WO2018098258A2 - Selective sulfonation of benzodiazepine derivatives - Google Patents
Selective sulfonation of benzodiazepine derivatives Download PDFInfo
- Publication number
- WO2018098258A2 WO2018098258A2 PCT/US2017/062989 US2017062989W WO2018098258A2 WO 2018098258 A2 WO2018098258 A2 WO 2018098258A2 US 2017062989 W US2017062989 W US 2017062989W WO 2018098258 A2 WO2018098258 A2 WO 2018098258A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ala
- val
- optionally substituted
- carbon atoms
- branched
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*SC(C)(C)CCC(Nc1cc(COc(cc(c2c3)N=CC(Cc4ccccc44)N4C2=O)c3OC)cc(COc(cc(c2c3)N=CC(Cc4c5cccc4)N5C2=O)c3OC)c1)=O Chemical compound C*SC(C)(C)CCC(Nc1cc(COc(cc(c2c3)N=CC(Cc4ccccc44)N4C2=O)c3OC)cc(COc(cc(c2c3)N=CC(Cc4c5cccc4)N5C2=O)c3OC)c1)=O 0.000 description 7
- JPDCXPPIZWQQJL-PXLJZGITSA-N CC(C)(CCC(Nc1cc(COc(cc(c2c3)N=C[C@H](Cc4c5cccc4)N5C2=O)c3OC)cc(COc(cc(c2c3)N=C[C@H](Cc4ccccc44)N4C2=O)c3OC)c1)=O)SC Chemical compound CC(C)(CCC(Nc1cc(COc(cc(c2c3)N=C[C@H](Cc4c5cccc4)N5C2=O)c3OC)cc(COc(cc(c2c3)N=C[C@H](Cc4ccccc44)N4C2=O)c3OC)c1)=O)SC JPDCXPPIZWQQJL-PXLJZGITSA-N 0.000 description 1
- QGXVFTYTCRUZLI-RIZNBTAUSA-N CC(C)(CN(CCOCCOCCOC)c1cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)cc(COc2cc(NC[C@H](C3)N(C4O)c5c3cccc5)c4cc2OC)c1)SSCCC(C(NCCN(C(C=C1)=O)C1=O)=O)S(O)(=O)=O Chemical compound CC(C)(CN(CCOCCOCCOC)c1cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)cc(COc2cc(NC[C@H](C3)N(C4O)c5c3cccc5)c4cc2OC)c1)SSCCC(C(NCCN(C(C=C1)=O)C1=O)=O)S(O)(=O)=O QGXVFTYTCRUZLI-RIZNBTAUSA-N 0.000 description 1
- ISGLDFBYYSAGRX-XZIJETOTSA-N CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c(C(N2c3ccccc3C[C@H]22)=O)c3)NC2S(O)(=O)=O)c3OC)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)SSCCC(C(NCCN(C(C=C1)=O)C1=O)=O)S(O)(=O)=O Chemical compound CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c(C(N2c3ccccc3C[C@H]22)=O)c3)NC2S(O)(=O)=O)c3OC)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)SSCCC(C(NCCN(C(C=C1)=O)C1=O)=O)S(O)(=O)=O ISGLDFBYYSAGRX-XZIJETOTSA-N 0.000 description 1
- FHVCLMVDGAVSTF-GSVOJQHPSA-N CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c2c3)NC[C@H](Cc4c5cccc4)N5C2=O)c3OC)cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)c1)SSCCCC(ON(C(CC1)=O)C1=O)=O Chemical compound CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c2c3)NC[C@H](Cc4c5cccc4)N5C2=O)c3OC)cc(COc(c(OC)c2)cc(N=C[C@H](C3)N4c5c3cccc5)c2C4=O)c1)SSCCCC(ON(C(CC1)=O)C1=O)=O FHVCLMVDGAVSTF-GSVOJQHPSA-N 0.000 description 1
- DOKWDOLZCMETIJ-ZAQUEYBZSA-N CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c2c3)NC[C@H](Cc4ccccc44)N4C2=O)c3OC)cc(COc(cc(c2c3)N=C[C@H](Cc4c5cccc4)N5C2=O)c3OC)c1)S Chemical compound CC(C)(CN(CCOCCOCCOC)c1cc(COc(cc(c2c3)NC[C@H](Cc4ccccc44)N4C2=O)c3OC)cc(COc(cc(c2c3)N=C[C@H](Cc4c5cccc4)N5C2=O)c3OC)c1)S DOKWDOLZCMETIJ-ZAQUEYBZSA-N 0.000 description 1
- ZZLUJKMZDAMFNU-RPLLCQBOSA-N CC(C)N[C@@H](Cc1ccccc1)C(N[C@](CCCCN)(CNc1ccc(COC(I)=O)cc1)C=O)=O Chemical compound CC(C)N[C@@H](Cc1ccccc1)C(N[C@](CCCCN)(CNc1ccc(COC(I)=O)cc1)C=O)=O ZZLUJKMZDAMFNU-RPLLCQBOSA-N 0.000 description 1
- RPGRHXXQWMYNEO-UHFFFAOYSA-N CC(C)SC(C)(C)CCC(Nc1cc(COc(cc(c2c3)N=CC(Cc4ccccc44)N4C2=O)c3OC)cc(COc(c(OC)c2)cc(NCC(C3)N4c5c3cccc5)c2C4=O)c1)=O Chemical compound CC(C)SC(C)(C)CCC(Nc1cc(COc(cc(c2c3)N=CC(Cc4ccccc44)N4C2=O)c3OC)cc(COc(c(OC)c2)cc(NCC(C3)N4c5c3cccc5)c2C4=O)c1)=O RPGRHXXQWMYNEO-UHFFFAOYSA-N 0.000 description 1
- RMVMVJNVOQQGPE-PXLJZGITSA-N CC(NCC(NCC(NCC(Nc1cc(COc(cc(c2c3)N=C[C@H](Cc4ccccc44)N4C2=O)c3OC)cc(COc(c(OC)c2)cc(N=C[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)=O)=O Chemical compound CC(NCC(NCC(NCC(Nc1cc(COc(cc(c2c3)N=C[C@H](Cc4ccccc44)N4C2=O)c3OC)cc(COc(c(OC)c2)cc(N=C[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)=O)=O RMVMVJNVOQQGPE-PXLJZGITSA-N 0.000 description 1
- JYUDPPJDZPTCJV-UHFFFAOYSA-N CCCNC(C(CCSC)S(O)(=O)=O)=O Chemical compound CCCNC(C(CCSC)S(O)(=O)=O)=O JYUDPPJDZPTCJV-UHFFFAOYSA-N 0.000 description 1
- DJIVBNQNMDGZOL-UHFFFAOYSA-N CCCNC(CCCSC)=O Chemical compound CCCNC(CCCSC)=O DJIVBNQNMDGZOL-UHFFFAOYSA-N 0.000 description 1
- YKYWKCZMAXNEPO-UHFFFAOYSA-N CCCOc(c(OC)c1)cc(N=CC(C2)N3CC2=C)c1C3=O Chemical compound CCCOc(c(OC)c1)cc(N=CC(C2)N3CC2=C)c1C3=O YKYWKCZMAXNEPO-UHFFFAOYSA-N 0.000 description 1
- ULMLCLUWGHVNGG-JLOLTXOASA-N C[C@@H](C(N[C@@H](C)C(Nc1cc(COc(c(OC)c2)cc(NC([C@H]3N4c5ccccc5C3)S(O)(=O)=O)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)NC(CCCCC(NCCN(C(C=C1)=O)C1=O)=O)=O Chemical compound C[C@@H](C(N[C@@H](C)C(Nc1cc(COc(c(OC)c2)cc(NC([C@H]3N4c5ccccc5C3)S(O)(=O)=O)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)NC(CCCCC(NCCN(C(C=C1)=O)C1=O)=O)=O ULMLCLUWGHVNGG-JLOLTXOASA-N 0.000 description 1
- HDCYVWIKDJLGRC-XNNASHAVSA-N C[C@H](C1)N(C(c(c(N)c2)cc(OC)c2OCc2cc(COc(cc(c3c4)NC[C@H](Cc5c6cccc5)N6C3=O)c4OC)cc(NC(CCC(C)(C)SSCCC(C(NCCN(C(C=C3)=O)C3=O)=O)S(O)(=O)=O)=O)c2)=O)c2c1cccc2 Chemical compound C[C@H](C1)N(C(c(c(N)c2)cc(OC)c2OCc2cc(COc(cc(c3c4)NC[C@H](Cc5c6cccc5)N6C3=O)c4OC)cc(NC(CCC(C)(C)SSCCC(C(NCCN(C(C=C3)=O)C3=O)=O)S(O)(=O)=O)=O)c2)=O)c2c1cccc2 HDCYVWIKDJLGRC-XNNASHAVSA-N 0.000 description 1
- PIECIIDCTKFVPL-VLXMWBNISA-N NCCCC(C1)C1(C(I)=O)NC([C@H](Cc1ccccc1)NC(CCOCCOCCNC(CCN(C(C=C1)=O)C1=O)=O)=O)=O Chemical compound NCCCC(C1)C1(C(I)=O)NC([C@H](Cc1ccccc1)NC(CCOCCOCCNC(CCN(C(C=C1)=O)C1=O)=O)=O)=O PIECIIDCTKFVPL-VLXMWBNISA-N 0.000 description 1
- JSHOVKSMJRQOGY-UHFFFAOYSA-N O=C(CCCSSc1ncccc1)ON(C(CC1)=O)C1=O Chemical compound O=C(CCCSSc1ncccc1)ON(C(CC1)=O)C1=O JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D243/00—Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms
- C07D243/06—Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4
- C07D243/10—Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems
- C07D243/14—1,4-Benzodiazepines; Hydrogenated 1,4-benzodiazepines
- C07D243/16—1,4-Benzodiazepines; Hydrogenated 1,4-benzodiazepines substituted in position 5 by aryl radicals
- C07D243/18—1,4-Benzodiazepines; Hydrogenated 1,4-benzodiazepines substituted in position 5 by aryl radicals substituted in position 2 by nitrogen, oxygen or sulfur atoms
- C07D243/24—Oxygen atoms
- C07D243/26—Preparation from compounds already containing the benzodiazepine skeleton
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
Definitions
- Antibody-cytotoxic agent conjugates and cell binding agent-drug conjugates are emerging as a powerful class of anti-tumor agents with efficacy across a range of cancers.
- Cell binding agent-drug conjugates are commonly composed of three distinct elements: a cell-binding agent (e.g. , an antibody); a linker; and a cytotoxic moiety.
- the cytotoxic drug moiety can be covalently attached to lysines on the antibody, resulting in conjugates that are heterogeneous mixtures of ADCs bearing varying numbers of drugs attached at different positions on the antibody molecule.
- the cytotoxic drug moiety can be covalently linked to cysteine thiol groups on the antibody through a thiol-reactive group, such as a maleimde group, to form site-specific ADCs.
- Conjugation reactions between the antibodies and the cytotoxic agents are often carried out in water or an aqueous solution with small amount of an organic solvent required for solubilizing the cytotoxic agents.
- Benzodiazepine compounds including tricyclic benzodiazepines, such as
- pyrrolobenzodiazepines PBD
- tetracyclic benzodiazepines such as
- indolinobenzodiazepines have been employed as cytotoxic agents in linkage with antibodies to generate ADCs, which have shown promising antitumor activities.
- These benzodiazepine compounds contain imine bonds, which can bind to the minor groove of DNA and interfere with DNA function, resulting in cell death.
- Benzodiazepine compounds generally have very low solubility in water. To solubilize the benzodiazepine compounds in the conjugation reaction with antibodies, relatively large amount of organic solvent is required, which can destabilize the antibodies.
- the imine-containing benzodiazepine compounds can be treated with an imine reactive reagent, such as a bisulfite salt or a metabisulfite salt, before the conjugation reaction with antibodies to form the antibody-benzodiazepine conjugates.
