether an antibody fragment has the same specificity as the antibody fragment disclosed herein by determining whether the antibody being tested prevents an antibody fragment disclosed herein from binding the protein or polypeptide with which the antibody fragment is normally reactive. If the antibody fragment being tested competes with the antibody fragment disclosed herein as shown by a decrease in binding by the antibody fragment disclosed herein, then it is likely that the two antibody fragments bind to the same or a closely related epitope.
  • antibody and "antibody fragment” also is intended to include antibodies of all immunoglobulin isotypes and subclasses. Particular isotypes of a monoclonal antibody can be prepared either directly by selecting from an initial fusion, or prepared secondarily, from a parental hybridoma secreting a monoclonal antibody of different isotype by using the sib selection technique to isolate class switch variants using the procedure described in Steplewski et al. (1985) Proc. Natl. Acad. Sci. USA 82:8653 or Spira et al. (1984) J.
  • the antibody fragment, antigen binding fragment or polyeptide it will be useful to detectably or therapeutically label the antibody fragment, antigen binding fragment or polyeptide. Suitable labels are described herein. Methods for conjugating antibodies and polypeptides to these agents are known in the art. For the purpose of illustration only, the antibody fragment, antigen binding fragment or polypeptide can be labeled with a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like. Such labeled antibodies can be used for diagnostic techniques, either in vivo, or in an isolated test sample.
  • haptens such as biotin, which reacts avidin, or dinitrophenol, pyridoxal, and fluorescein, which can react with specific anti-hapten antibodies. See, Harlow and Lane (1988) supra.
  • variable region of the parental antibodies of the present disclosure can be modified by mutating amino acid residues within the VH and/or VL CDR 1, CDR 2 and/or CDR 3 regions to improve one or more binding properties (e.g., affinity) of the antibody. Mutations may be introduced by site-directed mutagenesis or PCR-mediated mutagenesis and the effect on antibody binding, or other functional property of interest, can be evaluated in appropriate in vitro or in vivo assays. In certain embodiments, conservative modifications are introduced and typically no more than one, two, three, four or five residues within a CDR region are altered. The mutations may be amino acid substitutions, additions or deletions.
  • Framework modifications can be made to the parental antibodies to decrease immunogenicity, for example, by "backmutating" one or more framework residues to the corresponding germline sequence.
  • the antibody fragments, antigen binding fragments or polypeptides disclosed herein may be engineered to include modifications within the Fc region to alter one or more functional properties of the antibody, such as serum half-fife, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • modifications include, but are not limited to, alterations of the number of cysteine residues in the hinge region to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody (U.S. Patent No. 5,677,425) and amino acid mutations in the Fc hinge region to decrease die biological half-life of the antibody (U.S. Patent No. 6,165,745).
  • the antibody fragments disclosed herein may be chemically modified. Glycosylation of an antibody can be altered, for example, by modifying one or more sites of glycosylation within the antibody sequence to increase the affinity of the antibody for antigen (U.S. Patent Nos. 5,714,350 and 6,350,861). Alternatively, to increase antibody-dependent cell-mediated cytotoxicity, a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures can be obtained by expressing the antibody in a host cell with altered glycosylation mechanism (Shields et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech. 17: 176-180).
  • the antibodies fragment, antigen binding fragment or polypeptide as disclosed herein can be pegylated to increase biological half-life by reacting the antibody or fragment thereof with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
  • Pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water soluble polymer).
  • polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (CI -CIO) alkoxy- or aryloxy -polyethylene glycol or polyethylene glycol-maleimide.
  • the antibody to be pegylated can be an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies disclosed herein (EP 0154316 and EP 0401384).
  • the antibody binding fragment, antigen binding fragment or polypeptides may be chemically modified by conjugating or fusing the antigen-binding region to serum protein, such as human serum albumin, to increase half-life of the resulting molecule.
  • serum protein such as human serum albumin
  • the antibody fragment, antigen binding fragment or polypeptide as disclosed herein may be conjugated to a diagnostic agent and used diagnostically, for example, to monitor the development or progression of a disease and determine the efficacy of a given treatment regimen.
  • diagnostic agents include enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
  • the detectable substance may be coupled or conjugated either directly to the antibody or fragment thereof, or indirectly, through a linker using techniques known in the art.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase.
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin.
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin.
  • An example of a luminescent material includes luminol.
  • bioluminescent materials include luciferase, luciferin, and aequorin.
  • radioactive material examples include 125 I, 131 I, Indium-111, Lutetium-171, Bismuth-212, Bismuth-213, Astatine-211, Copper-62, Copper- 64, Copper-67, Yttrium-90, Iodine-125, Iodine-131, Phosphorus-32, Phosphorus-33, Scandium-47, Silver-I l l, Gallium-67, Praseodymium- 142, Samarium-153, Terbium-161, Dysprosium- 166, Holmium-166, Rhenium-186, Rhenium-188, Rhenium-189, Lead-212, Radium-223, Actinium-225, Iron-59, Selenium-75, Arsenic-77, Strontium-89, Molybdenum- 99, Rhodium-1105, Palladium- 109, Praseodymium- 143, Promethium-149, Erbium-169, Iridium- 194, Gold- 198,
  • Monoclonal antibodies may be indirectly conjugated with radiometal ions through the use of bifunctional chelating agents that are covalently linked to the antibodies.
  • Chelating agents may be attached through amities (Meares et al. (1984) Anal. Biochem. 142:68-78); sulfhydral groups (Koyama 1994 Chem. Abstr. 120: 217262t) of amino acid residues and carbohydrate groups (Rodwell et al. (1986) PNAS USA 83 :2632-2636; Quadri et al. (1993) Nucl. Med. Biol. 20:559-570).
  • the antibody fragment, antigen binding fragment or polypeptide of the present disclosure may be conjugated to a therapeutic agent.
  • Suitable therapeutic agents include antibiotics or antimicrobials for example, or host defense peptides (e.g., specifically targeted antimicrobial peptides (STAMPs)).
  • Additional suitable conjugated molecules include ribonuclease (RNase), DNase, an antisense nucleic acid, an inhibitory RNA molecule such as a siRNA molecule, an immunostimulatory nucleic acid, aptamers, ribozymes, triplex forming molecules, and external guide sequences.
  • RNase ribonuclease
  • DNase DNase
  • an antisense nucleic acid an inhibitory RNA molecule
  • an inhibitory RNA molecule such as a siRNA molecule
  • an immunostimulatory nucleic acid aptamers
  • ribozymes triplex forming molecules
  • triplex forming molecules and external guide sequences.
  • Aptamers are small nucleic acids ranging from 15-50 bases in length that fold into defined secondary and tertiary structures, such as stem-loops or G- quartets, and can bind small molecules, such as ATP (U.S. Pat. No. 5,631,146) and theophiline (U.S. Pat. No
  • Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intra- molecularly or inter-molecularly. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage. Triplex forming function nucleic acid molecules can interact with double-stranded or single-stranded nucleic acid by forming a triplex, in which three strands of DNA form a complex dependent on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules can bind target regions with high affinity and specificity. Suitable conjugated molecules may further include any protein that binds to DNA provided that it does not create or stabilize biofilm architecture; it is envisioned that at least a subset of such proteins may facilitate the kinetics of binding for the agents disclosed herein.
  • the functional nucleic acid molecules may act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules may possess a de novo activity independent of any other molecules.
  • the therapeutic agents can be linked to the fragment or polypeptide directly or indirectly, using any of a large number of available methods.
  • an agent can be attached at the hinge region of the reduced antibody component via disulfide bond formation, using cross-linkers such as N-succinyl 3-(2-pyridyldithio) proprionate (SPDP), or via a carbohydrate moiety in the Fc region of the antibody (Yu et al. (1994) Int. J. Cancer 56: 244; Upeslacis et al., "Modification of Antibodies by Chemical Methods," in Monoclonal antibodies: principles and applications, Birch et al.
  • SPDP N-succinyl 3-(2-pyridyldithio) proprionate
  • the fragments or polypeptides can be linked to another functional molecule such as another antibody or ligand for a receptor to generate a bi-specific or multi-specific molecule that binds to at least two or more different binding sites or target molecules.
  • Linking of the antibody to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, can be done, for example, by chemical coupling, genetic fusion, or non-covalent association.
  • Multi-specific molecules can further include a third binding specificity, in addition to the first and second target epitope.
  • Bi-specific and multi-specific molecules can be prepared using methods known in the art. For example, each binding unit of the hi-specific molecule can be generated separately and then conjugated to one another. When the binding molecules are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation.
  • cross-linking agents examples include protein A, carbodiimide, N-succinimidyl-S-acetyl- thioacetate (SAT A), 5,5'-dithiobis(2-nitroberizoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl)cyclohaxane-I-carboxylate (sulfo-SMCC) (Karpovsky et al. (1984) J. Exp. Med. 160: 1686; Liu et al. (1985) Proc. Natl. Acad. Sci. USA 82:8648).
  • the binding molecules are antibodies, they can be conjugated by sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains.
  • the antibody fragment, antigen binding fragment or polypeptide as disclosed herein may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
  • solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
  • the antibody fragment, antigen binding fragment or polypeptide also can be bound to many different carriers.
  • this disclosure also provides compositions containing the fragments or polypeptides and another substance, active or inert.
  • examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylase, natural and modified cellulose, polyacrylamide, agarose, and magnetite.
  • the nature of the carrier can be either soluble or insoluble for purposes disclosed herein. Those skilled in the art will know of other suitable carriers for binding monoclonal antibodies, or will be able to ascertain such, using routine experimentation.
  • compositions comprising, or alternatively consisting essentially of, or yet further consisting of, one or more of the above embodiments are further provided herein.
  • polynucleotides that encode the amino acid sequence of the antibody fragment, the antigen binding fragment or polypeptides, as well as methods to produce recombinantly or chemically synthesize the fragments and polypeptides.
  • the antibody polypeptides and fragments can be produced in a eukaryotic or a prokaryotic cell, or by other methods known in the art and briefly described herein.
  • the fragments and isolated polypeptides comprising the fragments disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the biofilm.
  • the higher the binding affinity of an antibody or antibody fragment or isolated polypeptides comprising the antibody fragments the more stringent wash conditions can be performed in an immunoassay to remove nonspecifically bound material without removing the target.
  • the fragments and isolated polypeptides comprising the antibody fragments of the present technology useful in the disclosed methods usually have binding affinities of at least 10 "6 , 10 "7 , 10 "8 , 10 "9 , 10 "10 , 10 "11 , or 10 "12 M.
  • the fragments and isolated polypeptides comprising the antibody fragments have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
  • the affinity of the antibody or antigen binding fragment is less than or about 1000 picoMole (pM), less than about 900 pM, less than about 800 pM, less than about 700 pM, less than about 600 pM, less than about 500 pM, less than about 400 pM, less than about 300 pM, less than about 200 pM, less than about 100 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, or about 10 pM, or about 9 pM, or about 8 pM, or alternatively less than about 4 pM, or alternatively less than about 2 pM.
  • pM picoMole
  • a peptide linker can be added to the N-terminus or C-terminus of the antibody fragment, antigen binding fragment or polypeptide as disclosed herein.
  • a “linker” or “peptide linker” refers to a peptide sequence linked to either the N- terminus or the C-terminus of a polypeptide sequence. In one aspect, the linker is from about 1 to about 20 amino acid residues long or alternatively 2 to about 10, about 3 to about 5 amino acid residues long.
  • An example of a peptide linker is Gly-Pro-Ser-Leu-Lys-Leu (SEQ ID NO. 43). Other examples include Gly-Gly-Gly (SEQ ID NO.
  • polynucleotides encoding the above noted antibody fragments, antigen binding fragments and polypeptides, as well as vector and host cells containing the same, as well as methods for recombinant production of the polypeptides using recombinant cell systems as known in the art and described herein.
  • the polynucleotide can be DNA or RNA.
  • the polynucleotides can be operatively linked to regulatory sequences, promoters, enhancers and the like, for the recombinant reproduction of the polynucleotides and/or the recombinant production of polyepeptides.
  • the polynucleotides can be inserted into a vector (plasmid or viral, for example) and inserted into an appropriate host cell (eukaryotic or prokaryotic) for recombinant reproduction or expression.
  • an appropriate host cell eukaryotic or prokaryotic
  • the polypeptides are isolated from the cell or the culture medium. Also provided by this application are the polynucleotides described herein conjugated to a detectable agent for use in the diagnostic methods.
  • Vectors comprising the isolated or recombinant polynucleotides or antibodies are further provided examples of which are known in the art and briefly described herein.
  • the isolated or recombinant polynucleotides can be contained within a
  • polycistronic vector The polynucleotides can be DNA, RNA, mRNA or interfering RNA, such as siRNA, miRNA or dsRNA.
  • the disclosure further provides the isolated or recombinant polynucleotide operatively linked to a promoter of RNA transcription, as well as other regulatory sequences for replication and/or transient or stable expression of the DNA or RNA.
  • a promoter of RNA transcription as well as other regulatory sequences for replication and/or transient or stable expression of the DNA or RNA.
  • operatively linked means positioned in such a manner that the promoter will direct transcription of RNA off the DNA molecule. Examples of such promoters are SP6, T4 and T7.
  • cell-specific promoters are used for cell-specific expression of the inserted polynucleotide.
  • Vectors which contain a promoter or a promoter/enhancer, with termination codons and selectable marker sequences, as well as a cloning site into which an inserted piece of DNA can be operatively linked to that promoter are known in the art and commercially available. For general methodology and cloning strategies, see Gene
  • polynucleotides derived from the polynucleotides disclosed herein encode polypeptides or proteins having diagnostic and therapeutic utilities as described herein as well as probes to identify transcripts of the protein that may or may not be present.
  • These nucleic acid fragments can be prepared, for example, by restriction enzyme digestion of larger polynucleotides and then labeled with a detectable marker. Alternatively, random fragments can be generated using nick translation of the molecule. For methodology for the preparation and labeling of such fragments, see Sambrook et al. (1989) supra.
  • Expression vectors containing these nucleic acids are useful to obtain host vector systems to produce proteins and polypeptides. It is implied that these expression vectors must be replicable in the host organisms either as episomes or as an integral part of the
  • suitable expression vectors include plasmids, yeast vectors, viral vectors and liposomes.
  • Adenoviral vectors are particularly useful for introducing genes into tissues in vivo because of their high levels of expression and efficient transformation of cells both in vitro and in vivo.
  • a nucleic acid is inserted into a suitable host cell, e.g., a prokaryotic or a eukaryotic cell and the host cell replicates, the protein can be recombinantly produced.