- an imine reactive reagent such as a bisulfite salt or a metabisulfite salt
- Sulfonation of the imine group can increase the water solubility of the benzodiazepine compounds, resulting in improved conditions for the conjugation reactions with CBAs, such as antibodies.
- CBAs such as antibodies.
- nucleophilic additions between nucleophiles and ⁇ , ⁇ -unsaturated carbonyls are well known in synthetic organic chemistry. The nucleophilic addition of bisulfite to the activated olefin of a maleimide is one such example of this reaction.
- the reactive group for covalent linkage with the antibodies, the maleimide moiety and the imine moiety can both react with the bisulfite salt or the metabisulfite salt to form sulfonated maleimide and/or sulfonated imine.
- the present invention provides a novel method for preparing a cell-binding agent- cytotoxic agent conjugate comprising an imine-containing cytotoxic agent bearing a maleimide group covalently linked to a cell-binding agent (CBA).
- CBA cell-binding agent
- the present invention provides a method of preparing a cell-binding agent-cytotoxic agent conjugate comprising the steps of:
- a modified cytotoxic agent comprising a modified imine moiety represented by the following formula:
- D is an imine-containing cytotoxic compound
- L is a linker
- D is an imine-containing tricyclic or tetracyclic
- D is an imine-containing tricyclic benzodiazepine compounds.
- D is an imine-containing tetracyclic benzodiazepine compounds.
- an imine-containing tricyclic benzodiazepine compound refers to a compound having a monocyclic ring fused to the diazepine portion of the benzodiazepine core.
- the monocyclic ring may contain one or more additional heteroatoms, such as oxygen, sulfur or nitrogen, and substituents such as monocyclic rings or polycyclic rings.
- Exemplary tricyclic benzodiazepine compounds include, but are not limited to, pyrrolobenzodiazepines (PBD), such as those described in WO2010/043880, WO2011/130616, WO2009/016516, WO 2013/177481 and WO 2012/112708.
- an imine-containing tetracyclic benzodiazepine compound refers to a compound having a bicyclic ring fused to the diazepine portion of the benzodiazepine core.
- the bicyclic ring is a fused bicyclic ring optionally containing one or more additional heteroatoms, such as oxygen, sulfur or nitrogen.
- Exemplary tetracyclic benzodiazepine compounds include, but are not limited to, indolinobenzodiazepines (IGNs), such as those described in WO/2010/091150, and WO 2012/128868.
- D is an indolinobenzodiazepine.
- D is a pyrrolobenzodiazepine (PBD).
- PBD pyrrolobenzodiazepine
- cell-binding agent-cytotoxic agent conjugates and modified cytotoxic agents prepared by the methods described herein. It should be understood that any embodiments described herein, including
- FIG. 1 shows an UPLC chromatogram of the reaction mixture of imine-containing cytotoxic agent Dl with sodium bisulfite at pH 3.3.
- FIG. 2 shows an UPLC chromatogram of the reaction mixture of imine-containing cytotoxic agent Dl with sodium bisulfite at pH 4.75.
- FIG. 3 shows an UPLC chromatogram of the reaction mixture of a PBD imine- containing cytototoxic agent talirine with sodium bisulfite.
- FIGs. 4 A and 4B show UPLC chromatograms of the reaction mixture of an imine- containing cytotoxic agent D5 with 2.0 (FIG. 4A) or 2.5 (FIG. 4B) equivalents of sodium bisulfite.
- Alkyl' or “linear or branched alkyl” as used herein refers to a saturated linear or branched monovalent hydrocarbon radical.
- a straight chain or branched chain alkyl has thirty or fewer carbon atoms (e.g., C 1 -C 30 for straight chain alkyl group and C 3 -C 30 for branched alkyl), and more preferably twenty or fewer carbon atoms. Even more preferably, the straight chain or branched chain alkyl has ten or fewer carbon atoms (i.e. , C 1 -C 10 for straight chain alkyl group and C 3 -C 10 for branched alkyl).
- the straight chain or branched chain alkyl has six or fewer carbon atoms (i.e.. Ci-C 6 for straight chain alky group or C3-C6 for branched chain alkyl).
- alkyl include, but are not limited to, methyl, ethyl, 1 -propyl, 2-propyl, 1 -butyl, 2-methyl-l -propyl, - CH 2 CH(CH 3 ) 2 ), 2-butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl 3-pentyl, 2-methyl-2-butyl, 3- methyl-2-butyl, 3 -methyl- 1 -butyl, 2-methyl-l -butyl, 1-hexyl), 2-hexyl, 3-hexyl, 2-methyl-2- pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3-pentyl, 2,3-
- alkyl as used throughout the specification, examples, and claims is intended to include both “unsubstituted alkyls” and “substituted alkyls”, the latter of which refers to alkyl moieties having substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone.
- (C x -C xx )alkyl or C x _ xx alky means a linear or branched alkyl having x-xx carbon atoms.
- the alkenyl has two to ten carbon atoms. More preferably, the alkyl has two to four carbon atoms.
- Alkynyl or “linear or branched alkynyl” refers to a linear or branched monovalent hydrocarbon radical of two to twenty carbon atoms with at least one site of unsaturation, i.e. , a carbon-carbon, triple bond. Examples include, but are not limited to, ethynyl, propynyl, 1- butynyl, 2-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, hexynyl, and the like.
- the alkynyl has two to ten carbon atoms. More preferably, the alkynyl has two to four carbon atoms.
- cyclic alkyl and “cycloalkyl” can be used interchangeably.
- the term refers to the radical of a saturated carbocyclic ring.
- cycloalkyls have from 3 to 10 carbon atoms in their ring structure, and more preferably from 5 to 7 carbon atoms in the ring structure.
- the two cyclic rings can have two or more atoms in common, e.g., the rings are "fused rings.”
- Suitable cycloalkyls include, but are not limited to cycloheptyl, cyclohexyl, cyclopentyl, cyclobutyl and cyclopropyl.
- the cycloalkyl is a monocyclic group. In some embodiments, the cycloalkyl is a bicyclic group. In some embodiments, the cycloalkyl is a tricyclic group.
- cycloalklalkyl refers to an alkyl group described above that is substituted with a cycloalkyl group.
- cyclic alkenyl refers to a carbocyclic ring radical having at least one double bond in the ring structure.
- cyclic alkynyl refers to a carbocyclic ring radical having at least one triple bond in the ring structure.
- aryl as used herein, include substituted or unsubstituted single-ring aromatic groups in which each atom of the ring is carbon.
- the ring is a 5- to 7- membered ring, more preferably a 6-membered ring.
- Aryl groups include, but are not limited to, phenyl, phenol, aniline, and the like.
- aryl also includes "polycyclyl",
- polycycle and “polycyclic” ring systems having two or more rings in which two or more atoms are common to two adjoining rings, e.g., the rings are “fused rings," wherein at least one of the rings is aromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, or aromatic rings.
- polycycles have 2-3 rings.
- polycyclic ring systems have two cyclic rings in which both of the rings are aromatic. Each of the rings of the polycycle can be substituted or unsubstituted.
- each ring of the polycycle contains from 3 to 10 carbon atoms in the ring, preferably from 5 to 7.
- aryl groups include, but are not limited to, phenyl (benzene), tolyl, anthracenyl, fluorenyl, indenyl, azulenyl, and naphthyl, as well as benzo-fused carbocyclic moieties such as 5,6,7,8-tetrahydronaphthyl, and the like.
- the aryl is a single-ring aromatic group.
- the aryl is a two-ring aromatic group.
- the aryl is a three-ring aromatic group.
- heterocycle refers to substituted or unsubstituted non-aromatic ring structures of 3- to 18-membered rings, preferably 3- to 10-membered rings, more preferably 3- to 7-membered rings, whose ring structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms.
- the ring structure can have two cyclic rings.
- the two cyclic rings can have two or more atoms in common, e.g., the rings are "fused rings.”
- Heterocyclyl groups include, for example, piperidine, piperazine, pyrrolidine, morpholine, lactones, lactams, and the like. Heterocycles are described in Paquette, Leo A.; “Principles of Modern Heterocyclic Chemistry” (W. A. Benjamin, New York, 1968), particularly Chapters 1, 3, 4, 6, 7, and 9; “The Chemistry of Heterocyclic Compounds, A series of Monographs” (John Wiley & Sons, New York, 1950 to present), in particular Volumes 13, 14, 16, 19, and 28; and J. Am. Chem. Soc.
- heterocyclic rings include, but are not limited to, tetrahydrofurane, dihydrofuran, tetrahydrothiene, tetrahydropyran, dihydropyran, tetrahydrothiopyran, thiomorpholine, thioxane, homopiperazine, azetidine, oxetane, thietane, homopiperidine, piperidine, piperazine, pyrrolidine, morpholine, oxepane, thiepane, oxazepine, diazepine, thiazepine, 2-pyrroline, 3-pyrroline, indoline, 2H-pyrane, 4H-pyrane, dioxane, 1,3-dioxolane, pyrazoline, dithiane, dithiolane, dihydropyrane, dihydrothiene, dihydrofurane,
- pyrazolidinylimidazoline imidazolidine, 3-azabicyco[3.1.0]hexane, 3- azabicyclo[4.1.0]heptane, and azabicyclo[2.2.2]hexane.
- heteroaryl refers to substituted or unsubstituted aromatic single ring structures, preferably 5- to 7-membered rings, more preferably 5- to 6-membered rings, whose ring structures include at least one heteroatom (e.g., 0, N, or S), preferably one to four or one to three heteroatoms, more preferably one or two heteroatoms. When two or more heteroatoms are present in a heteroaryl ring, they may be the same or different.
- heteroaryl also includes “polycyclyl”, “polycycle”, and “polycyclic” ring systems having two or more cyclic rings in which two or more ring atoms are common to two adjoining rings, e.g., the rings are "fused rings," wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, hetero aromatic s, and/or heterocyclyls.
- polycyclic heteroaryls have 2-3 rings.
- preferred polycyclic heteroaryls have two cyclic rings in which both of the rings are aromatic.
- each ring of the polycycle contains from 3 to 10 atoms in the ring, preferably from 5 to 7 atoms in the ring.
- heteroaryl groups include, but are not limited to, pyrrole, furan, thiophene, imidazole, oxazole, thiazole, pyrazole, pyridine, pyrazine, pyridazine, quinoline, pyrimidine, indolizine, indole, indazole, benzimidazole, benzothiazole, benzofuran, benzothiophene, cinnoline, phthalazine, quinazoline, carbazole, phenoxazine, quinoline, purine and the like.
- the heteroaryl is a single -ring aromatic group.
- the heteroaryl is a two-ring aromatic group.
- the heteroaryl is a three-ring aromatic group.
- the heterocycle or heteroaryl groups can be carbon (carbon-linked) or nitrogen (nitrogen-linked) attached where such is possible.
- carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4, 5, 6, 7,
- nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3- pyrroline, imidazole, imidazolidine, 2-imidazoline, 3 -imidazoline, pyrazole, pyrazoline, 2- pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, IH-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or O- carboline.
- heteroatoms present in heteroaryl or heterocyclcyl include the oxidized forms such as NO, SO, and S0 2 .
- halo or halogen refers to fluorine (F), chlorine (CI), bromine (Br) or iodine (I).
- haloalkyl refers to an alkyl, as defined herein, that is substituted by one or more halo groups as defined herein.
- the haloalkyl can be
- a monohaloalkyl can have one fluoro, chloro, bromo, or iodo substituent.
- Dihaloalkyl or polyhaloalkyl can be substituted with two or more of the same halo atoms or a combination of different halo groups.
- haloalkyl examples include, but are not limited to, flouromethyl, difluoromethyl, trifluoromethyl, chloroamethyl, dichloromethyl, trichloromethyl, pentafluoroethyl, heptafluoropropyl, diflurochloromethyl, dichlorofluoromethyl, difluoroehthyl, diflosoropropyl, dichloroethyl and dichloropropyl.
- Alkoxy used herein refers to alkyl-O-, wherein alkyl is defined herein above.
- alkoxy examples include, not are not limited to, methoxy, ethoxy, propoxy, 2-propoxy, butoxy, tert-butoxy, pentyloxy, hexyloxy, and the like.
- alkyl, haloalkyl, alkoxy, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above can be optionally substituted with one or more (e.g. , 2, 3, 4, 5, 6 or more) substituents.
- references to chemical moieties herein are understood to also include substituted variants.
- reference to an "alkyl” group or moiety implicitly includes both substituted and unsubstituted variants.
- substituents on chemical moieties includes but is not limited to, halogen, hydroxyl, carbonyl (such as carboxyl, alkoxycarbonyl, formyl, or acyl), thiocarbonyl (such as thioester, thioacetate, or thioformate), alkoxyl, alkylthio, acyloxy, phosphoryl, phosphate, phosphonate, amino, amido, amidine, imine, cyano, nitro, azido, sulfhydryl, alkylthio, sulfate, sulfonate, sulfamoyl, sulfonamido, sulfonyl, heterocyclyl, aralkyl
- Optional or “optionally” means that the subsequently described circumstance may or may not occur, so that the application includes instances where the circumstance occurs and instances where it does not.
- the phrase “optionally substituted” means that a nonhydrogen substituent may or may not be present on a given atom, and, thus, the application includes structures wherein a non-hydrogen substituent is present and structures wherein a nonhydrogen substituent is not present.
- substituted refers to moieties having substituents replacing a hydrogen on one or more carbons, nitrogens, oxygens or sulfurs atoms. It will be understood that
- substitution or “substituted with” includes the implicit proviso that such substitution is in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, e.g., which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc.
- substituted is contemplated to include all permissible substituents of organic compounds.
- the permissible substituents include acyclic and cyclic, branched and unbranched, carbocyclic and heterocyclic, aromatic and non-aromatic substituents of organic compounds.
- the permissible substituents can be one or more and the same or different for appropriate organic compounds.
- the heteroatoms such as nitrogen may have hydrogen substituents and/or any permissible substituents of organic compounds described herein which satisfy the valences of the heteroatoms.
- Substituents can include any substituents described herein, for example, a halogen, a hydroxyl, a carbonyl (such as a carboxyl, an alkoxycarbonyl, a formyl, or an acyl), a thiocarbonyl (such as a thioester, a thioacetate, or a thioformate), an alkoxyl, an alkylthio, an acyloxy, a phosphoryl, a phosphate, a phosphonate, an amino, an amido, an amidine, an imine, a cyano, a nitro, an azido, a sulfhydryl, an alkylthio, a sulfate, a sulfonate, a
- monofluoroalkyl is alkyl substituted with a fluoro substituent
- difluoroalkyl is alkyl substituted with two fluoro substituents. It should be recognized that if there is more than one substitution on a substituent, each non-hydrogen substituent may be identical or different (unless otherwise stated).
- a carbon of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the carbon (to the extent there are any) can separately and/or together be replaced with an independently selected optional substituent.
- a nitrogen of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the nitrogen (to the extent there are any) can each be replaced with an independently selected optional substituent.
- One exemplary substituent can be depicted as -NR'R", wherein R' and R" together with the nitrogen atom to which they are attached, can form a heterocyclic ring.
- the heterocyclic ring formed from R' and R" together with the nitrogen atom to which they are attached can be partially or fully saturated.
- the heterocyclic ring consists of 3 to 7 atoms.
- the heterocyclic ring is selected from the group consisting of pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, isoxazolyl, pyridyl and thiazolyl.
- a group of substituents are collectively described as being optionally substituted by one or more of a list of substituents, the group can include: (1) unsubstitutable substituents, (2) substitutable substituents that are not substituted by the optional substituents, and/or (3) substitutable substituents that are substituted by one or more of the optional substituents.
- a substituent is described as being optionally substituted with up to a particular number of non-hydrogen substituents, that substituent can be either (1) not substituted; or (2) substituted by up to that particular number of non-hydrogen substituents or by up to the maximum number of substitutable positions on the substituent, whichever is less.
- a substituent is described as a heteroaryl optionally substituted with up to 3 non- hydrogen substituents, then any heteroaryl with less than 3 substitutable positions would be optionally substituted by up to only as many non-hydrogen substituents as the heteroaryl has substitutable positions.
- R are each independently selected from H, linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit (-OCH 2 CH 2 )n-R 104 , wherein n is an integer from 1 to 24, an aryl having from 6 to 10 carbon atoms, a heterocyclic ring having from 3 to 10 carbon atoms and a heteroaryl having 5 to 10 carbon atoms; and R 104 is H or a linear or branched alkyl having 1 to 4 carbon atoms, wherein the alkyl, alkenyl, alkynyl, aryl, heteroaryl and heterocyclcyl in the groups represented by R 100 , R 101 , R 102 , R 103 and R 104 are optionally substituted with one or more (e.g.
- substituents independently selected from halogen, -OH, -CN, -N0 2 and unsubstituted linear or branched alkyl having 1 to 4 carbon atoms.
- substituents for the optionally substituted alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above include halogen, -CN, -NR 102 R 103 , -CF 3 , -OR 101 , aryl, heteroaryl, heterocycycl, -SR 101 , -SOR 101 , -S0 2 R 101 and -S0 3 M.
- C x _ xx or "C x -C xx ", wherein x and xx are integers.
- Ci_ 4 alkyl or "C 1-C4 alkyl” is an alkyl group having from 1 to 4 carbon atoms.
- cytotoxic compound or "cytotoxic compound,” “cytotoxic dimer” and “cytotoxic dimer compound” are used interchangeably. They are intended to include compounds for which a structure or formula or any derivative thereof has been disclosed in the present invention or a structure or formula or any derivative thereof that has been incorporated by reference.
- the term also includes, stereoisomers, geometric isomers, tautomers, solvates, metabolites, salts (e.g. , pharmaceutically acceptable salts) and prodrugs, and prodrug salts of a compound of all the formulae disclosed in the present invention.
- the term also includes any solvates, hydrates, and polymorphs of any of the foregoing.
- conjugate refers to a compound described herein or a derivative thereof that is linked to a cell binding agent.
- linkable to a cell binding agent refers to the compounds described herein or derivatives thereof comprising at least one linking group or a precursor thereof suitable to bond these compounds or derivatives thereof to a cell binding agent.
- precursor of a given group refers to any group that can lead to that group by any deprotection, a chemical modification, or a coupling reaction.
- chiral refers to molecules that have the property of non-superimposability of the mirror image partner, while the term “achiral” refers to molecules that are
- stereoisomer refers to compounds that have identical chemical constitution and connectivity, but different orientations of their atoms in space that cannot be interconverted by rotation about single bonds.
- Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers can separate under high resolution analytical procedures such as crystallization, electrophoresis and chromatography.
- Enantiomers refer to two stereoisomers of a compound that are non- superimposable mirror images of one another.
- the compounds of the invention can contain asymmetric or chiral centers, and therefore exist in different stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of the invention, including but not limited to, diastereomers, enantiomers and atropisomers, as well as mixtures thereof such as racemic mixtures, form part of the present invention.
- optically active compounds i.e., they have the ability to rotate the plane of plane-polarized light.
- the prefixes D and L, or R and S are used to denote the absolute configuration of the molecule about its chiral center(s).
- the prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
- a compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another.
- a specific stereoisomer can also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
- a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which can occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
- the terms "racemic mixture” and “racemate” refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
- tautomer or "tautomeric form” refers to structural isomers of different energies that are interconvertible via a low energy barrier.
- proton tautomers also known as prototropic tautomers
- Valence tautomers include
- benzodiazepine is a compound having a
- the benzodiazepine core can be substituted or unsubstituted, and/or fused with one or more ring structures. It also includes a compound having two benzodiazepine core linked by a linker.
- a "pyrrolobenzodiazepine” (PBD) compound is a compound having a pyrrolobenzodiazepine core structure.
- the pyrrolobenzodiazepine can be substituted or unsubstituted. It also includes a compound having two pyrrolobenzodiazepine core linked by a linker.
- the pyrrolobenzodiazepine compound comprises a core
- the pyrrolobenzodiazepine compounds comprises a core
- a "indolinobenzodiazepine” (IGN) compound is a compound having an indolinobenzodiazepine core structure.
- the indolinobenzodiazepine can be substituted or unsubstituted. It also includes a compound having two indolinobenzodiazepine core linked by a linker.
- e compound comprises a core
- Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate,” ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (i.e.
- a pharmaceutically acceptable salt can involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
- the counter ion can be any organic or inorganic moiety that stabilizes the charge on the parent compound.
- a pharmaceutically acceptable salt can have more than one charged atom in its structure.
- a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
- the desired pharmaceutically acceptable salt can be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesulfonic acid
- an inorganic acid such as hydro
- the desired pharmaceutically acceptable salt can be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- suitable salts include, but are not limited to, organic salts derived from amino acids, such as glycine and arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- solvate means a compound that further includes a stoichiometric or non- stoichiometric amount of solvent such as water, isopropanol, acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine dichloromethane, 2- propanol, or the like, bound by non-covalent intermolecular forces.
- Solvates or hydrates of the compounds are readily prepared by addition of at least one molar equivalent of a hydroxylic solvent such as methanol, ethanol, 1-propanol, 2-propanol or water to the compound to result in solvation or hydration of the imine moiety.
- phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
- protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while reacting other functional groups on the compound, a derivative thereof, or a conjugate thereof.
- an "amine-protecting group” or an “amino-protecting moiety” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
- Such groups are well known in the art (see for example P. Wuts and T. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J.
- carbamates such as methyl and ethyl carbamate, FMOC, substituted ethyl carbamates, carbamates cleaved by l,6-P-elimination (also termed "self immolative"), ureas, amides, peptides, alkyl and aryl derivatives.
- Suitable amino-protecting groups include acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ) and 9- fluorenylmethylenoxycarbonyl (Fmoc).
- leaving group refers to an group of charged or uncharged moiety that departs during a substitution or displacement.
- leaving groups include, but not limited to, halogens, esters, alkoxy, hydroxyl, tosylates, triflates, mesylates, nitriles, azide, carbamate, disulfides, thioesters, thioethers and diazonium compounds.
- bifunctional crosslinking agent refers to modifying agents that possess two reactive groups; one of which is capable of reacting with a cell binding agent while the other one reacts with the cytotoxic compound to link the two moieties together.
- bifunctional crosslinkers are well known in the art (see, for example, Isalm and Dent in Bioconjugation chapter 5, p218-363, Groves
- SMCC N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l- carboxylate
- SIAB N-succinimidyl-4-(iodoacetyl)- aminobenzoate
- Other bifunctional crosslinking agents that introduce maleimido groups or haloacetyl groups on to a cell binding agent are well known in the art (see US Patent Applications 2008/0050310, 20050169933, available from Pierce Biotechnology Inc. P.O.
- Heterobifunctional crosslinking agents are bifunctional crosslinking agents having two different reactive groups. Heterobifunctional crosslinking agents containing both an amine-reactive N-hydroxysuccinimide group (NHS group) and a carbonyl-reactive hydrazine group can also be used to link the cytotoxic compounds described herein with a cell-binding agent (e.g. , antibody). Examples of such commercially available heterobifunctional crosslinking agents include succinimidyl 6-hydrazinonicotinamide acetone hydrazone (SANH), succinimidyl 4-hydrazidoterephthalate hydrochloride (SHTH) and succinimidyl hydrazinium nicotinate hydrochloride (SHNH). Conjugates bearing an acid-labile linkage can also be prepared using a hydrazine-bearing benzodiazepine derivative of the present invention. Examples of bifunctional crosslinking agents that can be used include
- succinimidyl-p-formyl benzoate (SFB) and succinimidyl-p-formylphenoxyacetate (SFPA).