  • suitable host cells will depend on the vector and can include mammalian cells, animal cells, human cells, simian cells, insect cells, yeast cells, and bacterial cells constructed using known methods. See Sambrook et al. (1989) supra.
  • the nucleic acid can be inserted into the host cell by methods known in the art such as transformation for bacterial cells; transfection using calcium phosphate precipitation for mammalian cells; or DEAE-dextran; electroporation; or microinjection. See, Sambrook et al. (1989) supra, for methodology.
  • a host cell e.g., a mammalian cell, an animal cell (rat or mouse), a human cell, or a prokaryotic cell such as a bacterial cell, containing a polynucleotide encoding a protein or polypeptide or antibody.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment disclosed herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
  • This disclosure also provides genetically modified cells that contain and/or express the polynucleotides disclosed herein.
  • the genetically modified cells can be produced by insertion of upstream regulatory sequences such as promoters or gene activators (see, U.S. Pat. No. 5,733,761).
  • the polynucleotides can be conjugated to a detectable and/or purification marker, e.g., an enzymatic label or a radioisotope for detection of nucleic acid and/or expression of the gene in a cell.
  • a detectable and/or purification marker e.g., an enzymatic label or a radioisotope for detection of nucleic acid and/or expression of the gene in a cell.
  • detectable markers include fluorescent, radioactive, enzymatic or other ligands, such as avidin/biotin, which are capable of giving a detectable signal.
  • a fluorescent label or an enzyme tag such as urease, alkaline phosphatase or peroxidase, instead of radioactive or other environmentally undesirable reagents.
  • calorimetric indicator substrates can be employed to provide a means visible to the human eye or spectrophotometrically, to identify specific hybridization with complementary nucleic acid-containing samples.
  • this disclosure further provides a method for detecting a single-stranded polynucleotide or its complement, by contacting target single-stranded polynucleotide with a labeled, single-stranded polynucleotide (a probe) which is a portion of the polynucleotide disclosed herein under conditions permitting hybridization (optionally moderately stringent hybridization conditions) of complementary single-stranded
  • Hybridized polynucleotide pairs are separated from un-hybridized, single-stranded polynucleotides.
  • the hybridized polynucleotide pairs are detected using methods known to those of skill in the art and set forth, for example, in Sambrook et al, (1989) supra.
  • the polynucleotide embodied in this disclosure can be obtained using chemical synthesis, recombinant cloning methods, PCR, or any combination thereof. Methods of chemical polynucleotide synthesis are known in the art and need not be described in detail herein. One of skill in the art can use the sequence data provided herein to obtain a desired polynucleotide by employing a DNA synthesizer or ordering from a commercial service.
  • the polynucleotides disclosed herein can be isolated or replicated using PCR.
  • the PCR technology is the subject matter of U.S. Pat. Nos. 4,683, 195; 4,800,159; 4,754,065; and 4,683,202 and described in PCR: The Polymerase Chain Reaction (Mullis et al. eds., Birkhauser Press, Boston (199.4)) or MacPherson et al. (1991) and (1995) supra, and references cited therein.
  • one of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to replicate the DNA.
  • this disclosure also provides a process for obtaining the polynucleotides disclosed herein by providing the linear sequence of the polynucleotide, nucleotides, appropriate primer molecules, chemicals such as enzymes and instructions for their replication and chemically replicating or linking the nucleotides in the proper orientation to obtain the polynucleotides.
  • these polynucleotides are further isolated.
  • one of skill in the art can insert the poly-nucleotide into a suitable replication vector and insert the vector into a suitable host cell (prokaryotic or eukaryotic) for replication and amplification.
  • the DNA so amplified can be isolated from the cell by methods known to those of skill in the art.
  • a process for obtaining polynucleotides by this method is further provided herein as well as the
  • RNA can be obtained by first inserting a DNA polynucleotide into a suitable host cell.
  • the DNA can be delivered by any appropriate method, e.g., by the use of an appropriate gene delivery vehicle (e.g., liposome, plasmid or vector) or by electroporation.
  • an appropriate gene delivery vehicle e.g., liposome, plasmid or vector
  • electroporation e.g., liposome, plasmid or vector
  • the RNA can then be isolated using methods known to those of skill in the art, for example, as set forth in Sambrook et al. (1989) supra.
  • mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989) supra, or extracted by nucleic- acid-binding resins following the accompanying instructions provided by manufactures.
  • polynucleotide disclosed herein are useful as hybridization probes or as an equivalent of the specific polynucleotides identified herein. Since the full coding sequence of the transcript is known, any portion of this sequence or homologous sequences, can be used in the methods disclosed herein.
  • a probe useful for detecting the aforementioned mRNA is at least about 80% identical to the homologous region. In some embodiments, the probe is 85% identical to the corresponding gene sequence after alignment of the homologous region; in some embodiments, it exhibits 90% identity.
  • probes can be used in radioassays (e.g., Southern and Northern blot analysis) to detect, prognose, diagnose or monitor various cells or tissues containing these cells.
  • the probes also can be attached to a solid support or an array such as a chip for use in high throughput screening assays for the detection of expression of the gene corresponding a polynucleotide disclosed herein.
  • this disclosure also provides a probe comprising or corresponding to a polynucleotide disclosed herein, or its equivalent, or its complement, or a fragment thereof, attached to a solid support for use in high throughput screens.
  • the total size of fragment, as well as the size of the complementary stretches, will depend on the intended use or application of the particular nucleic acid segment. Smaller fragments will generally find use in hybridization embodiments, wherein the length of the complementary region may be varied, such as between at least 5 to 10 to about 100 nucleotides, or even full length according to the complementary sequences one wishes to detect.
  • Nucleotide probes having complementary sequences over stretches greater than 5 to 10 nucleotides in length are generally well suited, so as to increase stability and selectivity of the hybrid, and thereby improving the specificity of particular hybrid molecules obtained.
  • Such fragments may be readily prepared by, for example, directly synthesizing the fragment by chemical means, by application of nucleic acid reproduction technology, such as the PCR technology with two priming oligonucleotides as described in U.S. Pat. No. 4,603, 102 or by introducing selected sequences into recombinant vectors for recombinant production.
  • a probe is about 50-75 or more alternatively, 50-100, nucleotides in length.
  • the polynucleotides of the present disclosure can serve as primers for the detection of genes or gene transcripts that are expressed in cells described herein.
  • amplification means any method employing a primer-dependent polymerase capable of replicating a target sequence with reasonable fidelity. Amplification may be carried out by natural or recombinant DNA-polymerases such as T7 DNA polymerase, Klenow fragment of E. coli DNA polymerase, and reverse transcriptase.
  • a primer is the same length as that identified for probes.
  • PCR PCR and kits for PCR amplification are commercially available. After amplification, the resulting DNA fragments can be detected by any appropriate method known in the art, e.g., by agarose gel electrophoresis followed by visualization with ethidium bromide staining and ultraviolet illumination.
  • Methods for administering an effective amount of a gene delivery vector or vehicle to a cell have been developed and are known to those skilled in the art and described herein.
  • Methods for detecting gene expression in a cell include techniques such as in hybridization to DNA microarrays, in situ hybridization, PCR, RNase protection assays and Northern blot analysis. Such methods are useful to detect and quantify expression of the gene in a cell.
  • expression of the encoded polypeptide can be detected by various methods. In particular it is useful to prepare polyclonal or monoclonal antibodies that are specifically reactive with the target polypeptide. Such antibodies are useful for visualizing cells that express the polypeptide using techniques such as immunohistology, ELISA, and Western blotting. These techniques can be used to determine expression level of the expressed polynucleotide.
  • the antibodies, antibody fragments, proteins and polypeptides are obtainable by a number of processes known to those of skill in the art, which include purification, chemical synthesis and recombinant methods.
  • Polypeptides can be isolated from preparations such as host cell systems by methods such as immunoprecipitation with antibody, and standard techniques such as gel filtration, ion-exchange, reversed-phase, and affinity chromatography. For such methodology, see for example Deutscher et al. (1999) Guide To Protein Purification: Methods In Enzymology (Vol. 182, Academic Press).
  • this disclosure also provides the processes for obtaining these polypeptides as well as the products obtainable and obtained by these processes.
  • polypeptides also can be obtained by chemical synthesis using a commercially available automated peptide synthesizer such as those manufactured by Perkin/Elmer/ Applied Biosystems, Inc., Model 430A or 431 A, Foster City, Calif, USA.
  • the synthesized polypeptide can be precipitated and further purified, for example by high performance liquid chromatography (UPLC).
  • UPLC high performance liquid chromatography
  • this disclosure also provides a process for chemically synthesizing the proteins disclosed herein by providing the sequence of the protein and reagents, such as amino acids and enzymes and linking together the amino acids in the proper orientation and linear sequence.
  • compositions are further provided.
  • the compositions comprise a carrier and one or more of an antibody fragment or antigen binding fragment or isolated polypeptide as disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, an isolated host cell disclosed herein, a small molecule, an antibody, or an antibody fragment (e.g., a Fab (fragment antigen binding) fragment) disclosed herein.
  • the carriers can be one or more of a solid support or a pharmaceutically acceptable carrier.
  • the compositions can further comprise an adjuvant or other components suitable for administrations as vaccines.
  • the compositions are formulated with one or more pharmaceutically acceptable excipients, diluents, carriers and/or adjuvants.
  • compositions of the present disclosure include one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, a small molecule, an isolated host cell disclosed herein, an antibody, or an antibody fragment (e.g., a Fab
  • fragment antigen binding fragment of the disclosure, formulated with one or more pharmaceutically acceptable substances.
  • any one or more of an isolated or recombinant polypeptide as described herein, an isolated or recombinant polynucleotide as described herein, a vector as described herein, an isolated host cell as described herein, a small molecule or an antibody as described herein can be used alone or in pharmaceutical formulations disclosed herein comprising, or consisting essentially of, the compound in combination with appropriate additives to make tablets, powders, granules or capsules, for example, with conventional additives, such as lactose, mannitol, corn starch or potato starch; with binders, such as crystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins; with disintegrators, such as corn starch, potato starch or sodium carboxymethylcellulose; with lubricants, such as talc or magnesium stearate; and if desired, with diluents, buffering agents, moistening agents, preservatives and flavoring agents.
  • conventional additives such as lacto
  • compositions can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • a sweetening agent such as sucrose or saccharin
  • compositions and unit dose forms suitable for oral administration are particularly useful in the treatment of chronic conditions, infections, and therapies in which the patient self-administers the drug.
  • the formulation is specific for pediatric administration.
  • the disclosure provides pharmaceutical formulations in which the one or more of an antibody fragment, an antigen binding domain, an isolated polypeptide each as disclosed herein, an isolated polynucleotide as disclosed herein, a vector as disclosed herein, an isolated host cell as disclosed herein, or an antibody as disclosed herein, that are formulated into preparations for injection in accordance with the disclosure by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers (e.g., acacia, alginate, and sodium alginate) and preservatives or other antimicrobial agents.
  • an aqueous or nonaqueous solvent such as vegetable or other similar oils, synthetic aliphatic acid glycerides,
  • a non-limiting example of such is another therapeutic agent is an antibody to other vaccine components such as surface antigens, e.g., an OMP P5, OMP 26, OMP P2, or a vaccine component such as Type IV Pilin protein (see Jurcisek and Bakaletz (2007) J. of Bacteriology 189(10):3868-3875 and Murphy, T.F. et al. (2009) The Pediatric Infectious Disease Journal 28:S121-S126) and antibacterial agents.
  • suitable carriers include physiological bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.), or phosphate buffered saline (PBS).
  • a composition for parenteral administration must be sterile and should be fluid to the extent that easy syringability exists.
  • Aerosol formulations provided by the disclosure can be administered via inhalation and can be propellant or non-propellant based.
  • embodiments of the disclosure can be administered via inhalation and can be propellant or non-propellant based.
  • compositions disclosed herein comprise a compound disclosed herein formulated into pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen and the like.
  • propellants such as dichlorodifluoromethane, propane, nitrogen and the like.
  • the compounds can be delivered in the form of an aerosol spray from a pressurized container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a non-limiting example of a non-propellant is a pump spray that is ejected from a closed container by means of mechanical force (i.e., pushing down a piston with one's finger or by compression of the container, such as by a compressive force applied to the container wall or an elastic force exerted by the wall itself (e.g., by an elastic bladder)).
  • Suppositories disclosed herein can be prepared by mixing a compound disclosed herein with any of a variety of bases such as emulsifying bases or water-soluble bases.
  • Embodiments of this pharmaceutical formulation of a compound disclosed herein can be administered rectally via a suppository.
  • the suppository can include vehicles such as cocoa butter, carbowaxes and polyethylene glycols, which melt at body temperature, yet are solidified at room temperature.
  • Unit dosage forms for oral or rectal administration such as syrups, elixirs, and suspensions, may be provided wherein each dosage unit, for example, teaspoonful, tablespoonful, tablet or suppository, contains a predetermined amount of the composition containing one or more compounds disclosed herein.
  • unit dosage forms for injection or intravenous administration may comprise a compound disclosed herein in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
  • Embodiments of the pharmaceutical formulations disclosed herein include those in which one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, a small molecule for use in the disclosure, an isolated host cell disclosed herein, or an antibody disclosed herein is formulated in an injectable composition.
  • injectable pharmaceutical formulations disclosed herein are prepared as liquid solutions or suspensions; or as solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection. The preparation may also be emulsified or the active ingredient encapsulated in liposome vehicles in accordance with other embodiments of the pharmaceutical formulations disclosed herein.
  • an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, an isolated host cell disclosed herein, an antibody, or an antibody fragment (e.g., a Fab (fragment antigen binding) fragment) disclosed herein is formulated for delivery by a continuous delivery system.
  • continuous delivery system is used interchangeably herein with “controlled delivery system” and encompasses continuous (e.g., controlled) delivery devices (e.g., pumps) in combination with catheters, injection devices, and the like, a wide variety of which are known in the art.
  • Mechanical or electromechanical infusion pumps can also be suitable for use with the present disclosure.
  • a compound disclosed herein can be accomplished using any of a variety of refillable, pump systems. Pumps provide consistent, controlled release over time.
  • a compound disclosed herein is in a liquid formulation in a drug-impermeable reservoir, and is delivered in a continuous fashion to the individual.