- Bifunctional crosslinking agents that enable the linkage of cell binding agent with cytotoxic compounds via disulfide bonds are known in the art and include N-succinimidyl-3- (2-pyridyldithio)propionate (SPDP), N-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N- succinimidyl-4-(2-pyridyldithio)butanoate (SPDB), N-succinimidyl-4-(2-pyridyldithio)2- sulfo butanoate (sulfo-SPDB) to introduce dithiopyridyl groups.
- SPDP N-succinimidyl-3- (2-pyridyldithio)propionate
- SPP N-succinimidyl-4-(2-pyridyldithio)pentanoate
- SPDB N- succinimidyl-4-(
- crosslinking agents that can be used to introduce disulfide groups are known in the art and are disclosed in U.S. Patents 6,913,748, 6,716,821 and US Patent Publications 20090274713 and 20100129314, all of which are incorporated herein by reference.
- crosslinking agents such as 2-iminothiolane, homocysteine thiolactone or S-acetylsuccinic anhydride that introduce thiol groups can also be used.
- a “linker,” “linker moiety,” or “linking group” as defined herein refers to a moiety that connects two groups, such as a cell binding agent and a cytotoxic compound, together. Typically, the linker is substantially inert under conditions for which the two groups it is connecting are linked.
- a bifunctional crosslinking agent can comprise two reactive groups, one at each ends of a linker moiety, such that one reactive group can be first reacted with the cytotoxic compound to provide a compound bearing the linker moiety and a second reactive group, which can then react with a cell binding agent.
- one end of the bifunctional crosslinking agent can be first reacted with the cell binding agent to provide a cell binding agent bearing a linker moiety and a second reactive group, which can then react with a cytotoxic compound.
- the linking moiety can contain a chemical bond that allows for the release of the cytotoxic moiety at a particular site.
- Suitable chemical bonds are well known in the art and include disulfide bonds, thioether bonds, acid labile bonds, photolabile bonds, peptidase labile bonds and esterase labile bonds (see for example US Patents 5,208,020; 5,475,092; 6,441, 163; 6,716,821 ; 6,913,748; 7,276,497; 7,276,499; 7,368,565; 7,388,026 and 7,414,073).
- Preferred are disulfide bonds, thioether and peptidase labile bonds.
- Other linkers that can be used in the present invention include non-cleavable linkers, such as those described in are described in detail in U.S.
- amino acid refers to naturally occurring amino acids or non-naturally occurring amino acid.
- peptide refers to short chains of amino acid monomers linked by peptide (amide) bonds. In some embodiments, the peptides contain 2 to 20 amino acid residues. In other embodiments, the peptides contain 2 to 10 amino acid residus. In yet other embodiments, the peptides contain 2 to 5 amino acid residues. As used herein, when a peptide is a portion of a cytotoxic agent or a linker described herein represented by a specific sequence of amino acids, the peptide can be connected to the rest of the cytotoxic agent or the linker in both directions. For example, a dipeptide Xi-X 2 includes Xi-X 2 and X 2 -Xi.
- a tripeptide Xi-X 2 -X 3 includes Xi-X 2 -X 3 and X 3 -X 2 -Xi and a tetrapeptide Xi-X 2 - X 3 -X 4 includes Xi-X 2 -X 3 -X 4 and X 4 -X 2 -X 3 -Xi.
- Xi, X 2 , X 3 and X 4 represents an amino acid residue.
- cation refers to an ion with positive charge.
- the cation can be
- monovalent e.g. , Na + , K + , etc.
- bi-valent e.g. , Ca 2+ , Mg 2+ , etc.
- multi-valent e.g. , Al 3+ etc.
- the cation is monovalent.
- Cys engineered antibody includes an antibody with at least one cysteine (Cys) that is not normally present at a given residue of the antibody light chain or heavy chain.
- Cys which may also be referred to as “engineered Cys”
- engineered Cys can be introduced, for example, by standard recombinant technology (e.g. , by replacing the coding sequence for a non-Cys residue at the target residue with a coding sequence for Cys).
- the Cys engineered antibody of the invention has an engineered Cys in the heavy chain.
- the engineered Cys is in or near the CH3 domain of the heavy chain.
- the engineered Cys is at residue 442 of the heavy chain (EU/OU numbering).
- the C442 residue can be conjugated with a cytotoxic drug / agent through the free thiol group of the C442 residue, such as through reacting with a thiol-reactive agent of the cytotoxic drug (e.g. , a maleimido group).
- a cytotoxic drug / agent through the free thiol group of the C442 residue, such as through reacting with a thiol-reactive agent of the cytotoxic drug (e.g. , a maleimido group).
- an "aqueous solution” refers to a solution in which the solvent is water or a mixture of water and one or more organic solvents.
- treating includes reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in manner to improve or stabilize a subject's condition.
- treatment is an approach for obtaining beneficial or desired results, including clinical results.
- Beneficial or desired clinical results can include, but are not limited to, alleviation, amelioration, or slowing the progression, of one or more symptoms or conditions associated with a condition, e.g., cancer, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment. Exemplary beneficial clinical results are described herein.
- the present invention provides novel methods for preparing a cell-binding agent- cytotoxic agent conjugate comprising an imine-containing cytotoxic agent bearing a maleimide group covalently linked to a cell-binding agent (CBA).
- CBA cell-binding agent
- the methods of the present invention for preparing a cell- binding agent-cytotoxic agent conjugate comprise the steps of:
- a modified cytotoxic agent comprising a modified imine moiety represented by the following formula:
- the bisulfite salt is sodium bisulfite or potassium bisulfite. More specifically, the bisulfite salt is sodium bisulfite.
- the metabisulfite salt is sodium metabisulfite or potassium metabisulfite. More specifically, the metabisulfite salt is sodium metabisulfite.
- the present invention also provides a method of preparing a modified cytotoxic agent comprising the step of reacting an imine-moiety in an imine-containing cytotoxic agent represented by the following formula:
- a modified cytotoxic agent comprising a modified imine moiety represented by the following formula:
- the reaction can be carried out under the reaction conditions described in the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th or 7 th aspect below.
- the reaction of step (a) is carried out at a pH of 1.9 to 5.0. More specifically, the pH is 2.5 to 4.9, 1.9 to 4.8, 2.0 to 4.8, 2.5 to 4.5, 2.9 to 4.5, 2.9 to 4.0, 2.9 to 3.7, 3.1 to 3.5, or 3.2 to 3.4.
- the reaction of step (a) is carried out at a pH of 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9 or 5.0.
- the reaction of step (a) is carried out at a pH of 3.3.
- a specific pH value means the specific value + 0.05.
- the reaction of step (a) is carried out in the presence of a buffer solution.
- a buffer solution Any suitable buffer solution known in the art can be used in the methods of the present invention.
- Suitable buffer solutions include, for example, but are not limited to, a citrate buffer, an acetate buffer, a succinate buffer, a phosphate buffer, a glycine-containing buffer (e.g. , glycine-HCl buffer), a phthalate buffer (e.g. , a buffer solution comprising sodium or potassium hydrogen phthalate), and a combination thereof.
- the buffer solution is a succinate buffer.
- the buffer solution is a phosphate buffer.
- the buffer is a citrate-phosphate buffer.
- the buffer is a citrate-phosphate buffer comprising citric acid and Na 2 HP0 4 . In other embodiments, the buffer is a citrate-phosphate buffer comprising citric acid and K 2 HP0 4 . In some embodiments, the concentration of the buffer solution described above can be in the range of 10 to 250 mM, 10 to 200 mM, 10 to 150 mM, 10 to 100 mM, 25 to 100 mM, 25 to 75 mM, 10 to 50 mM, or 20 to 50 mM.
- the reaction step (a) is carried out in the absence of a buffer solution (e.g. , the buffers described in the 1 st aspect).
- the present method comprises the steps of: (a) reacting an imine-moiety in an imine-containing cytotoxic agent represented by formula (A) or a pharmaceutically acceptable salt thereof, with sulfur dioxide, a bisulfite salt or a metabisulfite salt in an aqueous solution to form a modified cytotoxic agent comprising a modified imine moiety represented by the following formula:
- aqueous solution does not comprise a buffer
- step (b) reacting the modified cytotoxic agent with a cell-binding agent to form the cell- binding agent-cytotoxic agent conjugate.
- the reaction of step (a) is carried out in a mixture of an organic solvent and water. More specifically, the reaction of step (a) is carried out in a mixture of dimethyacetamide (DMA) and water.
- the mixture of DMA and water comprises less than 60% of DMA by volume. Even more specifically, the volume ratio of DMA and water is 1 : 1.
- 0.5 to 5.0 equivalents of the bisulfite salt or 0.25 or 2.5 equivalents of the metabisulfite salt is used for every 1 equivalent of the imine-containing cytotoxic agent in the reaction of step (a).
- 1.4 equivalents of the bisulfite salt or 0.7 equivalent of the metabisulfite salt is used for every 1 equivalent of the imine-containing cytotoxic agent. In other embodiments, 1.2 equivalents of the bisulfite salt or 0.6 equivalent of the metabisulfite salt is used for every 1 equivalent of the imine-containing cytotoxic agent.
- a specific equivalent means the specific value + 0.05.
- the reaction of step (a) is carried out at a pH of 2.9 to 3.7 and 1.0 to 1.8 equivalents of the bisulfite salt or 0.5 to 0.9 equivalents of the metabisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the reaction of step (a) is carried out at a pH of 3.1 to 3.5 and 1.1 to 1.6 equivalents of the bisulfite salt or 0.55 to 0.8 equivalents of the
- the reaction of step (a) is carried out at a pH of 3.2 to 3.4 and 1.3 to 1.5 equivalents of the bisulfite salt or 0.65 to 0.75 equivalents of the metabisulfite is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the reaction of step (a) is carried out at a pH of 3.3 and 1.4 equivalents of the bisulfite salt or 0.7 equivalent of the metabisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the reaction of step (a) is carried out at a pH of 3.3 and 1.4 equivalents of sodium bisulfite is reacted with 1 equivalent of the imine- containing cytotoxic agent.
- the reaction of step (a) is carried out in a mixture of an organic solvent and water.
- organic solvents include, but are not limited to, alcohols (e.g. , methanol, ethanol, propanol, etc.), dimethylformamide (DMF), dimethylsulfoxide (DMSO), acetonitrile, acetone, methylene chloride, etc.
- the organic solvent is miscible with water. In other embodiments, the organic solvent is not miscible with water, i.e.
- the reaction of step (a) is carried out in a biphasic solution.
- the organic solvent is dimethylacetamide (DMA).
- the organic solvent e.g. , DMA
- the organic solvent can be present in the amount of l%-99%, 1-95%, 10-80%, 20- 70%, 30-70%, 1-60%, 5-60%, 10-60%, 20-60%, 30-60%, 40-60%, 45-55%, 10-50%, or 20- 40%, by volume of the total volume of water and the organic solvent.
- the reaction of step (a) is carried out in a mixture of DMA and water, wherein the volume ratio of DMA and water is 1 : 1.
- the reaction of step (a) can be carried out at any suitable temperature.
- the reaction is carried out at a temperature from 0 °C to 50 °C, from 10 °C to 50 °C, from 10 °C to 40 °C, or from 10 °C to 30 °C.
- the reaction is carried out at a temperature from 15 °C to 30 °C, from 20 °C to 30 °C, from 15 °C to 25 °C, from 16 °C to 24 °C, from 17 °C to 23 °C, from 18 °C to 22 °C or from 19 °C to 21 °C.
- the reaction can be carried out at 15 °C, 16 °C, 17 °C, 18 °C, 19 °C, 20 °C, 21 °C, 22 °C, 23 °C, 24 °C or 25 °C.
- the reaction can be carried out from 0 °C to 15 °C, from 0 °C to 10 °C, from 1°C to 10 °C, 5 °C to 15 °C, or from 5 °C to 10 °C.
- the reaction of step (a) is carried out for 1 minute to 48 hours, 5 minutes to 36 hours, 10 minutes to 24 hours, 30 minutes to 24 hours, 30 minutes to 20 hours, 1 hour to 20 hours, 1 hour to 15 hours, 1 hour to 10 hours, 2 hours to 10 hours, 3 hours to 9 hours, 3 hours to 8 hours, 4 hours to 6 hours, or 1 hour to 4 hours.
- the reaction is allowed to proceed for 4 to 6 hours.
- the reaction is allowed to proceed for 10 minutes, 15 minutes, 20 minutes, 30 minutes, 1 hours, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, etc. In other embodiments, the reaction is allowed to proceed for 4 hours. In yet other embodiments, the reaction is allowed to proceed for 2 hours.
- the reaction of step (b) is carried out at a pH of 4 to 9. In some embodiments, the reaction of step (b) is carried out at a pH of 4.5 to 8.5, 5 to 8.5, 5 to 8, 5 to 7.5, 5 to 7, 5 to 6.5, or 5.5 to 6.5.
- the reaction of step (b) is carried out at pH 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, or 8.0.
- the reaction of step (b) is carried out in an aqueous solution comprising a mixture of water and an organic solvent.
- aqueous solution comprising a mixture of water and an organic solvent.
- Any suitable organic solvent described above can be used. More specifically, the organic solvent is DMA.
- the aqueous solution comprises less than 50%, less than 40%, less than 30%, less than 25%, less than 20%, less than 15%, less than 10%, less than 5%, less than 3%, less than 2%, or less than 1% of the organic solvent (e.g. DMA) by volume.
- the modified cytotoxic agent is not purified before reacting with the cell-binding agent in step (b).
- the modified cytotoxic agent is purified before reacting with the cell-binding agent in step (b). Any suitable methods described herein can be used to purify the modified cytotoxic agent.
- the present invention provides isolated modified cytotoxic agent prepared by the present methods. The isolated modified cytotoxic agent can be stored for a period of time before reacting with the cell-binding agent.
- the isolated modified cytotoxic agent is stored under conditions that will prevent the decomposition of the modified cytotoxic agent, for example, as purified solid or as frozen solution or be kept at a low temperature (e.g., less than 10 °C or less than 5 °C).
- a low temperature e.g., less than 10 °C or less than 5 °C.
- the cell-binding agent-cytotoxic agent conjugate of step (b) is subject to a purification step.
- the cell-binding agent- cytotoxic agent conjugate can be purified from the other components of the mixture using tangential flow filtration (TFF), non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, selective precipitation, or any other suitable purification process, as well as combinations thereof.
- TMF tangential flow filtration
- the cell-binding agent-cytotoxic agent conjugate is purified using a single purification step (e.g. , TFF).
- the conjugate is purified and exchanged into the appropriate formulation using a single purification step (e.g. , TFF).
- the cell-binding agent cytotoxic agent conjugate is purified using two sequential purification steps.
- the conjugate can be first purified by selective precipitation, adsorptive filtration, absorptive chromatography or non-absorptive chromatography, followed by purification with TFF.
- purification of the cell-binding agent-cytotoxic agent conjugate enables the isolation of a stable conjugate comprising the cell-binding agent chemically coupled to the cytotoxic agent.
- TFF systems Any suitable TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, Mass.), a Sartocon Cassette system (Sartorius AG, Edgewood, N.Y.), and a Centrasette type system (Pall Corp., East Hills, N.Y.)
- Pellicon type system Millipore, Billerica, Mass.
- Sartocon Cassette system Sartorius AG, Edgewood, N.Y.
- Centrasette type system Pall Corp., East Hills, N.Y.
- Any suitable adsorptive chromatography resin may be utilized for purification.
- Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction chromatography (HIC), ion exchange chromatography, mixed mode ion exchange
- hydroxy apatite resins include ceramic hydroxy apatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif.), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, N.Y.), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif.).
- An example of a suitable HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, N.Y.).
- HIC resins examples include Butyl-Sepharose, Hexyl-Sepharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, N.J.), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratories, Hercules, Calif.).
- suitable ion exchange resins include SP- Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, N.J.), and Unosphere S resin (Bio-Rad Laboratories, Hercules, Calif.).
- suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg N.J.)
- suitable IMAC resins include Chelating Sepharose resin (GE Healthcare, Piscataway, N.J.) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, Calif.).
- Suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, N.J.) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, Calif.).
- suitable affinity resins include Protein A Sepharose resin (e.g. , MabSelect, GE Healthcare, Piscataway, N.J.), where the cell-binding agent is an antibody, and lectin affinity resins, e.g. Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, N.J.), where the cell-binding agent bears appropriate lectin binding sites.
- an antibody specific to the cell-binding agent may be used.
- Such an antibody can be immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway, N.J.).
- suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, Calif.).
- non-adsorptive chromatography resin Any suitable non-adsorptive chromatography resin may be utilized for purification.
- suitable non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G-25, G-50, G-100, SEPHACRYLTM resins (e.g. , S-200 and S-300),
- SUPERDEXTM resins e.g. , SUPERDEXTM 75 and SUPERDEXTM 200
- BIO-GEL ® resins e.g. , P-6, P-10, P-30, P-60, and P-100
- the purified cell-binding agent-cytotoxic agent conjugate is formulated into a suitable formulation buffer.
- the formulation buffer comprises a bisulfite salt, such as sodium bisulfite or potassium bisulfite. More specifically, the formulation buffer comprises sodium bisulfite.
- the formulation buffer comprises 5 to 200 ⁇ , 10 to 200 ⁇ , 10 to 150 ⁇ , 20 tolOO ⁇ , 30 to 90 ⁇ , 40 to 80 ⁇ , 50 to 70 ⁇ , 40 to 60 ⁇ , 45 to 55 ⁇ , or 55 to 65 ⁇ of the bisulfite salt (e.g. , sodium bisulfite).
- the formulation buffer comprises 20, 30, 40, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 70, 80, 90, or 100 ⁇ of the bisulfite salt (e.g. , sodium bisulfite).
- the bisulfite salt e.g. , sodium bisulfite
- the formulation buffer further comprises trehalose. Any suitable amount of trehalose can be used. In some embodiments, the formulation buffer further comprises 2 to 15 %, 5 to 10 %, 6 to 10% or 7 to 9% or 6 to 8% of trehalose by weight.
- the formulation buffer has a pH of 4 to 6, 4 to 5, or 4 to 4.5.
- the pH for the formulation buffer is 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5.0.
- the formulation buffer comprises 10 mM sodium succinate, 50 ⁇ sodium bisulfite, 8% trelose dihydrate and 0.01% polysorbate 20 at pH 4.2.
- the reaction of step (a) results in no substantial sulfonation of the maleimide group. In some embodiments, less than 50%, 40%, 30%, 20%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% of the maleimide group is sulfonated.
- the percentage of maleimide sulfonation is equal to the total amount of the maleimide- sulfonated cytotoxic agent (the cytotoxic agent having sulfonation on the maleimide only) and the di-sulfonated cytotoxic agent (the cytotoxic agent having sulfonation on both the maleimide and the imine moieties) divided by the starting amount of the imine-containing cytotoxic agent before its reaction with the bisulfite salt or the metabisulfite salt.
- the present invention provides a method of preparing a cell-binding agent-cytotoxic agent conjugate represented by the following formula:
- a modified cytotoxic agent represented b the following formula:
- Ab is an anti-CD 123 antibody comprising an immunoglobulin heavy chain having the amino acid sequence of SEQ ID NO: 25 and an immunoglobulin light chain having the amino acid sequence of SEQ ID NO:26;
- the method of the 9 aspect is carried out under reaction conditions described in the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , or 8 th aspect and any embodiments described therein.
- step (a) in the method of 9 th aspect is carried out at a pH of 3.2 to 3.4. More specifically, the pH is 3.3.
- the reaction of step (a) is carried out in the presence of a buffer solution.
- buffer solutions include, but are not limited to, a citrate buffer, an acetate buffer, a succinate buffer or a phosphate buffer. More specifically, the buffer is a succinate buffer.
- 1.1 to 1.6 equivalents of the bisulfite salt or 0.55 to 0.8 equivalents of the metabisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the remaining reaction conditions are as described above in the 10 th aspect and any embodiments described therein.
- 1.3 to 1.5 equivalents of the bisulfite salt or 0.65 to 0.75 equivalents of the metabisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent. More specifically, 1.4 equivalents of the bisulfite salt or 0.7 equivalents of the metabisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the reaction of step (a) in the method of 9 th aspect is carried out at a pH of 3.2 to 3.4 and 1.3 to 1.5 equivalents of the sodium bisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent. In some embodiments, the reaction is carried out at a pH of 3.3 and 1.4 equivalents of the sodium bisulfite salt is reacted with 1 equivalent of the imine-containing cytotoxic agent.
- the reaction of step (a) in the method of 9 th , 10 th , 11 th or 12 th aspect is carried out in a suitable solvent or solvent mixture.
- the reaction of step (a) is carried out in an aqueous solution comprising a mixture of water and an organic solvent. Any suitable organic solvent described above can be used. More specifically, the organic solvent is DMA.
- the aqueous solution comprises less than 50%, less than 40%, less than 30%, less than 25%, less than 20%, less than 15%, less than 10%, less than 5%, less than 3%, less than 2%, or less than 1% of the organic solvent (e.g. DMA) by volume.
- the reaction of step (a) is carried out at a suitable temperature, for example, at room temperature or at 15 to 25 °C, for a sufficient period time, such as 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 12 hours, 15 hours, 20 hours, 24 hours, 48 hours, etc.
- a suitable temperature for example, at room temperature or at 15 to 25 °C, for a sufficient period time, such as 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 12 hours, 15 hours, 20 hours, 24 hours, 48 hours, etc.
- the modified cytotoxic agent obtained from the reaction of step (a) is not purified before reacting with the cell-binding agent in step (b).
- the modified cytotoxic agent obtained from the reaction of step (a) is purified before reacting with the cell-binding agent in step (b). Any suitable
- the reaction of step (b) in the method of 9 th aspect is carried out at a pH of 5.5 to 6.5; and the remaining reaction conditions are as described in the 9 th , 10 th , 11 th or 12 th aspect.
- the pH is 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5.
- the pH is 6.0.
- the conjugate prepared by the methods of the 9 th , 10 th , 11 th , 12 th or 13 th aspect is purified by a suitable method described herein. In one embodiment, the conjugate is purified by tangential flow filtration to yield purified conjugate.
- the purified conjugate is formulated in a formulation buffer comprising 40 to 80 ⁇ of sodium bisulfite having a pH of 4 to 5.
- the formulation buffer comprises 50 ⁇ of sodium bisulfite having a pH of 4.2.
- the formulation buffer comprises 10 mM sodium succinate, 50 ⁇ sodium bisulfite, 8% trelose dihydrate and 0.01% polysorbate 20 at pH 4.2.
- the cell- binding agent is not an anti-CD 123 antibody.
- the cell- binding agent is not an anti-CD 123 antibody comprising an immunoglobulin heavy chain having the amino acid sequence of SEQ ID NO:25 and an immunoglobulin light chain having the amino acid sequence of SEQ ID NO:26.
- the cell-binding agent-cytotoxic agent conjugate prepared by the methods of the present invention described herein is not a conjugate represented by the following structure:
- Ab is an anti-CD 123 antibody comprising an immunoglobulin heavy chain having the amino acid sequence of SEQ ID NO: 25 and an immunoglobulin light chain having the amino acid sequence of SEQ ID NO:26;
- w 1 or 2.
- the imine-containing cytotoxic agent is represented by the following formula:
- cell-binding agent-cytotoxic agent conjugate is represented by the following formula:
- D 1V1 is the modified cytotoxic agent comprising the modified imine moiety represented by the following formula: or a pharmaceutically acceptable salt thereof;
- L is a linker;
- ° A represents the cell- binding agent linked to the cytotoxic agent via a thiol group; and
- w is an integer from 1 to 10.
- the CBA is an antibody and the antibody is linked to the cytotoxic agent via one or more cysteine thiol group.