  • the drug delivery system is an at least partially implantable device.
  • the implantable device can be implanted at any suitable implantation site using methods and devices well known in the art.
  • An implantation site is a site within the body of a subject at which a drug delivery device is introduced and positioned.
  • Implantation sites include, but are not necessarily limited to, a subdermal, subcutaneous, intramuscular, or other suitable site within a subject's body. Subcutaneous implantation sites are used in some embodiments because of convenience in implantation and removal of the drug delivery device.
  • Drug release devices suitable for use in the disclosure may be based on any of a variety of modes of operation.
  • the drug release device can be based upon a diffusive system, a convective system, or an erodible system (e.g., an erosion-based system).
  • the drug release device can be an electrochemical pump, osmotic pump, an electro osmotic pump, a vapor pressure pump, or osmotic bursting matrix, e.g., where the drug is incorporated into a polymer and the polymer provides for release of drug formulation concomitant with degradation of a drug-impregnated polymeric material (e.g., a
  • the drug release device is based upon an electro diffusion system, an electrolytic pump, an effervescent pump, a piezoelectric pump, a hydrolytic system, etc.
  • Drug release devices based upon a mechanical or electromechanical infusion pump can also be suitable for use with the present disclosure. Examples of such devices include those described in, for example, U.S. Pat. Nos. 4,692,147; 4,360,019; 4,487,603; 4,360,019; 4,725,852, and the like.
  • a subject treatment method can be accomplished using any of a variety of refillable, non-exchangeable pump systems. Pumps and other convective systems may be utilized due to their generally more consistent, controlled release over time. Osmotic pumps are used in some embodiments due to their combined advantages of more consistent controlled release and relatively small size (see, e.g., PCT International Pat.
  • Exemplary osmotically-driven devices suitable for use in the disclosure include, but are not necessarily limited to, those described in U.S. Pat. Nos.
  • a further exemplary device that can be adapted for the present disclosure is the Synchromed infusion pump (Medtronic).
  • the drug delivery device is an implantable device.
  • the drug delivery device can be implanted at any suitable implantation site using methods and devices well known in the art.
  • an implantation site is a site within the body of a subject at which a drug delivery device is introduced and positioned. Implantation sites include, but are not necessarily limited to a subdermal, subcutaneous, intramuscular, or other suitable site within a subject's body.
  • Suitable excipient vehicles for a compound disclosed herein are, for example, water, saline, dextrose, glycerol, ethanol, or the like, and combinations thereof.
  • the vehicle may contain minor amounts of auxiliary substances such as wetting or emulsifying agents or pH buffering agents.
  • auxiliary substances such as wetting or emulsifying agents or pH buffering agents.
  • compositions of the present disclosure include those that comprise a sustained- release or controlled release matrix.
  • embodiments of the present disclosure can be used in conjunction with other treatments that use sustained-release formulations.
  • a sustained-release matrix is a matrix made of materials, usually polymers, which are degradable by enzymatic or acid-based hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids.
  • a sustained-release matrix desirably is chosen from biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid), polyanhydrides, poly(ortho)esters, polypeptides, hyaluronic acid, collagen, chondroitin sulfate, carboxcylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such as phenylatanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone.
  • biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid),
  • Illustrative biodegradable matrices include a polylactide matrix, a polyglycolide matrix, and a polylactide co-glycolide (co-polymers of lactic acid and gly colic acid) matrix.
  • antibody fragment (as well as combination compositions) is delivered in a controlled release system.
  • a compound disclosed herein may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
  • a pump may be used (Sefton (1987) CRC Crit. Ref. Biomed. Eng. 14:201; Buchwald et al. (1980) Surgery 88:507; Saudek et al. (1989) N. Engl. J. Med. 321 :574).
  • polymeric materials are used.
  • a controlled release system is placed in proximity of the therapeutic target, i.e., the liver, thus requiring only a fraction of the systemic dose.
  • a controlled release system is placed in proximity of the therapeutic target, thus requiring only a fraction of the systemic.
  • Other controlled release systems are discussed in the review by Langer (1990) Science 249: 1527-1533.
  • compositions of the present disclosure include those formed by impregnation of an inhibiting agent described herein into absorptive materials, such as sutures, bandages, and gauze, or coated onto the surface of solid phase materials, such as surgical staples, zippers and catheters to deliver the compositions.
  • absorptive materials such as sutures, bandages, and gauze
  • solid phase materials such as surgical staples, zippers and catheters.
  • the present disclosure provides methods and compositions for the administration of a one or more of an antibody fragment for the treatment of a microbial infection.
  • these methods disclosed herein span almost any available method and route suitable for drug delivery, including in vivo and ex vivo methods, as well as systemic and localized routes of administration.
  • the disclosure provides for formulations or co-formulations comprising antibodies or antibody fragments (e.g., Fab (fragment antigen binding) fragments) that specifically recognize or bind a DNABII protein or polypeptide, or an isolated or recombinant polypeptide consisting essentially of an amino acid sequence selected from: SEQ ID NOs. 12 to 17, SEQ ID NO. 33, or an equivalent each thereof.
  • Antibodies or antibody fragments (e.g., Fab (fragment antigen binding) fragments) disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the biofilm.
  • the antibodies or antibody fragments (e.g., Fab (fragment antigen binding) fragments) of the present technology useful in the disclosed methods usually have binding affinities of at least 10 "6 , 10 "7 , 10 "8 , 10 “9 , 10 "10 , 10 "11 , or 10 "12 M.
  • the antibodies or antibody fragments e.g., Fab (fragment antigen binding) fragments
  • Fab fragment antigen binding fragments
  • the antibodies or antibody fragments have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
  • the affinity of the antibody or antigen binding fragment is less than or about 1000 picoMole (pM), 900 pM, 800 pM, 700 pM, 600 pM, 500 pM, 400 pM, 300 pM, 200 pM, about 100 pM, 50 pM, 40 pM , 30 pM, 20 pM, 10 pM, 9 pM, 8 pM, 7 pM, 6 pM, 5 pM, or 4 pM.
  • pM picoMole
  • the antibodies are present in the formulation at a
  • concentration from about 0.1 mg/mL to about 200 mg/mL, or alternatively from about 1 to about 150 mg/mL, or alternatively about 2 mg/mL to about 100 mg/mL, or alternatively about 3 mg/mL to about 80 mg/mL, or alternatively about 4 mg/mL to about 50 mg/mL, or alternatively about 5 mg/mL to about 20 mg/mL.
  • the antibodies are present at a concentration of at least about 1 mg/mL, or alternatively at least about 2 mg/mL, at least about 3 mg/mL, or alternatively at least about 4 mg/mL, or alternatively at least about 5 mg/mL, or alternatively at least about 6 mg/mL, or alternatively at least about 7 mg/mL, or alternatively at least about 8 mg/mL, or alternatively at least about 9 mg/mL, or alternatively at least about 10 mg/mL, or alternatively at least about 15 mg/mL, or alternatively at least about 20 mg/mL, or alternatively at least about 30 mg/mL, or alternatively at least about 40 mg/mL, or alternatively at least about 50 mg/mL, or alternatively at least about 60 mg/mL, or alternatively at least about 70 mg/mL, or alternatively at least about 80 mg/mL, or
  • At least one of the plurality of antibodies is present at a concentration of at least about 1 mg/mL, or alternatively at least about 2 mg/mL, or alternatively at least about 3 mg/mL, or alternatively at least about 4 mg/mL, or alternatively at least about 5 mg/mL, or alternatively at least about 6 mg/mL, or alternatively at least about 7 mg/mL, or alternatively at least about 8 mg/mL, or alternatively at least about 9 mg/mL, or alternatively at least about 10 mg/mL, or alternatively at least about 15 mg/mL, or alternatively at least about 20 mg/mL, or alternatively at least about 30 mg/mL, or alternatively at least about 40 mg/mL, or alternatively at least about 50 mg/mL
  • the different antibodies may be present in substantially equal concentrations.
  • the different antibodies one or more of the antibodies may be present in a substantially higher concentration than the other antibodies, e.g., ratios of about 1.5: 1, or alternatively about 1.5: 1 : 1, or alternatively about 1.5: 1 : 1 : 1, or alternatively about 2: 1, or alternatively about 2: 1 : 1, or alternatively about 2: 1 : 1 : 1, or alternatively at least about 2.5: 1, or alternatively at least about 2.5: 1 : 1, or alternatively at least about 2.5: 1 : 1 : 1.
  • Also provided are methods for inhibiting, competing or titrating the binding of a DNABII polypeptide or protein to a microbial DNA by contacting the DNABII polypeptide or protein or the microbial DNA with an antibody fragment, antigen binding fragment or composition as described herein, thereby inhibiting, competing or titrating the binding of the DNABII protein or polypeptide to the microbial DNA.
  • the DNABII polypeptide and the microbial DNA are detectably labeled, for example with luminescent molecules that will emit a signal when brought into close contact with each other.
  • the contacting can be performed in vitro or in vivo.
  • a method for inhibiting, preventing or breaking down a microbial biofilm is provided by contacting the biofilm with an antibody fragment or antigen binding fragment threof, or polypeptide as described herein thereby inhibiting, preventing or breaking down the microbial biofilm.
  • the DNABII polypeptide and the microbial DNA are detectably labeled, for example with luminescent molecules that will emit a signal when brought into close contact with each other. The contacting can be performed in vitro or in vivo.
  • the methods are useful to screen for or confirm antibody fragments and polypeptides having the same, similar or opposite ability as the polypeptides, polynucleotides, antibodies, antibody fragments (e.g., Fab (fragment antigen binding) fragment), host cells, small molecules and compositions disclosed herein.
  • they can be used to identify which antibody fragment or polypeptide is best suited to treat a microbial infection.
  • one can screen for new agents or combination therapies by having two samples containing for example, the DNABII polypeptide and microbial DNA and the agent to be tested.
  • the second sample contains the DNABII polypeptide and microbial DNA and an agent known to active, e.g., an anti-IHF antibody or a small molecule to serve as a positive control.
  • an agent known to active e.g., an anti-IHF antibody or a small molecule to serve as a positive control.
  • several samples are provided and the agents are added to the system in increasing dilutions to determine the optimal dose that would likely be effective in treating a subject in the clinical setting.
  • a negative control containing the DNABII polypeptide and the microbial DNA can be provided.
  • the DNABII polypeptide and the microbial DNA are detectably labeled, for example with luminescent molecules that will emit a signal when brought into close contact with each other.
  • the samples are contained under similar conditions for an effective amount of time for the agent to inhibit, compete or titrate the interaction between the DNABII polypeptide and microbial DNA and then the sample is assayed for emission of signal from the luminescent molecules. If the sample emits a signal, then the agent is not effective to inhibit binding.
  • the in vitro method is practiced in a miniaturized chamber slide system wherein the microbial (such as a bacterial) isolate causing an infection could be isolated from the human/animal then cultured to allow it to grow as a biofilm in vitro, see for example Experiment 1 below.
  • the agent such as anti-IHF antibody
  • potential agent biofilm is added alone or in combination with another agent to the culture with or without increasing dilutions of the potential agent or agent such as an anti-IHF (or other antibody, small molecule, agent, etc.) to find the optimal dose that would likely be effective at treating that patient when delivered to the subject where the infection existed.
  • a positive and negative control can be performed simultaneously.
  • the method is practiced in a high throughput platform with the antibody fragment and/or potential agent (alone or in combination with another agent) in a flow cell.
  • the anti-IHF antibody or fragment thereof, or potential agent is added alone or in combination with another agent to the culture with or without increasing dilutions of the potential agent or agent such as an anti-IHF (or other antibody, small molecule, agent, etc.) to find the optimal dose that would likely be effective at treating that patient when delivered to the subject where the infection existed.
  • Biofilm isolates are sonicated to separate biofilm bacteria from DNABII polypeptide such as IHF bound to microbial DNA.
  • the DNABII polypeptide— DNA complexes are isolated by virtue of the anti-IHF antibody on the platform.
  • the microbial DNA is then be released with e.g., a salt wash, and used to identify the biofilm bacteria added.
  • the freed DNA is then identified, e.g., by PCR sequenced. If DNA is not freed, then the agent(s) successfully performed or bound the microbial DNA. If DNA is found in the sample, then the agent did not interfere with DNABII polypeptide- microbial DNA binding. As is apparent to those of skill in the art, a positive and/or negative control can be simultaneously performed.
  • one or more of the antibody fragments, antigen binding fragments polypeptides or compositions disclosed herein are used in a method of detecting a biofilm in vivo.
  • the antibody fragments, polypeptides or compositions are detectably labeled, for example with a luminescent or fluorescent molecule.
  • Further applications of the methods disclosed herein include methods of use of such antibody fragments, polypeptides or compositions to image a biofilm using, for example, a detectably labeled primary antibody fragments, polypeptides or compositions which provides a detectable signal upon binding to the biofilm or a detectably labeled secondary antibody fragments, polypeptides or compositions which binds to the primary antibody fragments, polypeptides or compositions when it is bound to the biofilm.
  • the methods can be used to identify the microbe causing the infection and/or confirm effective alternative agents in an industrial setting, such as in a pipe.
  • an antibiotic or antimicrobial known to inhibit growth of the underlying infection is added sequentially or concurrently, to determine if the infection can be inhibited. It is also possible to add the antibody fragments, polypeptides or compositions to the microbial DNA or DNABII polypeptide before adding the complex to assay for biofilm inhibition.
  • the method When practiced in vivo in a non-human animal such as a chinchilla, the method provides a pre-clinical screen to identify antibody fragments, polypeptides or compositions that can be used alone or in combination with other agents to break down biofilms.
  • a method of inhibiting, preventing or breaking down a biofilm in a subject by administering to the subject an effective amount of an antibody fragment, polypeptide or composition, thereby inhibiting, preventing or breaking down the microbial biofilm.
  • methods of inhibiting, preventing or breaking down a biofilm may be practiced in vitro and/or ex vivo and involve providing a sample of the biofilm - taken from a subject or generated in vitro - and administering an effective amount of an antibody fragment, polypeptide or composition, thereby inhibiting, preventing or breaking down the microbial biofilm.
  • the antibody fragments, polypeptides or compositions disclosed herein may be used in method embodiments for inhibiting, preventing, or breaking down microbial biofilms on surfaces colonized by biofilms such as, but not limited to, hospital instruments, industrial equipment, and other materials not comprised of living tissue.
  • the methods further comprise, or alternatively consist essentially of, or yet further consist of administering to the subject an effective amount of one or more of an antimicrobial, an antigenic peptide or an adjuvant.
  • an antimicrobial agent antibodies directed against vaccine component such as a surface antigen, e.g., an OMP P5, rsPilA, OMP 26, OMP P2, or Type IV Pilin protein (see Jurcisek and Bakaletz (2007) J. Bacteriology 189(10):3868-3875; Murphy et al. (2009) The Pediatric Infectious Disease Journal 28:S121-S126; Novotny et al. (2015) Mol Microbiol. 96(2):276-92).
  • a surface antigen e.g., an OMP P5, rsPilA, OMP 26, OMP P2, or Type IV Pilin protein
  • compositions disclosed herein can be concurrently or sequentially administered with other antimicrobial agents and/or surface antigens.