- the free thiol group is on an engineered Cys residue in the heavy chain CH3 region of an antibody, at the EU/OU numbering position 442 of that heavy chain (or C442 for short). More specifically, the cysteine residue at position 442 is recombinantly introduced into the antibody.
- w is 1 or 2. More specifically, w is 2.
- D is represented by the following structural formula:
- Pi is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R x i is an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
- R e is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear, branched cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino (e.g.
- R 101 and R 102 are each independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms;
- R for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
- R' and R" are each independently selected from -H, -OH, -OR, -NHR, -NR 2 , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , and an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
- R c is -H or an optionally substituted linear or branched alkyl having 1 to 4 carbon atoms;
- n is an integer from 1 to 24;
- Xi' is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
- R 6 is -H, -R, -OR, -SR, -NR'R", -N0 2 , or halogen;
- G is -CH- or -N-;
- R5 for each occurrence is independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms.
- D is represented by formula (IGNT) or (IGN1).
- one of L', L" and L'" is represented by formula ( ⁇ ') or (D'), and the others are -H, an linear or branched alkyl having from 1 to 6 carbon atoms, halogen, -OH, (Ci-C6)alkoxy, or -N0 2 .
- L' is represented by formula (A'); and L" and L'" are both -H.
- L' is represented by formula (D'); and L" and L'" are both -H.
- R x i is a linear, branched or cyclic alkyl having 1 to 6 carbon atoms optionally substituted with halogen, -OH, -S0 3 H, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, halo(Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q.
- L' is represented by the following formula:
- R a and R b are each independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
- s is an integer from 1 to 6;
- si ' is 0 or an integer from 1 to 6;
- Cy is a cyclic alkyl having 5 or 6 ring carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (d-C 3 )alkoxy, or halo(Ci-C 3 )alkyl;
- R a and R b are both H; Cy in formulas ( ⁇ 2') and (C2') is cyclohexane; and R5 is H or Me. Even more specifically, s i ' is 0 or 1.
- Pi is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described in the 1 st or 2 nd specific aspect or any specific or more specific embodiments described therein.
- Pi is a peptide containing 2 to 5 amino acid residues.
- Pi is Gly-Gly-Gly, Ala-Val, Val-Cit, Val-Lys, Phe- Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe- N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 1), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 2), Gly-Phe- Leu-Gly (SEQ ID NO: 3), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D
- Xi' is selected from the group consisting of -H, -OH, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, and phenyl;
- Yi' is selected from the group consisting of -H, an oxo group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms; and the remaining variables are as described above in the 1 st , 2 nd , or 3 rd specific aspect or any specific or more specific embodiments described therein.
- Xi' is -H, -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl, or phenyl; and Yi' is -H, an oxo group, (Ci-C 3 )alkyl or halo(Ci-C 3 )alkyl.
- Xi' is -H, -OH or -Me; and Yi' is -H or oxo. Even more specifically, Xi' is -H; and Yi' is -H.
- R 6 is -OR, wherein R is an alkyl group having 1 to 6 carbon atoms; and the remaining variables are as described above in the 1 st , 2 nd , 3 rd , 4 th or 5 th specific aspect or any specific or more specific embodiments described therein. More specifically, R 6 is -OMe.
- R ls R 2 , R 3 , R 4 , Ri', R 2 ', R 3 ' and R 4 ' are each independently -H, halogen, -N0 2 , -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl or (Ci- C 3 )alkoxy; and the remaining variables are as described above in the 1 st , 2 nd , 3 rd , 4 th , 5 th or 6 th specific aspect or any specific or more specific embodiments described therein. More specifically, R ls R 2 , R 3 , R 4 , Ri', R 2 ', R 3 ' and R 4 ' are all -H.
- R, R', R" and R5 are each independently -H or (Ci-C 3 )alkyl; and the remaining variables are as described above in the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th or 7 th specific aspect or any specific or more specific embodiments described therein.
- Ri, R 2 , R 3 , R 4 , R 2 ', R 3 ' and R 4 ' are all -H;
- R 6 is -OMe
- a and A' are -0-;
- R, R', R" and R5 are each independently -H or (Ci-C 3 )alkyl. Even more specifically, R, R', R" and R5 are all -H.
- D is represented by the following structural formula:
- R 2 3 and R 24 are independently H or an optionally substituted alkyl
- n' is an integer between 0 and 10;
- R h' is H or an optionally substituted alkyl
- n' is an integer from 1 to 6. Even more specifically, m' is an integer from 1 to 3.
- R 23 and R 24 are independently H or a (Ci-C 3 )alkyl. Even more specifically, R 23 and R 24 are both H. In another specific embodiment, R ' is H or a (Ci-C3)alkyl. More specifically, R ' is
- R 23 and R 24 are both H; m' is an integer from 1 to 6. Even more specifically, m' is an integer from 1 to 3.
- si is the site covalently linked to D; s2 is the site covalently linked to the maleimide group; and the remaining variables are as described above for formula (A) or formula (B), or in the 1 st to 10 th specific aspect, or any specific or more specific embodiments described therein.
- the imine-containing cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- the imine-containing cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- D is re resented by the following structural formula:
- X' is selected from the group consisting of -H, -OH, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, phenyl, and an amine-protecting group;
- Y' is selected from the group consisting of -H, an oxo group, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
- a and A' are selected from -O- and -S-;
- R x is absent or selected from a linear, branched or cyclic alkyl having 1 to 10 carbon atoms;
- R e is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear, branched cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino (e.g. , -NHR 101 ) or tertiary amino (- NR 101 R 102 ) group or a 5- or 6-membered nitrogen containing heterocycle, wherein R 101 and
- R are each independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms;
- n is an integer from 1 to 24;
- G is selected from -CH- or -N-;
- R 6 is -H, -R, -OR, -SR, -NR'R" , -N0 2 , or halogen;
- R is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c , wherein n is an integer from 1 to 24, and R c is a linear or branched alkyl having 1 to 4 carbon atoms;
- R' and R" are each independently selected from -H, -OH, -OR, -NRR g , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted aryl having from 6 to 18 carbon atoms, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms selected from O, S, N and P, a PEG group -(CH 2 CH 2 0) n -R c , and R g is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c .
- D is represented by formula (IGN5') or (IGN5) above, or a pharmaceutically acceptable salt thereof.
- X' and Y' are both -H;
- a and A' are both -0-; R 6 is -OMe;
- R e is -H, a linear or branched alkyl having 1 to 4 carbon atoms or -(CH 2 -CH 2 - 0) n -R k , wherein R k is a -H, a linear or branched alkyl having 1 to 4 carbon atoms; n is an integer from 2 to 6; and
- R x is a linear or branched alkyl having 1 to 6 carbon atoms.
- D is represented by the following structural formula:
- sl is the site covalently linked to D, and s2 is the site covalently linked to the maleimide group;
- E is -(CRioRn) q -, cycloalkyl, or cycloalkylalkyl;
- p is an integer from 1 to 24;
- Q is H, a charged substituent, or an ionizable group
- R 9 , Rio, Rii, Ri 2 , and Ri 3 are independently H or an optionally substituted alkyl
- q and r for each occurrence, are independently an integer between 0 and 10; and the remaining variables are as described above for formula (A) or formula (B), or in 14 th or 15 th specific aspect or any specific or more specific embodiments described therein.
- q and r are independently an integer from 1 to 6, more specifically, 1 to 3.
- R 9 , Rio, Rn, Ri 2 , and Ri 3 are independently H or a Ci_ 3 alkyl. More specifically, R 9 , Rio, Rn, Ri 2 , and Ri 3 are all H.
- p is an integer from 2 to 14. More specifically, p is an integer from 2 to 8, 2 to 6 or 2 to 4.
- E is -(CRioRn) q -; and the remaining variables in formula (L2) are as described above in the 16 th specific as ect.
- E is and the remaining variables in formula (L2) are as described above in the 16 th specific aspect.
- Q is i) H; ii) -S0 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NR 14 R 15 , or -Z'-NRi 4 Ri 5 , or a pharmaceutically acceptable salt thereof; or, iii) -N + Ri 4 RisRi 6 X or -Z'-N + Ri 4 RisRi 6 X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; Ri 4 to Ri 6 are each independently an optionally substituted alkyl; and X " is a pharmaceutically acceptable anion; and the remaining variables in formula (L2) are as described above in the 16 th specific embodiment or any more specific embodiments described above
- Z' is an optionally substituted alkylene.
- Z' is a Ci_ 3 alkylene (e.g. , -C3 ⁇ 4); and Ri 4 to Ri 6 are each independently a Ci_ 4 alkyl.
- Q is H, or -SO 3 H, or a pharmaceutically acceptable cation (e.g. , sodium or potassium salt); and the remaining variables in formula (L2) are as described above in the 16 th specific aspect or any specific or more specific embodiments described above.
- a pharmaceutically acceptable cation e.g. , sodium or potassium salt
- R12 and Ri3, for each occurrence, are each independently H or (Ci-C 3 )alkyl
- Q is H or -S0 3 H or a pharmaceutically acceptable salt thereof
- R 9 is H or (Ci-C 3 )alkyl
- E is -(CRioRll)q-.
- Rio and Rn for each occurrence, are independently H or (Ci-C 3 )alkyl; and q and r are each an integer from 1 to 5.
- -L- is represented by any one of the following structural formulae:
- q and r are each independently an integer from 1 to 6; and the remaining variables are as described above for formula (A) or formula (B), or in 14 th or 15 th specific aspect or any specific or more specific embodiments described therein. More specifically, q and r are each independently an integer from 1 to 3.
- -L- is represented by any one of the following structural formulae:
- si is the site covalently linked to D, and s2 is the site covalently linked to the maleimide group; and the remaining variables are as described above for formula (A) or formula (B), or in 14' or 15 th specific aspect or any specific or more specific embodiments described therein.
- a pharmaceutically acceptable salt e.g. , sodium or potassium salt
- Ri9, R20, R21 and R 22 are independently H or an optionally substituted alkyl
- n are each independently an integer between 0 and 10;
- R h is H or an optionally substituted alkyl
- j is an integer from 1 to 24; and the remaining variables are as described above for formula (A) or formula (B), or the 14 th or 15 th specific aspect, or any specific or more specific embodiments described therein.
- R19, R 2 o, R21 and R 22 are each H or a (Ci- C 3 )alkyl; m and n are each independently an integer between 1 and 6; and the remaining variables are as described above in the 19 specific embodiment or any specific or more specific embodiment described therein. More specifically, R 9, R 2 o, R 2 i and R 22 are all H. Even more specifically, R19, R 2 o, R 2 i and R 22 are all H; and m and n are each independently an integer between 1 and 3.
- P L is an amino acid residue or a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described above in the 19 th or 20 th specific aspect or any specific or more specific embodiment described therein. More specifically, P L is a peptide containing 2 to 5 amino acid residues.
- each amino acid residue is the residue of an amino acid independently selected from: a naturally occurring amino acid, a synthetic amino acid, an amino acid analog, and an amino acid mimetic that functions in a manner similar to the naturally occurring amino acids.
- each amino acid residue is the residue of an amino acid independently selected from the group consisting of: Histidine, Alanine, Isoleucine, Arginine, Leucine, Asparagine, Lysine, Aspartic acid, Methionine, Cysteine, Phenylalanine, Glutamic acid, Threonine, Glutamine, Tryptophan, Glycine, Valine, Proline, Serine, Tyrosine, N- methyl-Histidine, N-methyl-Alanine, N-methyl-Isoleucine, N-methyl- Arginine, N-methyl- Leucine, N-methyl-Asparagine, N-methyl-Lysine, N-methyl-Aspartic acid, N-methyl- Methionine, N-methyl-Cysteine, N-methyl-Phenylalanine, N-methyl- Glutamic acid, N- methyl-Threonine, N-methyl-Glutamine, N-methyl-Tryptophan, N-methyl-methyl-methyl-
- each amino acid residue is the residue of an independently selected glycine or alanine.
- P L is a peptide cleavable by a protease. More specifically, P L is a peptide cleavable by a protease expressed in tumor tissue. Alternatively, P L is a peptide cleavable by a lysosomal protease.
- P L is selected from the group consisting of: Ala-Val, Val- Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp-Cit, Phe-Ala, Phe- N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 1), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 2), Gly-Phe-Leu-Gly (SEQ ID NO: 3), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val- D-Arg,
- P L is Gly- Gly-Gly, Ala- Ala- Ala, D-Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Val-Ala, or ⁇ -Ala-Gly-Gly-Gly.
- -L- is represented by the following structural formula: or a pharmaceutically acceptable salt thereof, wherein si is the site covalently linked to D; s2 is the site covalently linked to the maleimide group; and the remaining variables are as described above for formula (A) or formula (B), or in the 14 th or 15 th specific aspect.
- the imine-containing cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- the modified cytotoxic agent is represented by the following formula:
- modified cytotoxic agent is represented by the following formula:
- the imine-containing cytotoxic agent is represented by the following formula:
- D is an imine-containing PBD compound.
- D is represented by the following formula:
- Xi' is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
- Yi' is selected from -H, an oxo group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms;
- R 6 is -H, -R, -OR, -SR, -NR'R", -N0 2 , or halogen;
- R for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
- R' and R" are each independently selected from -H, -OH, -OR, -NHR, -NR 2 , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , and an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
- R c is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4 carbon atoms, or the linking group with the reactive group bonded thereto;
- n is an integer from 1 to 24;
- R5 for each occurrence is independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms;
- Do and Do' are the same or different, and are independently absent or selected from the group consisting of an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a peptide bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH 2 )n-;
- L is absent, a linker, a polyethylene glycol unit (-OCH 2 CH 2 ) n -, an optionally substituted linear, branched or cyclic alkyl or alkenyl having 1 to 10 carbon atoms, an optionally substituted phenyl group, an optionally substituted 3 to 18-membered heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
- Ar and Ar' are each independently absent, or represent an aryl group
- R c is absent or selected from linear or branched alkyl, alkenyl or alkynyl having 1 to 5 carbon atoms.
- D is selected from one of the following:
- one of L ⁇ L" , and L' " in formula (PBD5'), (PBD6'), (PBDV), (PBD8'), (PBD5), (PBD6), (PBD7) or (PBD8) is represented by the following formula:
- Pi is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R x i is an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
- R e is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear, branched cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino (e.g. , -NHR 101 ) or tertiary amino (- NR 101 R 102 ) group or a 5- or 6-membered nitrogen containing heterocycle, wherein R 101 and
- R are each independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms;
- R c is -H or an optionally substituted linear or branched alkyl having 1 to 4 carbon atoms; R5 for each occurrence is independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms.
- R a " and R b " are the same or different, and are selected from -H and -Me; and n' is selected from 0, 1, 2 and 3; and the remaining variables are as described in the 25 th specific aspect.
- one of L ⁇ L" and L'" in formula (PBD5'), (PBD6'), (PBD7'), (PBD8'), (PBD5), (PBD6), (PBD7) or (PBD8) is represented by formula ( ⁇ ') or (D') and the other two are -H, an linear or branched alkyl having from 1 to 6 carbon atoms, halogen, -OH, (d-C 6 )alkoxy or -N0 2 ; or one of Q 2 and Q 2 ' in formula (PBD9'), (PBD10'), (PBD9) or (PBD10) is represented by formula ( ⁇ '), (D') or (E'); and the other is -H, an linear or branched alkyl having from 1 to 6 carbon atoms, halogen, -OH, (Ci-C6)alkoxy or - N0 2 ; and the remaining variables are as described in the 26 th specific aspect.
- L" and L'" are both -H; and L' in formula (PBD5'), (PBD6'), (PBD7'), (PBD8'), (PBD5), (PBD6), (PBD7) or (PBD8) is represented by the following formula:
- R a and R b are each independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
- s is an integer from 1 to 6;
- si' is 0 or an integer from 1 to 6;
- Cy is a cyclic alkyl having 5 or 6 ring carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, or halo(Ci-C 3 )alkyl; and the remaining variables are as described in the 27 specific aspect.
- R a and 3 ⁇ 4 are both H; Cy in formulas ( ⁇ 2') and (C2') is cyclohexane; R5 is H or Me; and si' is 0 or 1.
- Pi is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described in the 28 th specific aspect.
- Pi is a peptide containing 2 to 5 amino acid residues.
- Pi is Gly-Gly-Gly, Ala- Val, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 1), ⁇ -Ala-Leu-
- R 6 is -OMe; Xi' and Yi' are both -H; and A and A' are -0-.
- D is represented by the following structural formula:
- R 2 3 and R 24 are independently H or an optionally substituted alkyl
- n' is an integer between 0 and 10;
- R h' is H or an optionally substituted alkyl; and the remaining variables are as describe above in the 25 th , 26 th , 27 th , 28 th , 29 th , 30 th , 31 st or 32 nd specific aspect.
- R 23 and R 24 are both H; and m' is an integer between 1 and 6.
- R h ' is H.
- L is re resented by the following structural formula:
- the imine-containing cytotoxic agent is represented by the following formula:
- the imine-containing cytotoxic agent is represented by the following formula:
- the modified imine-containing cytotoxic agent is represented by the following formula:
- D is represented by the following formula:
- Xi' is selected from the group consisting of -H, -OH, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, phenyl, and an amine-protecting group;
- Yi' is selected from the group consisting of -H, an oxo group, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
- R x is absent or selected from a linear, branched or cyclic alkyl having 1 to 10 carbon atoms;
- R e is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear, branched cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino (e.g. , -NHR 101 ) or tertiary amino (- NR 101 R 102 ) group or a 5- or 6-membered nitrogen containing heterocycle, wherein R 101 and
- R are each independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms;
- n is an integer from 1 to 24;
- R 6 is -H, -R, -OR, -SR, -NR'R" , -N0 2 , or halogen;
- R is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c , wherein n is an integer from 1 to 24, and R c is a linear or branched alkyl having 1 to 4 carbon atoms;
- R' and R" are each independently selected from -H, -OH, -OR, -NRR g , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted aryl having from 6 to 18 carbon atoms, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms selected from O, S, N and P, a PEG group -(CH 2 CH 2 0) n -R c , and R g is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c .
- Xi' and Yi' are both -H;
- R 6 is -OMe
- R e is -H, a linear or branched alkyl having 1 to 4 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear or branched alkyl having 1 to 4 carbon atoms;
- n is an integer from 2 to 6;
- R x is a linear or branched alkyl having 1 to 6 carbon atoms; and the remaining variables are as described in the 35 th specific aspect.
- L is re resented by the following structural formula:
- si is the site covalently linked to D, and s2 is the site covalently linked to the maleimide group;
- E is -(CRioRn)q-, cycloalkyl, or cycloalkylalkyl;
- p is an integer from 1 to 24;
- Q is H, a charged substituent, or an ionizable group
- R 9 , Rio, Ru, Ri 2 , and Ri 3 are independently H or an optionally substituted alkyl
- q and r for each occurrence, are independently an integer between 0 and 10; and the remaining variables are as described in the 35 th or 36 th specific aspect.
- E is -(CRioRn) q -.
- R 9 is -H.
- R 9 , Rio, Ru, Ri 2 , and Ri 3 are all H; and q and r are each independently an integer between 1 and 6.
- Ri 2 and Ri 3 are each independently H or (Ci-C 3 )alkyl;
- Q is H or -S0 3 H or a pharmaceutically acceptable salt thereof
- R 9 is H or (Ci-C 3 )alkyl
- E is -(CRioRll)q-.
- L is represented by the following structural formula:
- Ri9, R20, R21 and R22, for each occurrence, are independently H or an optionally substituted alkyl
- n are each independently an integer between 0 and 10;
- R h is H or an optionally substituted alkyl
- j is an integer from 1 to 24; and the remaining variables are as described in the 35 th or 36 th specific aspect.
- R19, R20, R21 and R22 are each H; and m and n are each independently an integer between 1 and 6.
- PL is a peptide containing 2 to 10 amino acid residues. More specifically, PL is a peptide containing 2 to 5 amino acid residues. Even more specifically, PL is selected from the group consisting of: Ala-Val, Val-Ala, Val-Cit, Cit-Val.
- Val-Lys Phe- Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp-Cit, Phe-Ala, Phe-N -tosyl-Arg, Phe- N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 1), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 2), Gly-Phe- Leu-Gly (SEQ ID NO: 3), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D-Val-Lys, D- Val-Arg, D-Val-D-C
- L is represented by the following structural formula: or a pharmaceutically acceptable salt thereof.
- the imine-containing cytotoxic agent is represented by the following formula:
- R is a C3- 12 alkylene group
- each X' for each occurrence, is independently -0-, -S- or -N(H)-
- each R 2' is independently selected from -H, -OH, -CN, -R 1' , -OR 1' , -O-SO 2 -R 1 , - CO 2 R 1' , -COR 1 ' or halo;
- R 4b is a leaving group selected from -OR 6' , -OCOR 4' , -OCOOR 4' , -OCONR 4 R 5' , - NR 4 R 5 , -NR 4 COR 5 , -NR 4 NR 4 R 5 , an optionally substituted 5- or 6-membered nitrogen- containing heterocycle (e.g.
- R L is linker bearing a maleimide moiety that can form a covalent bond with a cell binding agent (CBA);
- R 6 and R 9 are independently selected from -H, -R 1' , -OH, -OR 1 ' , -SH, -SR 1' , -NH 2 , - NHR 1' , -NR 1 R 3 , -NO 2 , Me 3 Sn and halo; and,
- R and R 3 are each independently selected from optionally substituted Ci_i 2 alkyl, C 3 _
- R together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring; or any pair of adjacent groups from R 6 to R 9 together form a group -0-(CH 2 ) p -0-, where p is 1 or 2;
- R 4' and R 5' are each independently selected from -H, -OH, -OR 6' , -NHR 6' , -NR 6 2 , -COR 6 , an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R b , or an optionally substituted 3- 18-membered heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N or P;
- R 6 for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R b , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally
- R a is independently selected from -R 1' , -C0 2 R r , -COR 1' , -CHO, -C0 2 H, or halo;
- R b is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4 carbon atoms;
- M is H or a pharmaceutically acceptable cation
- n is an integer from 1 to 24.
- the imine-containing cytotoxic agent is represented by the following formula:
- R 3" is a C3_salkylene; and the remaining variables are as described above in the 40 th specific aspect.
- L 1 is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described above in the 42 nd specific aspect. More specifically, L 1 is a peptide containing 2 to 5 amino acid residues.
- L 1 is selected from the group consisting of Phe-Lys, Val- Ala, Val-Lys, Ala-Lys, Val-Cit, Phe-Cit, Leu-Cit, Ile-Cit, Phe-Arg, Trp-Cit, Lys-Lys, Phe- Ala, Phe-N9-tosyl-Arg, Phe-N9-nitro-Arg, Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D- Lys, Val-D-Arg, D- Val-Cit, D- Val-Lys, D- Val-Arg, D-Val-D-Cit, D-Val-D-Lys, D-Val-D- Arg, D-Arg-D-Arg, Gly-Gly-Gly, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, He- Ala-
- A is represented by one of the following:
- p is 4 to 6; r is 1; and s is 1 to 10.
- the imine- containing cytotoxic agent is represented by the following formula:
- the modified imine-containing cytotoxic agent is re resented by the following formula:
- s is 2 to 8; w is 1 or 2; and CBA is a cell-binding agent described herein. In some embodiments, s is 7.
- the imine- containing cytotoxic agent is represented by the following formula:
- the modified imine-containing cytotoxic agent represented by the following formula:
- s is 2 to 8; w is 1 or 2; and CBA is a cell-binding agent described herein. In some embodiments, s is 7.