  • administration is locally to the site of the infection by direct injection or by inhalation for example.
  • Other non-limiting examples of administration include by one or more method comprising transdermally, urethrally, sublingually, rectally, vaginally, ocularly,
  • Microbial infections and disease that can be treated by the methods disclosed herein include but are not limited to infection by various organisms associated with biofilm formation, including but not limited to those disclosed in Examples 4 through 9.
  • relevant organisms include: Aggregatibacter actinomycetemcomitans, Borrelia burgdorferi (e.g., B31),
  • Bordetella pertussis e.g., Tohama I
  • Burkholderia pseudomallei e.g., 668
  • Burkholderia cenocepacia e.g., HI2424
  • Escherichia coli e.g., K12 MG1655
  • Enterococcus e.g., Tohama I
  • Burkholderia pseudomallei e.g., 668
  • Burkholderia cenocepacia e.g., HI2424
  • Escherichia coli e.g., K12 MG1655
  • faecalis e.g., V583
  • Haemophilus influenzae e.g., Rd KW20
  • Helicobacter pylori e.g., 26695
  • Klebsiella pneumoniae Moraxella catarrhalis
  • Mycobacterium smegmatis e.g., MC2
  • Mycobacterium tuberculosis e.g., CDC 1551
  • gonorrhoeae e.g., FA1090
  • Neisseria meningitidis e.g., MC58
  • Pseudomonas aeruginosa Porphyromonas gingivalis (e.g., W83)
  • Prevotella intermedia e.g., 17
  • Prevotella melaninogenica e.g., ATCC ® 25845
  • Staphylococcus aureus e.g., MW2
  • Staphylococcus epidermidis e.g., RP62A
  • Streptococcus agalactiae e.g., 2603 V/R
  • Streptococcus bovis Streptococcus gallolyticus
  • Streptococcus gordonii e.g., NCTC 7868
  • Streptococcus mutans e.g., UA159
  • Streptococcus pneumoniae e.g., R6
  • Streptococcus pyogenes e.g., MGAS 10270
  • Streptococcus sobrinus e.g., 6715
  • Salmonella enterica e.g., typhi, CT18
  • Treponema denticola e.g., ATCC ® 35405
  • Treponema palladum e.g., Nichols
  • Vibrio cholera e.g., El Tor, N16961
  • Additional organisms known to associate with and/or form biofilms include but are not limited to
  • cystic fibrosis patients have Pseudomonas infections that often result in antibiotic resistant biofilms.
  • Exemplary diseases associated with biofilms include, but are not limited to, lung infections of cystic fibrosis patients, otitis media, native valve infectious endocarditis, osteomyelitis, rhinosinositis, prostatitis, recurrent urinary tract infection, wounds, dental caries and periodontitis.
  • Conditions such as an infected artificial device, joint, catheter, stent or other surgical implant are also associated with biofilm formation.
  • These microbial infections may be present in the upper, mid and lower airway (otitis, sinusitis, bronchitis but also exacerbations of chronic obstructive pulmonary disease (COPD), chronic cough, complications of and/or primary cause of cystic fibrosis (CF) and community acquired pneumonia (CAP).
  • COPD chronic obstructive pulmonary disease
  • COPD chronic obstructive pulmonary disease
  • CF cystic fibrosis
  • CAP community acquired pneumonia
  • Infections might also occur in the oral cavity ⁇ caries, periodontitis) and caused by Streptococcus mutans, Porphyromonas gingivalis, Aggregatibacter
  • Infections might also be localized to the skin (abscesses, 'staph' infections, impetigo, secondary infection of burns, Lyme disease) and caused
  • Infections of the urinary tract can also be treated and are typically caused by Escherichia coli.
  • Infections of the gastrointestinal tract GI (diarrhea, cholera, gall stones, gastric ulcers) are typically caused by Salmonella enterica serovar, Vibrio cholerae and Helicobacter pylori.
  • Infections of the genital tract include and are typically caused by Neisseria gonorrhoeae . Infections can be of the bladder or of an indwelling device caused by Enterococcus faecalis.
  • Infections associated with implanted prosthetic devices such as artificial hip or knee replacements, or dental implants, or medical devices such as pumps, catheters, stents, or monitoring systems, typically caused by a variety of bacteria, can be treated by the methods disclosed herein. These devices can be coated or conjugated to an agent as described herein. Thus, by practicing the in vivo methods disclosed herein, these diseases and complications from these infections can also be prevented or treated.
  • Infections caused by Streptococcus agalactiae can also be treated by the methods disclosed herein and it is the major cause of bacterial septicemia in newborns. Infections caused by Neisseria meningitidis which can cause meningitis can also be treated.
  • routes of administration applicable to the methods disclosed herein include intranasal, intramuscular, urethrally, intratracheal, subcutaneous, intradermal, topical application, intravenous, rectal, nasal, oral, inhalation, and other enteral and parenteral routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the agent and/or the desired effect. An active agent can be administered in a single dose or in multiple doses. Embodiments of these methods and routes suitable for delivery, include systemic or localized routes. In general, routes of administration suitable for the methods disclosed herein include, but are not limited to, direct injection, enteral, parenteral, or inhalational routes.
  • Parenteral routes of administration other than inhalation administration include, but are not limited to, topical, transdermal, subcutaneous, intramuscular, intraorbital,
  • intracapsular, intraspinal, intrasternal, and intravenous routes i.e., any route of administration other than through the alimentary canal.
  • Parenteral administration can be conducted to effect systemic or local delivery of the inhibiting agent. Where systemic delivery is desired, administration typically involves invasive or systemically absorbed topical or mucosal administration of pharmaceutical preparations.
  • the antibody fragments, polypeptides or compositions disclosed herein can also be delivered to the subject by enteral administration.
  • Enteral routes of administration include, but are not limited to, oral and rectal (e.g., using a suppository) delivery.
  • Methods of administration of the active through the skin or mucosa include, but are not limited to, topical application of a suitable pharmaceutical preparation, transcutaneous transmission, transdermal transmission, injection and epidermal administration.
  • a suitable pharmaceutical preparation for transdermal transmission, absorption promoters or iontophoresis are suitable methods.
  • Iontophoretic transmission may be accomplished using commercially available "patches” that deliver their product continuously via electric pulses through unbroken skin for periods of several days or more.
  • the antibody fragments, polypeptides or compositions will be administered by inhalation, injection or orally on a continuous, daily basis, at least once per day (QD), and in various embodiments two (BID), three (TID), or even four times a day.
  • the therapeutically effective daily dose will be at least about 1 mg, or at least about 10 mg, or at least about 100 mg, or about 200— about 500 mg, and sometimes, depending on the compound, up to as much as about 1 g to about 2.5 g-
  • This disclosure provides methods and compositions to inhibit or prevent infection of a host or host cell by a bacteria that exports an DNABII protein, the methods and
  • compositions comprising, or alternatively consisting essentially of, or yet further consisting of, administering to a tissue exposed to or infected with the bacteria an effective amount of an bacteria-relevant antibody fragments, antigen binding fragments thereof, polypeptides or compositions that specifically recognizes and binds the DNABII protein, thereby inhibiting or preventing infection of the host or host cell by the bacteria.
  • Multiple antibody fragments, polypeptides or compositions can be administered concurrently or sequentially along with supporting therapies as noted herein.
  • This disclosure provides a method to inhibit or prevent infection of a cell by a bacteria that exports an DNABII protein.
  • the method comprises, or alternatively consists essentially of, or yet further consists of, administering to a tissue infected with the bacteria an effective amount of an antibody fragment, polypeptide or composition that specifically recognizes and binds the DNABII protein, thereby inhibiting or preventing infection of the bacteria.
  • Multiple antibody fragments, polypeptides or compositions can be administered concurrently or sequentially along with supporting therapies as noted herein.
  • the administration can be in vitro in a culture or in vivo, by administration to a patient infected with the bacteria.
  • the method can be used to treat a subject infected with the bacteria by administering to the infected subject an effective amount of the antibody.
  • the method can be used to test possible therapies or combination therapies prior to administration to a human.
  • the method is useful to screen for other therapeutic agents and combination therapies, such as small molecule drugs, that inhibit or prevent infection of the bacteria in a tissue.
  • the antibody fragment can be generated from a polyclonal, monoclonal or a derivative of an antibody that recognizes and binds the bacteria- relevant DNABII protein.
  • the source of antibody against the DNABII protein can be elicited by either active vaccination of the host with the DNABII protein or passive transfer of antiserum or an antibody against proteins of the DNABII protein.
  • Multiple antibody fragments, polypeptides or compositions can be administered concurrently or sequentially along with supporting therapies as noted herein.
  • the source of antibody that produced the antibody fragment, polypeptide or composition against the DNABII protein can be elicited by either active vaccination of the host with the DNABII protein or passive transfer of antiserum or an antibody against the DNABII protein.
  • the antibody can be polyclonal, monoclonal or a derivative of an antibody that recognizes and binds the bacteria- relevant DNABII protein. Multiple antibody fragments, polypeptides or compositions can be administered concurrently or sequentially along with supporting therapies as noted herein.
  • Any of the above methods can further comprise, or alternatively consist essentially of, or yet further consist of, administering to the subject or the tissue or cell culture in vitro, an effective amount of one or more of an antimicrobial, an antigenic peptide or an adjuvant.
  • the subject in some aspects, is a non-human animal or a human patient.
  • the antibody fragment, polypeptide or composition is administered locally or systemically by any appropriate method, e.g., to the site of infection or biofilm, topically, rectally, vaginally, ocularly, subcutaneous, intramuscularly, intraperitoneally, urethrally, intranasally, by inhalation or orally.
  • the subject is a pediatric patient and the antibody is administered in a formulation for the pediatric patient.
  • a screen to identify potential therapeutic agents that inhibit or prevent infection of a cell by a bacteria that exports a DNABII protein and/or that disrupt or prevent biofilm formation is also disclosed.
  • the screening method comprises, or alternatively consists essentially of, or yet consists of , contacting in vitro or administering in vivo to a tissue infected with the bacteria an agent and determining if the agent binds the DNABII protein. Methods to determining binding are known in the art and several non-limiting examples are described herein. In one aspect, if the agent binds the protein, the agent is a potential therapeutic agent and if the agent does not bind the protein, the agent is not a potential therapeutic agent.
  • the agent is a potential therapeutic agent and if infection is not inhibited or prevented, the agent is not a potential therapeutic agent.
  • Methods of determining if the infection is inhibited or prevented are known in the art and several non-limiting examples are described herein; methods of determining if a biofilm is disrupted or prevented are known in the art and further disclosed herein.
  • Non-limiting examples of potential therapeutic agents are from the group of: an antibody, an antibody derivative, a polypeptide or a small molecule. Multiple antibodies can be administered concurrently or sequentially along with supporting therapies as noted herein.
  • the agent binds the protein and the binding is compared to the binding of anti-DNABII antisera to the antibody fragment or polypeptide.
  • Dosing can be accomplished in accordance with the methods disclosed herein using capsules, tablets, oral suspension, suspension for intra-muscular injection, suspension for intravenous infusion, get or cream for topical application, or suspension for intra-articular injection.
  • compositions described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, for example, to determine the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
  • compositions exhibit high therapeutic indices. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such compounds lies (in certain embodiments, within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half- maximal inhibition of symptoms) as determined in cell culture.
  • IC50 i.e., the concentration of the test compound which achieves a half- maximal inhibition of symptoms
  • levels in plasma may be measured, for example, by high performance liquid chromatography.
  • an effective amount of a composition sufficient for achieving a therapeutic or prophylactic effect ranges from about 0.000001 mg per kilogram body weight per administration to about 10,000 mg per kilogram body weight per administration.
  • the dosage ranges are from about 0.0001 mg per kilogram body weight per administration to about 100 mg per kilogram body weight per administration.
  • Administration can be provided as an initial dose, followed by one or more "booster" doses.
  • Booster doses can be provided a day, two days, three days, a week, two weeks, three weeks, one, two, three, six or twelve months after an initial dose.
  • a booster dose is administered after an evaluation of the subject's response to prior administrations.
  • treatment of a subject with a therapeutically effective amount of the therapeutic compositions described herein can include a single treatment or a series of treatments.
  • Antibodies and antibody fragments e.g., Fab (fragment antigen binding) fragment
  • Fab fragment antigen binding fragment
  • antibodies and antibody fragments can be used to purify the polypeptides disclosed herein and to identify biological equivalent polypeptide and/or polynucleotides. They also can be used to identify agents that modify the function of the polypeptides disclosed herein, e.g., aptamer, polynucleotides and small molecules. These antibodies include polyclonal antisera, monoclonal antibodies, and various reagents derived from these preparations that are familiar to those practiced in the art and described above.
  • Antibodies and antibody fragments that neutralize the activities of proteins encoded by identified genes can also be used in vivo and in vitro to demonstrate function by adding such neutralizing antibodies into in vivo and in vitro test systems. They also are useful as pharmaceutical agents to modulate the activity of polypeptides disclosed herein.
  • Various antibody preparations and antibody fragments can also be used in analytical methods such as ELISA assays or Western blots to demonstrate the expression of proteins encoded by the identified genes by test cells in vitro or in vivo. Fragments of such proteins generated by protease degradation during metabolism can also be identified by using appropriate polyclonal antisera with samples derived from experimental samples.
  • the antibodies and antibody fragments may be used to visualize and/or detect biofilms.
  • the antibodies may be detectably labeled, e.g., with a radioisotope, an enzyme which generates a detectable product, a fluorescent protein, and the like or conjugated to other moieties, such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like.
  • Detectably labeled antibodies may then be introduced to the sample suspected of being colonized by a biofilm and visualized and/or detected through microscopy or other methods known to detect the relevant label, e.g., spectroscopy, cytometry, or other common techniques.
  • Conjugated antibodies or unlabeled antibodies may likewise be identified through known analytical methods targeting the conjugated moiety or antibody, respectively.
  • a detectably labeled secondary antibody specific to the isotype of the antibodies and/or antibody fragments (e.g., Fab (fragment antigen binding) fragment) disclosed herein may be used in the visualization and/or detection of a biofilm; such embodiments may entail the administration of the antibody specific to the "tail" of a DNABII protein to the surface suspected of being colonized by a biofilm, followed by the administration of the detectably labeled secondary antibody and the subsequent detection of the relevant label.
  • Fab fragment antigen binding
  • the antibody fragments, antigen binding domains, polypeptides or compositions disclosed herein may be used for vaccination or to boost vaccination, alone or in combination with peptides or protein-based vaccines or dendritic-cell based vaccines.
  • an "agent” is intended to include, but not be limited to a biological or chemical compound such as a simple or complex organic or inorganic molecule, a peptide, a protein (e.g., antibody), a polynucleotide (anti-sense) or a ribozyme.
  • a vast array of compounds can be synthesized, for example polymers, such as polypeptides and polynucleotides, and synthetic organic compounds based on various core structures, and these are also included in the term "agent.”
  • various natural sources can provide compounds for screening, such as plant or animal extracts, and the like. It should be understood, although not always explicitly stated that the agent is used alone or in combination with another agent, having the same or different biological activity as the agents identified by the inventive screen.
  • a "binding moiety” is intended to include, but not be limited to a biological or chemical compound such as a simple or complex organic or inorganic molecule, a peptide, a protein (e.g., antibody), a polynucleotide (anti-sense) or a ribozyme that has affinity with respect to at least one DNABII protein.
  • a biological or chemical compound such as a simple or complex organic or inorganic molecule, a peptide, a protein (e.g., antibody), a polynucleotide (anti-sense) or a ribozyme that has affinity with respect to at least one DNABII protein.
  • a vast array of compounds can be synthesized, for example polymers, such as polypeptides and
  • polynucleotides and synthetic organic compounds based on various core structures, and these are also included in the term "binding moiety.”
  • various natural sources can provide compounds for screening, such as plant or animal extracts, and the like.
  • suitable cell culture or tissue infected with the microbial to be treated are first provided.
  • the cells are cultured under conditions
  • suitable cells can be cultured in micro-titer plates and several agents can be assayed at the same time by noting genotypic changes, phenotypic changes or a reduction in microbial titer.
  • the agent when the agent is a composition other than a DNA or RNA, such as a small molecule as described above, the agent can be directly added to the cell culture or added to culture medium for addition. As is apparent to those skilled in the art, an "effective" a mount must be added which can be empirically determined.
  • the agent when the agent is an antibody or antigen binding fragment, the agent can be contacted or incubated with the target antigen and polyclonal antibody as described herein under conditions to perform a competitive ELISA. Such methods are known to the skilled artisan.
  • the assays also can be performed in a subject.
  • the subject is an animal such as a rat, chinchilla, mouse or simian
  • the method provides a convenient animal model system that can be used prior to clinical testing of an agent in a human patient.
  • a candidate agent is a potential drug if symptoms of the disease or microbial infection is reduced or eliminated, each as compared to untreated, animal having the same infection. It also can be useful to have a separate negative control group of cells or animals that are healthy and not treated, which provides a basis for comparison.
  • Additional screening assays specific to antibodies contemplated herein include those methods suitable for identifying an antibody or agent which specifically binds to one or more of the polypeptides disclosed herein. This method involves identifying an antibody binding to a site on the antigen to which the antibody of the present invention binds.
  • An antibody binding site can be determined through methods known to those skilled in the art. For example, when the antibody binds to or recognizes the partial conformation of the antigen, the binding site for the antibody can be determined by identifying amino acid residues on the antigen adjacent to the antibody using X-ray structural analysis. For example, the antibody or its fragment and the antigen or its fragment can be bound to each other and crystallized, followed by structural analysis to identify each amino acid residue on the antigen having an interactional distance with the antibody. The interactional distance is 8 angstroms or shorter, preferably 6 angstroms or shorter, more preferably 4 angstroms or shorter.
  • One or more such amino acid residues having an interactional distance with the antibody can constitute a site (epitope) on the antigen to which the antibody binds. Two or more such amino acid residues may not be adjacent to each other on the primary sequence.
  • Such structural analysis can provide the three-dimensional structure of the protein, therefore yielding both the sequence and conformation of the identified epitope.
  • a test antibody or agent may be contacted with one or more of the polypeptides disclosed herein. Subsequently, the distance is measured between the substance and amino acid residues constituting the epitope to which any one of the antibodies disclosed herein bind. The test antibody or agent can be determine to specifically bind if it has an appropriate interaction distance with each of the residues. In some embodiments, the test antibody is not a polyclonal antibody.
  • the test antibody or agent is analyzed based on its interaction with a the conformational epitope identified by structural analysis of the antibody-antigen interaction.
  • a conformational epitope is a ⁇ hairpin, which may be comprised in one or more of the polypeptides disclosed herein.
  • An additional non- limiting exemplary epitope is an amino acid sequence that conforms to a sharp turn as part of an anti-parallel beta ribbon, such as the consensus amino acid sequence NPXT, wherein "X" refers to any amino acid.
  • X is selected from the amino acids Q, R, K, S, or T.
  • Non-limiting examples of such are disclosed herein with the consensus amino acid sequence NPXT, in underlined and bolded text. A skilled artisan will appreciate that in any one of these sequences, the residue in the X position (marked with a double underline in the below examples) may be substituted with any amino acid - e.g., Q, R, K, S, or T. Examples include:
  • SEQ ID NO. 13 Haemophilus influenzae IhfA, A5 fragment:
  • SEQ ID NO. 14 Haemophilus influenzae HU, A5 fragment: RTGRNPQTGAEIQI AASKVP .
  • SEQ ID NO. 17 Haemophilus influenzae IhfB, modified B4 (mB4) fragment:
  • SEQ ID NO. 26 Haemophilus influenzae IhfA, A tip fragment:
  • SEQ ID NO. 27 Haemophilus influenzae IhfB, B tip fragment:
  • the polypeptide comprising NPXT is at least about 20 amino acids long and the NPXT is located approximately centrally in the sequence.
  • Non-limiting examples of such sequences include SEQ ID NOs. 13, 14, and 31.
  • the agents and compositions can be used in the manufacture of medicaments and for the treatment of humans and other animals by administration in accordance with conventional procedures, such as an active ingredient in pharmaceutical compositions.
  • compositions and related methods of the present disclosure may be used in combination with the administration of other therapies. These include, but are not limited to, the administration of DNase enzymes, antibiotics, antimicrobials, vaccine adjuvants, or other antibodies.
  • the methods and compositions include a deoxyribonuclease (DNase) enzyme that acts synergistically with the anti-DNABII antibody.
  • DNase is any enzyme that catalyzes the cleavage of phosphodiester linkages in the DNA backbone.
  • DNase enzymes that are known to target not only cruciform structures, but also a variety of secondary structure of DNA include DNAse I, T4 EndoVII and T7 Endo I.
  • the effective amount of anti-DNABII antibody needed to destabilize the biofilm is reduced when combined with a DNase.
  • the DNase can be added directly to the assay or in a suitable buffer known to stabilize the enzyme.
  • the effective Unit dose of DNase and the assay conditions may vary, and can be optimized according to procedures known in the art.
  • the methods and compositions can be combined with antibiotics and/or antimicrobials.
  • Antimicrobials are substances that kill or inhibit the growth of microorganisms such as bacteria, fungi, or protozoans.
  • biofilms are generally resistant to the actions of antibiotics, compositions and methods described herein can be used to sensitize the infection involving a biofilm to traditional therapeutic methods for treating infections.
  • the use of antibiotics or antimicrobials in combination with methods and compositions described herein allow for the reduction of the effective amount of the antimicrobial and/or biofilm reducing agent.
  • antimicrobials and antibiotics useful in combination with methods of the current disclosure include amoxicillin, amoxicillin-clavulanate, cefdinir, azithromycin, and sulfamethoxazole- trimethoprim.
  • the therapeutically effective dose of the antimicrobial and/or antibiotic in combination with the biofilm reducing agent can be readily determined by traditional methods.
  • the dose of the antimicrobial agent in combination with the biofilm reducing agent is the average effective dose which has been shown to be effective in other bacterial infections, for example, bacterial infections wherein the etiology of the infection does not include a biofilm.
  • the dose is 0.1, 0.15, 0.2, 0.25, 0,30, 0,35, 0.40, 0.45, 0.50, 0.55, 0.60, 0.65, 0.70, 0.75, 0.8, 0.85, 0.9, 0.95, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.5, 3.0 or 5 times the average effective dose.
  • the antibiotic or antimicrobial can be added prior to, concurrent with, or subsequent to the addition of the anti- DNABII antibody.
  • the methods and compositions can be combined with antibodies that treat the bacterial infection.
  • antibodies that treat the bacterial infection.
  • One example of an antibody useful in the methods and compositions can be combined with antibodies that treat the bacterial infection.
  • an antibody directed against an unrelated outer membrane protein i.e., OMP P5
  • OMP P5 an unrelated outer membrane protein
  • Treatment with this antibody alone does not debulk a biofilm in vitro.
  • Combined therapy with this antibody and a biofilm reducing agent results in a greater effect than that which could be achieved by either reagent used alone at the same concentration.
  • Other antibodies that may produce a synergistic effect when combined with a biofilm reducing agent or methods to reduce a biofilm include anti- rsPilA anti-OMP26, anti-OMP P2, and anti-whole OMP preparations.
  • compositions and methods described herein can be used to sensitize the bacterial infection involving a biofilm to common therapeutic modalities effective in treating bacterial infections without a biofilm but are otherwise ineffective in treating bacterial infections involving a biofilm.
  • the compositions and methods described herein can be used in combination with therapeutic modalities that are effective in treating or preventing bacterial infections involving a biofilm, but the combination of such additional therapy and biofilm reducing agent or method produces a synergistic effect such that the effective dose of either the biofilm reducing agent or the additional therapeutic agent can be reduced.
  • the combination of such additional therapy and biofilm reducing agent or method produces a synergistic effect such that the treatment is enhanced.
  • An enhancement of treatment can be evidenced by a shorter amount of time required to treat the infection.
  • the additional therapeutic treatment can be added prior to, concurrent with, or subsequent to methods or compositions used to reduce the biofilm, and can be contained within the same formation or as a separate formulation. Kits
  • kits containing the agents and instructions necessary to perform the in vitro and in vivo methods as described herein are claimed. Accordingly, the disclosure provides kits for performing these methods which may include an antibody fragment or antigen binding fragmet thereof as disclosed herein as well as instructions for carrying out the methods disclosed herein such as collecting tissue and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an antibody fragment or antigen binding fragmet thereof, as defined herein. These can be used alone or in combination with other suitable antimicrobial agents.
  • kits can comprise, or alternatively consist essentially of, or yet further consist of any one or more antibody fragments, polypeptides or compositions of this disclosure and instructions for use.
  • the kit can further comprising one or more of an adjuvant, an antigenic peptide or an antimicrobial.
  • carriers include a liquid carrier, a pharmaceutically acceptable carrier, a solid phase carrier, a pharmaceutically acceptable carrier, a pharmaceutically acceptable polymer, a liposome, a micelle, an implant, a stent, a paste, a gel, a dental implant, or a medical implant.
  • Example 1 Generation of IHF and HU antibodies and Fab fragments
  • IHF and HU antibodies, proteins and polypeptides were generated to IHF and HU as a whole and to specific fragments.
  • Transformants of strain K5607, a lambda lysogen of strain C600himA42 that had received the desired plasmid were identified by screening ampicillin-resistant transformants for the ability to grow bacteriophage Mu.
  • DNA was prepared from himA + transformants according to standard DNA isolation techniques, and the orientation of the himA gene was determined by restriction enzyme cleavage.
  • plasmid pKT23-hip323 which contains a fusion of the IHF-betacoding sequence to the bacteriophage lambda P L promoter was used.
  • pKT23-hip323 was introduced into N5271 to give strain E443.
  • changed its selectable marker was changed from ampicillin resistance (bla + ) to chloramphenicol resistance (cat-).
  • a cat- containing fragment was isolated from plasmid pBR325 as described by Flamm and
  • E735 was transformed with plasmid pP L himA-1, selecting transformant (E738) that had become ampicillin resistant and had retained chloramphenicol resistance.
  • the generation of a second strain that overproduces both subunits of depended on the construction of plasmid pPJiip himA-5, which was made by ligating blunted (Sstll restriction enzyme site) containing the pheT and himA genes into the pKT23-hip323 plasmid. This is described in further detail in (Nash et al. (1987) J. Bacteriology 169(9):4124-4127.
  • a 10% (vol/vol) solution (1.1 ml) of polymin P (BDH Chemicals Ltd.) was added slowly to the clarified extract; after being stirred for 20 mm, the mixture was centrifuged for 30 mm at 10,000 rpm. The resulting pellet was suspended in 10 ml of TEG containing 500 mM NaCl; after being stirred for 15 min, the mixture was centrifuged for 20 min at 12,000 rpm. The supernatant (10.3 ml) was adjusted to 50% saturation by the addition of 3.2 g of ammonium sulfate, stirred for 20 min, and centrifuged for 15 min at 15,000 rpm.
  • the resulting supernatant was adjusted to 70% saturation by the addition of 1.64 g of ammonium sulfate, stirred for 20 min, and centrifuged for 15 min at 15,000 rpm.
  • the resulting pellet was suspended in 1 ml of TG (50 mM Tris hydrochloride (pH 7.4) containing 10% glycerol) and dialyzed against two changes of TG.
  • the dialyzed material 2.0 ml was loaded onto a 1-ml column (0.5 by 5.8 cm) of
  • Polyclonal anti-IHF was prepared as follows. Rabbits were injected with 250 ⁇ g of purified IHF with Freund's complete adjuvant. Booster immunizations of 250 ⁇ g of IHF with Freund's incomplete adjuvant were given 1, 7, and 12 weeks later. As determined by immunoblotting of IHF, sera collected 13 weeks after the initial injection had a high titer of IHF-reactive material. The animals were maintained for several years and, when necessary, given further booster immunization in order to maintain a high titer of anti-IHF in their sera. The antibody was not purified further. Crude sera was stored at -70° C. Polyclonal anti-HU was prepared according to the same manner.
  • Hybridomas producing murine monoclonal antibodies specific to each subunit of IHF or HU were generated by using synthetic polypeptides corresponding to SEQ ID NOs. 12-17 were ordered from Rockland Immonchemicals, Limerick, PA. Three of the synthetic polypeptides corresponding to SEQ ID NOs. 12-17 were ordered from Rockland Immonchemicals, Limerick, PA. Three of the synthetic polypeptides corresponding to SEQ ID NOs. 12-17 were ordered from Rockland Immonchemicals, Limerick, PA. Three of the
  • hybridomas were deposited and validated for viability by ATCC, see Table 1, above.
  • Rabbit polyclonal anti-IhfB2 N THi and anti-mIhfB4 N THi were prepared as follows. Rabbits were injected with 250 ⁇ g of IhfB2 NTH i peptide or mIhfB4 NTHI peptide, with Freund's complete adjuvant. Two booster immunizations of 250 ⁇ g of IhfB2 N THi or mIhfB4 N THi with Freund's incomplete adjuvant were given at 21 -day intervals.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Communicable Diseases (AREA)
  • Mycology (AREA)
  • Zoology (AREA)
  • Pulmonology (AREA)
  • Virology (AREA)
  • Biotechnology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Diabetes (AREA)
  • Biomedical Technology (AREA)
  • Agronomy & Crop Science (AREA)
  • Environmental Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Dentistry (AREA)
  • Plant Pathology (AREA)
  • Pest Control & Pesticides (AREA)
PCT/US2018/012255 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders Ceased WO2018129092A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP18701391.7A EP3565834B1 (en) 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders
AU2018206560A AU2018206560B9 (en) 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders
US16/475,654 US12098188B2 (en) 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders
JP2019556568A JP7661008B2 (ja) 2017-01-04 2018-01-03 バイオフィルム関連障害の処置のための抗体断片
CA3049114A CA3049114A1 (en) 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders
JP2023001681A JP2023033394A (ja) 2017-01-04 2023-01-10 バイオフィルム関連障害の処置のための抗体断片
JP2025016938A JP2025067928A (ja) 2017-01-04 2025-02-04 バイオフィルム関連障害の処置のための抗体断片
JP2025104762A JP2025126236A (ja) 2017-01-04 2025-06-20 バイオフィルム関連障害の処置のための抗体断片

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762442307P 2017-01-04 2017-01-04
US62/442,307 2017-01-04
US201762453921P 2017-02-02 2017-02-02
US62/453,921 2017-02-02

Publications (1)

Publication Number Publication Date
WO2018129092A1 true WO2018129092A1 (en) 2018-07-12

Family

ID=61025090

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/012255 Ceased WO2018129092A1 (en) 2017-01-04 2018-01-03 Antibody fragments for the treatment of biofilm-related disorders

Country Status (6)

Country Link
US (1) US12098188B2 (https=)
EP (1) EP3565834B1 (https=)
JP (4) JP7661008B2 (https=)
AU (1) AU2018206560B9 (https=)
CA (1) CA3049114A1 (https=)
WO (1) WO2018129092A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10940204B2 (en) 2015-07-31 2021-03-09 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms
JP2022512580A (ja) * 2018-10-05 2022-02-07 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル 細菌バイオフィルムの酵素的破壊のための組成物および方法
US11564982B2 (en) 2017-01-04 2023-01-31 Research Institute At Nationwide Children's Hospital DNABII vaccines and antibodies with enhanced activity
EP4361171A3 (en) * 2019-07-08 2024-07-31 Research Institute at Nationwide Children's Hospital Antibody compositions for disrupting biofilms
US12365710B2 (en) 2018-10-05 2025-07-22 Research Institute At Nationwide Children's Hospital HMGB1 protein derivatives for the removal of biofilms

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11274144B2 (en) 2013-06-13 2022-03-15 Research Institute At Nationwide Children's Hospital Compositions and methods for the removal of biofilms
EP3365027B1 (en) 2015-10-14 2022-03-30 Research Institute at Nationwide Children's Hospital Hu specific antibodies and their use in inhibiting biofilm

Citations (84)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3760984A (en) 1971-09-29 1973-09-25 Alza Corp Osmotically powered agent dispensing device with filling means
US3845770A (en) 1972-06-05 1974-11-05 Alza Corp Osmatic dispensing device for releasing beneficial agent
US3916899A (en) 1973-04-25 1975-11-04 Alza Corp Osmotic dispensing device with maximum and minimum sizes for the passageway
US3923426A (en) 1974-08-15 1975-12-02 Alza Corp Electroosmotic pump and fluid dispenser including same
US3987790A (en) 1975-10-01 1976-10-26 Alza Corporation Osmotically driven fluid dispenser
US3995631A (en) 1971-01-13 1976-12-07 Alza Corporation Osmotic dispenser with means for dispensing active agent responsive to osmotic gradient
US4016880A (en) 1976-03-04 1977-04-12 Alza Corporation Osmotically driven active agent dispenser
US4036228A (en) 1975-09-11 1977-07-19 Alza Corporation Osmotic dispenser with gas generating means
US4111203A (en) 1976-11-22 1978-09-05 Alza Corporation Osmotic system with means for improving delivery kinetics of system
US4111202A (en) 1976-11-22 1978-09-05 Alza Corporation Osmotic system for the controlled and delivery of agent over time
US4203440A (en) 1978-10-23 1980-05-20 Alza Corporation Device having variable volume chamber for dispensing useful agent
US4203442A (en) 1977-08-29 1980-05-20 Alza Corporation Device for delivering drug to a fluid environment
US4210139A (en) 1979-01-17 1980-07-01 Alza Corporation Osmotic device with compartment for governing concentration of agent dispensed from device
US4327725A (en) 1980-11-25 1982-05-04 Alza Corporation Osmotic device with hydrogel driving member
US4360019A (en) 1979-02-28 1982-11-23 Andros Incorporated Implantable infusion device
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4603102A (en) 1984-07-06 1986-07-29 Agfa-Gevaert Aktiengesellschaft Photographic silver halide recording material with cellulose dicarboxylic acid semiester particles in outer layer
US4627850A (en) 1983-11-02 1986-12-09 Alza Corporation Osmotic capsule
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4692147A (en) 1980-04-02 1987-09-08 Medtronic, Inc. Drug administration device
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4725852A (en) 1985-05-09 1988-02-16 Burlington Industries, Inc. Random artificially perturbed liquid apparatus and method
US4754065A (en) 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0322094A1 (en) 1987-10-30 1989-06-28 Delta Biotechnology Limited N-terminal fragments of human serum albumin
US4865845A (en) 1986-03-21 1989-09-12 Alza Corporation Release rate adjustment of osmotic or diffusional delivery devices
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
US5057318A (en) 1988-12-13 1991-10-15 Alza Corporation Delivery system for beneficial agent over a broad range of rates
US5059423A (en) 1988-12-13 1991-10-22 Alza Corporation Delivery system comprising biocompatible beneficial agent formulation
US5112614A (en) 1989-09-14 1992-05-12 Alza Corporation Implantable delivery dispenser
EP0486525A1 (en) 1989-08-01 1992-05-27 Cemu Bioteknik Ab STABILIZED PROTEIN OR PEPTIDE CONJUGATES.
US5137727A (en) 1991-06-12 1992-08-11 Alza Corporation Delivery device providing beneficial agent stability
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
WO1993002108A1 (en) 1991-07-25 1993-02-04 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5234693A (en) 1990-07-11 1993-08-10 Alza Corporation Delivery device with a protective sleeve
US5234692A (en) 1990-07-11 1993-08-10 Alza Corporation Delivery device with a protective sleeve
US5304489A (en) 1987-02-17 1994-04-19 Genpharm International, Inc. DNA sequences to target proteins to the mammary gland for efficient secretion
WO1995000655A1 (en) 1993-06-24 1995-01-05 Mc Master University Adenovirus vectors for gene therapy
WO1995011984A2 (en) 1993-10-25 1995-05-04 Canji, Inc. Recombinant adenoviral vector and methods of use
WO1995027071A2 (en) 1994-04-04 1995-10-12 Board Of Regents, The University Of Texas System An adenovirus supervector system
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5543293A (en) 1990-06-11 1996-08-06 Nexstar Pharmaceuticals, Inc. DNA ligands of thrombin
US5580737A (en) 1990-06-11 1996-12-03 Nexstar Pharmaceuticals, Inc. High-affinity nucleic acid ligands that discriminate between theophylline and caffeine
US5627052A (en) 1990-08-02 1997-05-06 B.R. Centre, Ltd. Methods for the production of proteins with a desired function
US5631146A (en) 1995-01-19 1997-05-20 The General Hospital Corporation DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof
US5643207A (en) 1995-04-28 1997-07-01 Medtronic, Inc. Implantable techniques for infusing a therapeutic agent with endogenous bodily fluid
WO1997027840A1 (en) 1996-02-02 1997-08-07 Alza Corporation Sustained delivery of an active agent using an implantable system
US5670153A (en) 1991-09-13 1997-09-23 Chiron Corporation Immunoreactive polypeptide compositions
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5686073A (en) 1990-05-23 1997-11-11 The University Of Iowa Research Foundation Polyclonal and monoclonal antibodies against a 43 KDA dystrophin associated protein
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5723323A (en) 1985-03-30 1998-03-03 Kauffman; Stuart Alan Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof
US5733761A (en) 1991-11-05 1998-03-31 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5763192A (en) 1986-11-20 1998-06-09 Ixsys, Incorporated Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5786462A (en) 1990-06-11 1998-07-28 Nexstar Pharmaceuticals, Inc. High affinity ssDNA ligands of HIV-1 reverse transcriptase
US5820589A (en) 1996-04-30 1998-10-13 Medtronic, Inc. Implantable non-invasive rate-adjustable pump
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
WO1999055369A1 (en) 1998-04-28 1999-11-04 Smithkline Beecham Corporation Monoclonal antibodies with reduced immunogenicity
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US6198966B1 (en) 1999-02-26 2001-03-06 Medtronic, Inc. Recirculating implantable drug delivery system
US6204023B1 (en) 1985-11-01 2001-03-20 Xoma Ltd. Modular assembly of antibody genes, antibodies prepared thereby and use
US6322788B1 (en) 1998-08-20 2001-11-27 Stanley Arthur Kim Anti-bacterial antibodies and methods of use
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6656746B2 (en) 1993-11-05 2003-12-02 Zymogenetics, Inc. Antibodies to human kunitz-type inhibitor
US6709659B1 (en) 1996-08-02 2004-03-23 Zymogenetics, Inc. Antibodies that bind testis-specific insulin homolog polypeptides
US6797492B2 (en) 1991-05-17 2004-09-28 Merck & Co., Inc. Method for reducing the immunogenicity of antibody variable domains
US7060800B2 (en) 2000-09-08 2006-06-13 Schering Corporation Antibodies binding the TNF related protein, TNF-X
US7119179B1 (en) 2005-03-21 2006-10-10 Los Alamos National Security, Llc Preparation of high nitrogen compound and materials therefrom
US7279559B2 (en) 1999-04-28 2007-10-09 Genetics Institute, Llc Antibodies that bind to interleukin-22
US20110059079A1 (en) 2009-09-04 2011-03-10 Xoma Technology Ltd. Antibody Coformulations
US7939344B2 (en) 2003-11-05 2011-05-10 Trellis Bioscience, Inc. Use of particulate labels in bioanalyte detection methods
WO2011123396A1 (en) * 2010-03-29 2011-10-06 University Of Southern California Compositions and methods for the removal of biofilms
WO2014201305A1 (en) * 2013-06-13 2014-12-18 University Of Southern California Compositions and methods for the treatment of burkholderia infections
WO2015048484A2 (en) * 2013-09-26 2015-04-02 Trellis Bioscience, Llc Binding moieties for biofilm remediation
US20160194384A1 (en) * 2014-06-12 2016-07-07 Research Institute At Nationwide Children's Hospital Compositions and methods for the removal of biofilms
WO2017023863A1 (en) * 2015-07-31 2017-02-09 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms

Family Cites Families (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050131222A1 (en) 1995-04-21 2005-06-16 Human Genome Sciences, Inc. Nucleotide sequence of the haemophilus influenzae Rd genome, fragments thereof, and uses thereof
US6355450B1 (en) 1995-04-21 2002-03-12 Human Genome Sciences, Inc. Computer readable genomic sequence of Haemophilus influenzae Rd, fragments thereof, and uses thereof
US6551795B1 (en) 1998-02-18 2003-04-22 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to pseudomonas aeruginosa for diagnostics and therapeutics
US6696550B2 (en) 1998-07-23 2004-02-24 Millennium Pharmaceuticals, Inc. Humanized anti-CCR2 antibodies and methods of use therefor
JP2003527439A (ja) 2000-03-17 2003-09-16 ミレニアム・ファーマシューティカルズ・インコーポレイテッド 抗cd18抗体と抗ccr2抗体の混合物を用いる狭窄および再狭窄を抑制する方法
AU2002307448A1 (en) 2001-04-20 2002-11-05 President And Fellows Of Harvard College Methods and compositions for the modulation of biofilm formation
WO2004001058A2 (en) 2001-05-04 2003-12-31 Paratek Pharmaceuticals, Inc. Transcription factor modulating compounds and methods of use thereof
AU2002328203C1 (en) 2001-08-24 2009-01-08 Migenix Inc. Antimicrobial and anti-inflammatory peptides
US20030099602A1 (en) 2001-10-25 2003-05-29 Levin Gilbert V. D-tagatose as an anti-biofilm agent
US20060057160A1 (en) 2002-08-02 2006-03-16 Ralph Biemans Vaccine composition
US7285269B2 (en) 2002-12-02 2007-10-23 Amgen Fremont, Inc. Antibodies directed to tumor necrosis factor
US7297340B2 (en) 2003-01-07 2007-11-20 University Of Iowa Research Foundation Vaccine and method for preventing biofilm formation
CA2796381A1 (en) 2003-03-06 2004-09-16 Children's Hospital, Inc. Genes of an otitis media isolate of nontypeable haemophilus influenzae
US20090029929A1 (en) 2004-03-26 2009-01-29 Locomogene, Inc. Decoy Nucleic Acid to Synoviolin Gene Promoter
GB0410866D0 (en) * 2004-05-14 2004-06-16 Chiron Srl Haemophilius influenzae
EP1799255A4 (en) 2004-06-25 2008-10-01 Medimmune Vaccines Inc RECOMBINANT HUMANESE CYTOMEGALOVIRUS AND HETEROLOGIST ANTIGENS CONTAINING VACCINES
US20060030539A1 (en) 2004-08-06 2006-02-09 National Jewish Medical And Research Center Product and process for inhibition of biofilm development
SI1858920T1 (sl) 2005-02-18 2016-07-29 Glaxosmithkline Biologicals S.A. Proteini in nukleinske kisline iz escherichia coli, povezane z meningitisom/sepso
US20060228384A1 (en) 2005-04-06 2006-10-12 Sequoia Sciences, Inc. Control of biofilm with a biofilm inhibitor
CA2871088A1 (en) 2005-06-16 2006-12-28 Lauren O. Bakaletz Genes of an otitis media isolate of nontypeable haemophilus influenzae
EP1943344A2 (en) 2005-10-04 2008-07-16 The Ludwig Institute for Cancer Research Methods for stimulating an immune response using bacterial antigen delivery system
US20090264342A1 (en) 2006-02-13 2009-10-22 Trustees Of Boston University Compositions and methods for antibiotic potentiation and drug discovery
CA2660668C (en) 2006-08-21 2016-06-28 The University Of British Columbia Small cationic antimicrobial peptides
EP1980269A1 (en) 2007-04-13 2008-10-15 Katholieke Universiteit Leuven Prevention of staphylococcus biofilm formation
WO2009006699A1 (en) 2007-07-12 2009-01-15 Oral Health Australia Pty Ltd Biofilm treatment
EP2613797B1 (en) 2010-09-09 2015-11-04 University Of Southern California Compositions and methods for the removal of biofilms
US9746475B2 (en) 2011-03-14 2017-08-29 University Of Southern California Antibody and antibody mimetic for visualization and ablation of endogenous proteins
US20130183323A1 (en) 2011-12-19 2013-07-18 Hua Wang Targeted antibiotic and antimicrobial treatments for personalized administration
AU2013266069B2 (en) 2012-05-25 2018-03-15 Sloan Kettering Institute For Cancer Research Methods for treating GI syndrome and graft versus host disease
US11274144B2 (en) 2013-06-13 2022-03-15 Research Institute At Nationwide Children's Hospital Compositions and methods for the removal of biofilms
US20160289287A1 (en) 2013-08-27 2016-10-06 The University Of British Columbia Small cationic anti-biofilm and idr peptides
US9745366B2 (en) 2013-09-23 2017-08-29 University Of Southern California Compositions and methods for the prevention of microbial infections
US10233234B2 (en) 2014-01-13 2019-03-19 Trellis Bioscience, Llc Binding moieties for biofilm remediation
US20150197558A1 (en) 2013-09-26 2015-07-16 Trellis Bioscience, Llc Binding moieties for biofilm remediation
US11248040B2 (en) 2013-09-26 2022-02-15 Trellis Bioscience, Llc Binding moieties for biofilm remediation
US20150299298A1 (en) 2013-09-26 2015-10-22 Trellis Bioscience, Llc Binding moieties for biofilm remediation
BR112016013514B1 (pt) * 2013-12-13 2022-04-19 Stora Enso Oyj (Fi) Papelão de múltiplas camadas
EP3049113B1 (en) 2014-01-13 2023-12-27 Trellis Bioscience, LLC Binding moieties for biofilm remediation
US10624934B2 (en) 2014-03-06 2020-04-21 Research Institute At Nationwide Children's Hospital Prebiotic formulations
WO2016154491A1 (en) 2015-03-25 2016-09-29 Trellis Bioscience, Llc Binding moieties for biofilm remediation
EP3365027B1 (en) 2015-10-14 2022-03-30 Research Institute at Nationwide Children's Hospital Hu specific antibodies and their use in inhibiting biofilm
CN109069871A (zh) 2015-12-04 2018-12-21 加利福尼亚大学董事会 用于治疗癌症的新抗体
US20170182205A1 (en) 2015-12-28 2017-06-29 ProclaRx LLC Medical devices with biofilm disruptors
WO2017192594A1 (en) 2016-05-02 2017-11-09 Trellis Bioscience, Llc Binding moieties for biofilm remediation
AU2017319702B2 (en) 2016-09-02 2024-11-14 The Regents Of The University Of California Methods and compositions involving interleukin-6 receptor alpha-binding single chain variable fragments
US11564982B2 (en) 2017-01-04 2023-01-31 Research Institute At Nationwide Children's Hospital DNABII vaccines and antibodies with enhanced activity
WO2018170178A1 (en) 2017-03-15 2018-09-20 Research Institute At Nationwide Children's Hospital Composition and methods for disruption of bacterial biofilms without accompanying inflammation
AU2019354829B2 (en) 2018-10-05 2025-04-17 Research Institute At Nationwide Children's Hospital Hmgb1 protein derivatives for the removal of biofilms
AU2020311897A1 (en) 2019-07-08 2022-02-03 Research Institute At Nationwide Children's Hospital Antibody compositions for disrupting biofilms

Patent Citations (101)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3995631A (en) 1971-01-13 1976-12-07 Alza Corporation Osmotic dispenser with means for dispensing active agent responsive to osmotic gradient
US3760984A (en) 1971-09-29 1973-09-25 Alza Corp Osmotically powered agent dispensing device with filling means
US3845770A (en) 1972-06-05 1974-11-05 Alza Corp Osmatic dispensing device for releasing beneficial agent
US3916899A (en) 1973-04-25 1975-11-04 Alza Corp Osmotic dispensing device with maximum and minimum sizes for the passageway
US3923426A (en) 1974-08-15 1975-12-02 Alza Corp Electroosmotic pump and fluid dispenser including same
US4036228A (en) 1975-09-11 1977-07-19 Alza Corporation Osmotic dispenser with gas generating means
US3987790A (en) 1975-10-01 1976-10-26 Alza Corporation Osmotically driven fluid dispenser
US4016880B1 (https=) 1976-03-04 1983-02-01
US4016880A (en) 1976-03-04 1977-04-12 Alza Corporation Osmotically driven active agent dispenser
US4111203A (en) 1976-11-22 1978-09-05 Alza Corporation Osmotic system with means for improving delivery kinetics of system
US4111202A (en) 1976-11-22 1978-09-05 Alza Corporation Osmotic system for the controlled and delivery of agent over time
US4203442A (en) 1977-08-29 1980-05-20 Alza Corporation Device for delivering drug to a fluid environment
US4203440A (en) 1978-10-23 1980-05-20 Alza Corporation Device having variable volume chamber for dispensing useful agent
US4210139A (en) 1979-01-17 1980-07-01 Alza Corporation Osmotic device with compartment for governing concentration of agent dispensed from device
US4360019A (en) 1979-02-28 1982-11-23 Andros Incorporated Implantable infusion device
US4692147A (en) 1980-04-02 1987-09-08 Medtronic, Inc. Drug administration device
US4327725A (en) 1980-11-25 1982-05-04 Alza Corporation Osmotic device with hydrogel driving member
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4627850A (en) 1983-11-02 1986-12-09 Alza Corporation Osmotic capsule
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4603102A (en) 1984-07-06 1986-07-29 Agfa-Gevaert Aktiengesellschaft Photographic silver halide recording material with cellulose dicarboxylic acid semiester particles in outer layer
US4754065A (en) 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (https=) 1985-03-28 1990-11-27 Cetus Corp
US5817483A (en) 1985-03-30 1998-10-06 Stuart Kauffman Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property
US5814476A (en) 1985-03-30 1998-09-29 Stuart Kauffman Process for the production of stochastically-generated transcription or translation products
US5723323A (en) 1985-03-30 1998-03-03 Kauffman; Stuart Alan Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof
US5824514A (en) 1985-03-30 1998-10-20 Stuart A. Kauffman Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides
US5976862A (en) 1985-03-30 1999-11-02 Ixsys Corporation Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique
US4725852A (en) 1985-05-09 1988-02-16 Burlington Industries, Inc. Random artificially perturbed liquid apparatus and method
US6204023B1 (en) 1985-11-01 2001-03-20 Xoma Ltd. Modular assembly of antibody genes, antibodies prepared thereby and use
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4865845A (en) 1986-03-21 1989-09-12 Alza Corporation Release rate adjustment of osmotic or diffusional delivery devices
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US5763192A (en) 1986-11-20 1998-06-09 Ixsys, Incorporated Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
US5565362A (en) 1987-02-17 1996-10-15 Pharming B.V. DNA sequences to target proteins to the mammary gland for efficient secretion
US5994616A (en) 1987-02-17 1999-11-30 Pharming B.V. Targeted synthesis of protein in mammary gland of a non-human transgenic mammal
US5304489A (en) 1987-02-17 1994-04-19 Genpharm International, Inc. DNA sequences to target proteins to the mammary gland for efficient secretion
US4873316A (en) 1987-06-23 1989-10-10 Biogen, Inc. Isolation of exogenous recombinant proteins from the milk of transgenic mammals
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
EP0322094A1 (en) 1987-10-30 1989-06-28 Delta Biotechnology Limited N-terminal fragments of human serum albumin
US5057318A (en) 1988-12-13 1991-10-15 Alza Corporation Delivery system for beneficial agent over a broad range of rates
US5059423A (en) 1988-12-13 1991-10-22 Alza Corporation Delivery system comprising biocompatible beneficial agent formulation
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
EP0486525A1 (en) 1989-08-01 1992-05-27 Cemu Bioteknik Ab STABILIZED PROTEIN OR PEPTIDE CONJUGATES.
US5112614A (en) 1989-09-14 1992-05-12 Alza Corporation Implantable delivery dispenser
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5686073A (en) 1990-05-23 1997-11-11 The University Of Iowa Research Foundation Polyclonal and monoclonal antibodies against a 43 KDA dystrophin associated protein
US5543293A (en) 1990-06-11 1996-08-06 Nexstar Pharmaceuticals, Inc. DNA ligands of thrombin
US5580737A (en) 1990-06-11 1996-12-03 Nexstar Pharmaceuticals, Inc. High-affinity nucleic acid ligands that discriminate between theophylline and caffeine
US5786462A (en) 1990-06-11 1998-07-28 Nexstar Pharmaceuticals, Inc. High affinity ssDNA ligands of HIV-1 reverse transcriptase
US5234693A (en) 1990-07-11 1993-08-10 Alza Corporation Delivery device with a protective sleeve
US5234692A (en) 1990-07-11 1993-08-10 Alza Corporation Delivery device with a protective sleeve
US5627052A (en) 1990-08-02 1997-05-06 B.R. Centre, Ltd. Methods for the production of proteins with a desired function
US6797492B2 (en) 1991-05-17 2004-09-28 Merck & Co., Inc. Method for reducing the immunogenicity of antibody variable domains
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5137727A (en) 1991-06-12 1992-08-11 Alza Corporation Delivery device providing beneficial agent stability
WO1993002108A1 (en) 1991-07-25 1993-02-04 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5670153A (en) 1991-09-13 1997-09-23 Chiron Corporation Immunoreactive polypeptide compositions
US5733761A (en) 1991-11-05 1998-03-31 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6350861B1 (en) 1992-03-09 2002-02-26 Protein Design Labs, Inc. Antibodies with increased binding affinity
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
WO1995000655A1 (en) 1993-06-24 1995-01-05 Mc Master University Adenovirus vectors for gene therapy
WO1995011984A2 (en) 1993-10-25 1995-05-04 Canji, Inc. Recombinant adenoviral vector and methods of use
US6656746B2 (en) 1993-11-05 2003-12-02 Zymogenetics, Inc. Antibodies to human kunitz-type inhibitor
US5849992A (en) 1993-12-20 1998-12-15 Genzyme Transgenics Corporation Transgenic production of antibodies in milk
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
WO1995027071A2 (en) 1994-04-04 1995-10-12 Board Of Regents, The University Of Texas System An adenovirus supervector system
US5631146A (en) 1995-01-19 1997-05-20 The General Hospital Corporation DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof
US5643207A (en) 1995-04-28 1997-07-01 Medtronic, Inc. Implantable techniques for infusing a therapeutic agent with endogenous bodily fluid
US5985305A (en) 1996-02-02 1999-11-16 Alza Corporation Sustained delivery of an active agent using an implantable system
WO1997027840A1 (en) 1996-02-02 1997-08-07 Alza Corporation Sustained delivery of an active agent using an implantable system
US5728396A (en) 1996-02-02 1998-03-17 Alza Corporation Sustained delivery of leuprolide using an implantable system
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5820589A (en) 1996-04-30 1998-10-13 Medtronic, Inc. Implantable non-invasive rate-adjustable pump
US6709659B1 (en) 1996-08-02 2004-03-23 Zymogenetics, Inc. Antibodies that bind testis-specific insulin homolog polypeptides
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
WO1999055369A1 (en) 1998-04-28 1999-11-04 Smithkline Beecham Corporation Monoclonal antibodies with reduced immunogenicity
US6322788B1 (en) 1998-08-20 2001-11-27 Stanley Arthur Kim Anti-bacterial antibodies and methods of use
US6198966B1 (en) 1999-02-26 2001-03-06 Medtronic, Inc. Recirculating implantable drug delivery system
US7279559B2 (en) 1999-04-28 2007-10-09 Genetics Institute, Llc Antibodies that bind to interleukin-22
US7060800B2 (en) 2000-09-08 2006-06-13 Schering Corporation Antibodies binding the TNF related protein, TNF-X
US7939344B2 (en) 2003-11-05 2011-05-10 Trellis Bioscience, Inc. Use of particulate labels in bioanalyte detection methods
US7119179B1 (en) 2005-03-21 2006-10-10 Los Alamos National Security, Llc Preparation of high nitrogen compound and materials therefrom
US20110059079A1 (en) 2009-09-04 2011-03-10 Xoma Technology Ltd. Antibody Coformulations
WO2011123396A1 (en) * 2010-03-29 2011-10-06 University Of Southern California Compositions and methods for the removal of biofilms
US8999291B2 (en) 2010-03-29 2015-04-07 University Of Southern California Compositions and methods for the removal of biofilms
WO2014201305A1 (en) * 2013-06-13 2014-12-18 University Of Southern California Compositions and methods for the treatment of burkholderia infections
WO2015048484A2 (en) * 2013-09-26 2015-04-02 Trellis Bioscience, Llc Binding moieties for biofilm remediation
US20160194384A1 (en) * 2014-06-12 2016-07-07 Research Institute At Nationwide Children's Hospital Compositions and methods for the removal of biofilms
WO2017023863A1 (en) * 2015-07-31 2017-02-09 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms

Non-Patent Citations (139)

* Cited by examiner, † Cited by third party
Title
"Gene Expression Technology", 1991, ACADEMIC PRESS, INC.
"Gene Transfer Vectors for Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY
"Immobilized Cells and Enzymes", 1986, IRL PRESS
"Immunochemical Methods in Cell and Molecular Biology", 1987, ACADEMIC PRESS
"Methods in Enzymology", ACADEMIC PRESS, INC.
"Monoclonal antibodies against DNA-binding tips of DNABII proteins disrupt biofilms in vitro and induce bacterial clearance in vivo", EBIOMEDICINE, vol. 10, August 2016 (2016-08-01), pages 33 - 44
"Monoclonal antibodies against DNA-binding tips of DNABII proteins disrupt biofilms in vitro and induce bacterial clearance in vivo", EBIOMEDICINE., vol. 10, 2016, pages 33 - 44
"Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody in Cancer Therapy", pages: 303 - 16
"PCR: The Polymerase Chain Reaction", vol. 199, BIRKHAUSER PRESS, pages: 4
"Remington's Pharmaceutical Sciences", MACK PUBLISHING COMPANY
ADAMS ET AL., 9TH INTERNATIONAL SYMPOSIUM ON RECENT ADVANCES IN OTITIS MEDIA, 2007
ADAMS ET AL.: "107th General Meeting", 2007, AMERICAN SOCIETY FOR MICROBIOLOGY
AMON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting of Drugs In Cancer Therapy", pages: 243 - 56
ANDERSON, NUCLEIC ACID HYBRIDIZATION, 1999
ANTIBODIES, A LABORATORY MANUAL, 1999
ANTIBODIES, A LABORATORY MANUAL, 2014
ARBONES ET AL., IMMUNITY, vol. 1, no. 4, 1994, pages 247 - 260
ARMOUR ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624
ARMOUR ET AL., MOL. IMMUNOL., vol. 40, 2003, pages 585 - 593
BABCOOK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 7843 - 7848
BIRCH; RADNER, ADV. DRUG DELIVERY REV., vol. 58, 2006, pages 671 - 685
BROWNING ET AL., CURR. OPIN. MICROBIOL., vol. 13, 2010, pages 773 - 780
BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507
CARTER, NAT. REV. IMMUNOL., vol. 6, 2006, pages 343 - 357
CONRAD ET AL., PLANT MOL. BIOL., vol. 38, 1998, pages 101 - 109
CRAMER ET AL., CURR. TOP. MICROBOL. IMMUNOL., vol. 240, 1999, pages 95 - 118
CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987
CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 2015
DEUTSCHER ET AL.: "Guide To Protein Purification: Methods In Enzymology", vol. 182, 1999, ACADEMIC PRESS
DONLAN, EMERGING INFECTIOUS DISEASES, vol. 8, no. 9, 2002, pages 881 - 890
DRESSER ET AL., PATHOGENS, vol. 5, no. 12, 4 December 2009 (2009-12-04), pages el000680
EREN ET AL., MUMMA, vol. 93, 1998, pages 154 - 161
FERGUSON ET AL., ANN. REV. BIOCHEM., vol. 57, 1988, pages 285 - 320
FERRERA ET AL., BIOFOULING, vol. 31, no. 2, 2015, pages 173 - 180
FRESHNEY, CULTURE OF ANIMAL CELLS: A MANUAL OF BASIC TECHNIQUE, 2010
GALLO ET AL., EUROPEAN J. OF IMMUN., vol. 30, 2000, pages 534 - 540
GENE TRANSFER AND EXPRESSION IN MAMMALIAN CELLS, 2003
GRANSTON; NASH, J. MOL. BIOL., vol. 234, 1993, pages 45 - 59
GRAY ET AL., J. IMM. METH., vol. 182, 1995, pages 155 - 163
GREEN, J. OF IMMUN. METHODS, vol. 231, 1999, pages 11 - 23
GREEN; JAKOBOVITS, J. EXP. MED., vol. 188, no. 3, 1998, pages 483 - 495
HANDBOOK OF BIOCHEMISTRY AND MOLECULAR BIOLOGY, 2010
HANES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 14130 - 14135
HAUGLAND, RICHARD P., HANDBOOK OF FLUORESCENT PROBES AND RESEARCH CHEMICALS, 1996
HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53
HERLYN ET AL., SCIENCE, vol. 232, 1986, pages 100
HERMONAT; MUZYCZKA, PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6466 - 6470
HESSELL ET AL., NATURE, vol. 449, 2007, pages 101 - 104
HOOD ET AL., ADV. EXP. MED. BIOL., vol. 464, 1999, pages 127 - 147
HUSE ET AL., SCIENCE, vol. 256, pages 1275 - 1281
IMMOBILIZATION OF ENZYMES AND CELLS, 2006
IN VITRO TRANSCRIPTION AND TRANSLATION PROTOCOLS, 2007
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, no. 6, 1993, pages 2551 - 2555
JAKOBOVITS, ADVANCED DRUG REVIEWS, vol. 31, 1998, pages 33 - 42
JAKOBOVITS, CURRENT BIOLOGY, vol. 4, no. 8, 1994, pages 761 - 763
JAKOBOVITS, CURRENT OPINION IN BIOTECHNOLOGY, vol. 6, 1995, pages 561 - 566
JAKOBOVITS, EXP. OPIN. INVEST. DRUGS, vol. 7, no. 4, 1998, pages 607 - 614
JAKOBOVITS, NATURE, vol. 362, no. 6417, 1993, pages 255 - 258
JAKOBOVITS: "Weir's Handbook of Experimental Immunology, The Integrated Immune System", vol. IV, 1996, pages: 194.1 - 194.7
JEFFERIS, ARCH. BIOCHEM. BIOPHYS., vol. 526, 2012, pages 159 - 166
JURCISEK; BAKALETZ, J. BACTERIOLOGY, vol. 189, no. 10, 2007, pages 3868 - 3875
JURCISEK; BAKALETZ, J. OF BACTERIOLOGY, vol. 189, no. 10, 2007, pages 3868 - 3875
KABAT ET AL.: "Sequences of Proteins of Immunological interest", 1987, NATIONAL INSTITUTES OF HEALTH
KARPOVSKY ET AL., J. EXP. MED., vol. 160, pages 1686
KENNY ET AL., BIO. TECHNOL., vol. 13, 1995, pages 787 - 790
KOTTERMAN ET AL., VIRAL VECTORS FOR GENE THERAPY: TRANSLATIONAL AND CLINICAL OUTLOOK ANNUAL REVIEW OF BIOMEDICAL ENGINEERING, vol. 17, 2015
KOYAMA, CHEM. ABSTR., vol. 120, 1994, pages 217262t
LAINE ET AL., EUR. J. BIOCHEM, vol. 103, no. 3, 1980, pages 447 - 481
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LAURA A. NOVOTNY ET AL: "Monoclonal antibodies against DNA-binding tips of DNABII proteins disrupt biofilms in vitro and induce bacterial clearance in vivo", EBIOMEDICINE, vol. 10, 1 August 2016 (2016-08-01), pages 33 - 44, XP055352908, ISSN: 2352-3964, DOI: 10.1016/j.ebiom.2016.06.022 *
LEBKOWSKI ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 3988 - 3996
LIU AND, MABS, vol. 4, May 2012 (2012-05-01), pages 17 - 23
LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648
M. ELIZABETH BROCKSON ET AL: "Evaluation of the kinetics and mechanism of action of anti-integration host factor-mediated disruption of bacterial biofilms", MOLECULAR MICROBIOLOGY, 19 September 2014 (2014-09-19), pages n/a - n/a, XP055147799, ISSN: 0950-382X, DOI: 10.1111/mmi.12735 *
MACPHERSON ET AL., PCR 2: A PRACTICAL APPROACH, 1995
MACPHERSON ET AL.: "PCR 1: A Practical Approach", 2015, IRL PRESS
MARIANI ET AL.: "A new enzymatic method to obtain high-yield F(ab)2 suitable for clinical use from mouse IgGl", MOLEC. IMMUNOL., vol. 28, no. 1-2, January 1991 (1991-01-01), pages 69 - 77
MCPHERSON ET AL., PCR: THE BASICS (GARLAND SCIENCE, 2006
MEARES ET AL., ANAL. BIOCHEM., vol. 142, 1984, pages 68 - 78
MENDEZ ET AL., GENOMICS, vol. 26, 1995, pages 294 - 307
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MOLECULAR CLONING: A LABORATORY MANUAL, 2012
MURPHY ET AL., THE PEDIATRIC INFECTIOUS DISEASE JOURNAL, vol. 28, 2009, pages S121 - S126
MURPHY, T.F. ET AL., THE PEDIATRIC INFECTIOUS DISEASE JOURNAL, vol. 28, 2009, pages S121 - S126
NASH ET AL., J. BACTERIOLOGY, vol. 169, no. 9, 1987, pages 4124 - 4127
NASH ET AL., JOURNAL OF BACTERIOLOGY, vol. 169, no. 9, 1987, pages 4124 - 4127
NGUYEN ET AL., MICROBIOL. IMMUNOL., vol. 41, 1997, pages 901 - 907
NOVOTNY ET AL., 9TH INTERNATIONAL SYMPOSIUM ON RECENT ADVANCES IN OTITIS MEDIA, 2007
NOVOTNY ET AL., INFECT, vol. 68, no. 4, 2000, pages 2119 - 2128
NOVOTNY ET AL., MOL MICROBIOL., vol. 96, no. 2, 2015, pages 276 - 92
NOVOTNY ET AL., VACCINE, vol. 20, no. 29-30, 2002, pages 3590 - 3597
NOVOTNY ET AL., VACCINE, vol. 24, no. 22, 2006, pages 4804 - 11
NUCLEIC ACID HYBRIDIZATION, 1984
NUCLEIC ACIDS HYBRIDIZATION: MODERN APPLICATIONS, 2007
O'KEEFE ET AL., PROC. NAT. ACAD. SCI. USA, vol. 106, no. 15, 2009, pages 6099 - 6104
OLIGONUCLEOTIDE SYNTHESIS, 1984
OLIGONUCLEOTIDE SYNTHESIS: METHODS AND APPLICATIONS, 2005
ORDWAY ET AL., ANTI. AGENTS AND CHEMOTHERAPY, vol. 54, 2010, pages 1820
ORLANDI ET AL., PNAS, vol. 86, 1989, pages 3833 - 3837
OTTO, NATURE REVIEWS MICROBIOLOGY, vol. 7, 2009, pages 555
PADLAN ET AL., MOL. IMMUNOL., vol. 28, no. 4-5, 1991, pages 489 - 498
PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1988
POWELL ET AL., BIOTECHNOL., vol. 8, 1990, pages 333 - 337
PRICE ET AL.: "Monoclonal antibodies: Production, Engineering and Clinical Application", 1995, CAMBRIDGE UNIVERSITY PRESS, article "Production and Characterization of Synthetic Peptide-Derived Antibodies", pages: 60 - 84
PRYMULA ET AL., LANCET., vol. 367, no. 9512, 2006, pages 740 - 8
QUADRI ET AL., NUCL. MED. BIOL., vol. 20, 1993, pages 559 - 570
REDPATH ET AL., HUM. IMMUNOL., vol. 59, 1998, pages 720 - 727
RICE ET AL., CELL, vol. 87, 1996, pages 1295 - 1306
RISPENS; VIDARSSON: "Human IgG Subclasses", 2014, ACADEMIC PRESS, pages: 159 - 177
RODWELL ET AL., PNAS USA, vol. 83, 1986, pages 2632 - 2636
ROUX ET AL., J. IMMUNOL., vol. 159, 1997, pages 3372 - 3382
RUSSEL ET AL., INFECTION AND IMMUNITY, April 2000 (2000-04-01), pages 1820 - 1826
SANDHU ET AL., CRIT. REV. BIOTECHNOL., vol. 16, 1996, pages 95 - 118
SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574
SCHLESINGER; DUBENSKY, CURR. OPIN. BIOTECHNOL., vol. 5, 1999, pages 434 - 439
SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201
SHERMAN-GOLD, GENETIC ENGINEERING NEWS, vol. 17, 1997, pages 14
SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740
SPIRA ET AL., J. IMMUNOL. METHODS, vol. 74, 1984, pages 307
STEENBAKKERS ET AL., MOLEC. BIOL. REPORTS, vol. 19, 1994, pages 125 - 134
STEPLEWSKI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8653
STOLTZ ET AL., SCIENCE TRANSLATIONAL MEDICINE, vol. 2, no. 29, 2010, pages 29 - 31
SWINGER ET AL., CURR. OPIN. STRUCT. BIOL., vol. 14, 2004, pages 28 - 35
THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58
THORPE ET AL.: "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", MONOCLONAL ANTIBODIES '84: BIOLOGICAL AND CLINICAL APPLICATIONS, vol. 84, 1985, pages 475 - 506
TIAN ET AL., PHARM. SCI., vol. 103, 2014, pages 1701 - 1710
TRANSCRIPTION AND TRANSLATION, 1984
TSUDA ET AL., GENOMICS, vol. 42, 1997, pages 413 - 421
UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180
UPESLACIS ET AL.: "Monoclonal antibodies: principles and applications", 1995, WILEY-LISS, INC., article "Modification of Antibodies by Chemical Methods", pages: 187 - 230
VAFA ET AL., METHODS, vol. 65, 2014, pages 114 - 126
WANES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 4937 - 4942
WEIR'S HANDBOOK OF EXPERIMENTAL IMMUNOLOGY, 1996
WEN ET AL., J. IMMUNOL, vol. 17, 1987, pages 887 - 892
WINTER ET AL., NATURE, vol. 349, 1991, pages 293 - 299
YANG ET AL., J. OF LEUKOCYTE BIOLOGY, vol. 66, 1999, pages 401 - 410
YANG, CANCER RESEARCH, vol. 59, no. 6, 1999, pages 1236 - 1243
YING ET AL., NAT. MED., vol. 5, no. 7, 1999, pages 823 - 827
YU ET AL., INT. J. CANCER, vol. 56, 1994, pages 244

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10940204B2 (en) 2015-07-31 2021-03-09 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms
US11684673B2 (en) 2015-07-31 2023-06-27 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms
US12239763B2 (en) 2015-07-31 2025-03-04 Research Institute At Nationwide Children's Hospital Peptides and antibodies for the removal of biofilms
US11564982B2 (en) 2017-01-04 2023-01-31 Research Institute At Nationwide Children's Hospital DNABII vaccines and antibodies with enhanced activity
US12419944B2 (en) 2017-01-04 2025-09-23 Research Institute At Nationwide Children's Hospital DNABII vaccines and antibodies with enhanced activity
JP2022512580A (ja) * 2018-10-05 2022-02-07 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル 細菌バイオフィルムの酵素的破壊のための組成物および方法
EP3861021A4 (en) * 2018-10-05 2022-06-22 Research Institute at Nationwide Children's Hospital COMPOSITIONS AND METHODS FOR ENZYMATIC DESTRUCTION OF BACTERIAL BIOFILM
JP7541513B2 (ja) 2018-10-05 2024-08-28 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル 細菌バイオフィルムの酵素的破壊のための組成物および方法
US12161701B2 (en) 2018-10-05 2024-12-10 Research Institute At Nationwide Children's Hospital Compositions and methods for enzymatic disruption of bacterial biofilms
US12365710B2 (en) 2018-10-05 2025-07-22 Research Institute At Nationwide Children's Hospital HMGB1 protein derivatives for the removal of biofilms
EP4361171A3 (en) * 2019-07-08 2024-07-31 Research Institute at Nationwide Children's Hospital Antibody compositions for disrupting biofilms

Also Published As

Publication number Publication date
AU2018206560B2 (en) 2025-01-30
EP3565834B1 (en) 2025-10-22
EP3565834A1 (en) 2019-11-13
AU2018206560A1 (en) 2019-07-18
JP7661008B2 (ja) 2025-04-14
JP2023033394A (ja) 2023-03-10
JP2025126236A (ja) 2025-08-28
US12098188B2 (en) 2024-09-24
AU2018206560B9 (en) 2025-04-03
US20190338018A1 (en) 2019-11-07
JP2025067928A (ja) 2025-04-24
CA3049114A1 (en) 2018-07-12
JP2020506221A (ja) 2020-02-27

Similar Documents

Publication Publication Date Title
US12239763B2 (en) Peptides and antibodies for the removal of biofilms
JP7627255B2 (ja) バイオフィルムを破壊するための抗体組成物
US12419944B2 (en) DNABII vaccines and antibodies with enhanced activity
AU2018206560B9 (en) Antibody fragments for the treatment of biofilm-related disorders
EP3365027B1 (en) Hu specific antibodies and their use in inhibiting biofilm
HK40111331A (en) Antibody compositions for disrupting biofilms
HK1255383B (en) Peptides and antibodies for the removal of biofilms

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18701391

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3049114

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019556568

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018206560

Country of ref document: AU

Date of ref document: 20180103

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018701391

Country of ref document: EP

Effective date: 20190805

WWG Wipo information: grant in national office

Ref document number: 2018701391

Country of ref document: EP