- the imine- containing cytotoxic agent is represented by the following formula:
- the modified imine-containing cytotoxic agent is represented by the following formula:
- s is 2 to 8; w is 1 or 2; and CBA is a cell-binding agent described herein. In some embodiments, s is 7.
- the imine- containin cytotoxic agent is represented by the following formula:
- the modified imine-containing cytotoxic agent is represented by the following formula:
- s is 2 to 8; w is 1 or 2; and CBA is a cell-binding agent described herein. In some embodiments, s is 7.
- the charged substituent or an ionizable group Q described in any embodiments above is i) -S0 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRiiP i 2 , or -Z'-NRnRi 2 , or a pharmaceutically acceptable salt thereof; or, ii) -N + Ri 4 Ri 5 Ri 6 X or -Z'-N + Ri 4 RisRi 6 X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; Ri 4 to Ri 6 are each independently an optionally substituted alkyl; and X " is a pharmaceutically acceptable anion. More specifically, Q is -S0 3 H or a pharmaceutically acceptable
- the cell-binding agent can be used in the present methods is an antibody having an engineered cysteine residue (e.g. , at the EU/OU numbering position 442 of the heavy chain(s)).
- the engineered Cys residue can be located on one or both heavy chains of the antibody, or on one or both light chains of the antibody, or antigen-binding portion thereof, or a combination thereof.
- the Cys residue is located at the EU/OU numbering position 442 of the antibody heavy chain(s).
- the antibody is a cysteine engineered antibody as described herein.
- the antibody of the present invention is a monoclonal antibody, a chimeric antibody, a humanized antibody, a resurfaced antibody, or a human antibody.
- the cell-binding agent is an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, a monoclonal antibody fragment (or "antigen-binding portion") that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment (or "antigen-binding portion") that specifically binds to the target cell, a domain antibody (e.g. , sdAb), or a domain antibody fragment that specifically binds to the target cell.
- the cell-binding agent is a humanized antibody, a humanized single chain antibody, or a humanized antibody fragment (or "antigen-binding portion").
- the humanized antibody is huMy9-6 or another related antibody, which is described in U.S. Pat. Nos. 7,342,110 and 7,557,189.
- the humanized antibody is an anti-folate receptor antibody described in U.S. Pat. No. 8,557,966.
- the humanized antibody is an anti-CD 123 antibody described in U.S. Application No. 15/195,401, filed on June 28, 2016, entitled "ANTI-CD 123 ANTIBODIES AND CONJUGATES AND DERIVATIVES THEREOF.” The teachings of all these applications are incorporated herein by reference in its entirety.
- the cell-binding agent is a resurfaced antibody, a resurfaced single chain antibody, a resurfaced antibody fragment (or "antigen-binding portion"), or a bispecific antibody.
- a recombinant antibody comprising a mature processed sequence of the heavy chain, light chain, or antigen-binding portion thereof, derived from any one of the subject recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein.
- the recombinant antibody may be or may comprise an scFv-Fc, Fcab, mAb2, small modular immunopharmaceutical (SMIP), Genmab / unibody or duobody, minibody, IgGACH2, DVD-Ig, probody, intrabody, or a multispecificity antibody.
- a DUOBODY is a bispecific modified IgGl antibody heterodimer.IgGl hinge region that generally includes (i) a stable hinge region that contains a CPPC sequence and is non-permissive for Fab arm exchange in vivo and (ii) an IgG4-like CH3 domain that is modified to contain F405L and K409R residues, which renders it permissive for Fab arm exchange in vivo. (See, for example, WO2008119353 and WO2011131746).
- the recombinant antibody may comprise 1, 2, 3, or 4 of the mature processed sequence of the heavy chain, light chain, or antigen-binding portion thereof, each derived from any one of the subject recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein.
- the recombinant antibody may be a heterodimeric antibody comprising a first heavy chain polypeptide and a second heavy chain polypeptide, wherein the Fc region of the first heavy chain polypeptide and the Fc region of the second heavy chain polypeptide meet at an interface, and the interface of the Fc region of the second heavy chain polypeptide comprises a protuberance which is positionable in a cavity in the interface of the Fc region of the first heavy chain polypeptide.
- knob-into-hole technology to promote specific pairing of heavy chains in the bi- specific antibody may be further improved based on, for example, the CrossMab technology of Genentech / Roche, e.g., by swapping CHI and Kappa constant regions to further reduce or eliminate light chain mis-pairing.
- LC heterodimers such as Zymeworks AZYMETRICTM heterodimeric IgGl light chain platform technology that fully complements multiple other biologies approaches, including common light chain, domain antibody, and single chain formats, in the development of fully bi- specific antibodies.
- the Fc region of the second heavy chain polypeptide has been altered from a template/original polypeptide to encode the protuberance, or the Fc region of the first heavy chain polypeptide has been altered from a template/original polypeptide to encode the cavity, or both.
- the protuberance and the cavity each comprises a naturally occurring amino acid residue.
- the Fc region of the second heavy chain polypeptide comprising the protuberance is generated by replacing an original residue from the interface of a template/original polypeptide with an import residue having a larger side chain volume than the original residue.
- the Fc region of the second heavy chain polypeptide comprising the protuberance is generated by a method comprising a step wherein nucleic acids encoding an original residue from the interface of said polypeptide is replaced with nucleic acids encoding an import residue having a larger side chain volume than the original.
- the antibody includes bispecific, multispecific, and
- monospecific antibody variants that include the antigen bind regions and the heavy chain constant domain, wherein the heavy chain constant domain is modified to include a Cys at position 442 of the EU/OU numbering.
- the antibody may bind to a ligand on the target cell, such as a cell-surface ligand, including cell-surface receptors.
- Specific exemplary antigens or ligands may include renin; a growth hormone (e.g. , human growth hormone and bovine growth hormone); a growth hormone releasing factor; a parathyroid hormone; a thyroid stimulating hormone; a lipoprotein; alpha- 1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; a follicle stimulating hormone; calcitonin; a luteinizing hormone; glucagon; a clotting factor (e.g. , factor vmc, factor IX, tissue factor, and von WiUebrands factor); an anti-clotting factor (e.g.
- a growth hormone e.g. , human growth hormone and bovine growth hormone
- a growth hormone releasing factor e.g., a parathyroid hormone; a thyroid stimulating hormone; a lipoprotein; alpha- 1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; a follicle stimulating hormone; calciton
- plasminogen activator e.g. , a urokinase, a human urine or tissue-type plasminogen activator
- bombesin e.g. , bombesin
- a thrombin e.g. , hemopoietic growth factor; tumor necrosis factor- alpha and -beta; an enkephalinase
- RANTES i.e.
- human macrophage inflammatory protein- 1 -alpha a serum albumin (human serum albumin); Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; a mouse gonadotropin-associated peptide; a microbial protein (beta- lactamase); DNase; IgE; a cytotoxic T-lymphocyte associated antigen (e.g. , CTLA-4);
- vascular endothelial growth factor a receptor for hormones or growth factors; protein A or D; a rheumatoid factor; a neurotrophic factor(e.g. , bone-derived neurotrophic factor, neurotrophin-3, -4, -5, or -6), a nerve growth factor (e.g. , NGF- ⁇ ); a platelet-derived growth factor; a fibroblast growth factor (e.g. , aFGF and bFGF); fibroblast growth factor receptor 2; an epidermal growth factor; a transforming growth factor (e.g.
- TGF-alpha TGF- ⁇ ⁇ , TGF- 2, TGF- 3, TGF- 4, and TGF- 5
- insulin-like growth factor-I and -II des(l-3)-IGF-I (brain IGF-I); an insulin-like growth factor binding protein
- melanotransferrin EpCAM; GD3; FLT3; PSMA; PSCA; MUC1 ; MUC16; STEAP; CEA; TENB2; an EphA receptor; an EphB receptor; a folate receptor; FOLR1 ; mesothelin; cripto; an alpha v beta 6 ; integrins; VEGF; VEGFR; EGFR; transferrin receptor; IRTA1 ; IRTA2;
- IRTA3; IRTA4; IRTA5; CD proteins e.g. , CD2, CD3, CD4, CD5, CD6, CD8, CDl l, CD14, CD19, CD20, CD21, CD22, CD25, CD26, CD28, CD30, CD33, CD36, CD37, CD38, CD40, CD44, CD52, CD55, CD56, CD59, CD70, CD79, CD80.
- erythropoietin an osteoinductive factor; an immunotoxin; a bone morphogenetic protein; an interferon (e.g. , interferon- alpha, -beta, and - gamma); a colony stimulating factor (e.g. , M-CSF, GM-CSF, and G-CSF); interleukins (e.g. , IL- 1 to IL- 10); a superoxide dismutase; a T-cell receptor; a surface membrane protein; a decay accelerating factor; a viral antigen (e.g.
- a portion of the HIV envelope a transport protein, a homing receptor; an addressin; a regulatory protein; an integrin (e.g. , CD1 la, CDl lb, CDl lc, CD18, an ICAM, VLA-4, and VCAM;) a tumor associated antigen (e.g. , HER2, HER3 and HER4 receptor); endoglin; c-Met; c-kit; 1GF1R; PSGR; NGEP; PSMA; PSCA; TMEFF2; LGR5; B7H4; and fragments of any of the above-listed polypeptides.
- an integrin e.g. , CD1 la, CDl lb, CDl lc, CD18, an ICAM, VLA-4, and VCAM
- a tumor associated antigen e.g. , HER2, HER3 and HER4 receptor
- endoglin c-Met; c-kit; 1GF1R; PSGR; NGEP
- the cell-binding agent is an anti-folate receptor antibody.
- the anti-folate receptor antibody is a humanized antibody that specifically binds a human folate receptor 1, wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYFMN (SEQ ID NO: 4); a heavy chain CDR2 comprising
- RIHP YD GDTF YNQXaa i FXaa 2 Xaa 3 (SEQ ID NO: 5); and a heavy chain CDR3 comprising YDGSRAMDY (SEQ ID NO: 6); and (b) a light chain CDR1 comprising
- KASQSVSFAGTSLMH (SEQ ID NO: 7); a light chain CDR2 comprising RASNLEA (SEQ ID NO: 8); and a light chain CDR3 comprising QQSREYPYT (SEQ ID NO: 9); wherein Xaai is selected from K, Q, H, and R; Xaa 2 is selected from Q, H, N, and R; and Xaa 3 is selected from G, E, T, S, A, and V.
- the heavy chain CDR2 sequence comprises RIHP YD GDTF YNQKFQG (SEQ ID NO: 10).
- the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of
- the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the light chain having the amino acid sequence of
- the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of SEQ ID NO: 11, and the light chain having the amino acid sequence of SEQ ID NO: 12 or SEQ ID NO: 13.
- the antibody comprises the heavy chain having the amino acid sequence of SEQ ID NO: 11 and the light chain having the amino acid sequence of SEQ ID NO: 13 (huMov l9).
- the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof comprising an engineered Cys residue (e.g. , C442) and a heavy chain variable domain at least about 90%, 95%, 99% or 100% identical to
- QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHPYDG DTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDYWGQG TTVTVSS (SEQ ID NO: 14), and a light chain variable domain at least about 90%, 95%, 99% or 100% identical to DIVLTQS PLS LAVS LGQP AIIS CKAS QS VS FA GTS LMHW YHQKPGQQPRLLIYRAS NL EAGVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKR (SEQ ID NO: 15); or
- the humanized antibody is huMy9-6 or another related antibody, which is described in U.S. Pat. Nos. 7,342, 110 and 7,557, 189.
- the humanized antibody is an anti-folate receptor antibody (e.g., huMovl9) described in U.S. Patent No. 8,577,966.
- the humanized antibody is an anti-CD37 antibody (e.g., anti-CD37-3) described in U.S. Patent No. 8,765,917.
- the humanized antibody is an anti-EGFR antibody described in U.S. Patent No. 8,790,649. In other embodiments, the antibody is an anti-EGFR antibody.
- the anti-EGFR antibody is a non-antagonist antibody, including, for example, the antibodies described in WO2012058592, herein incorporated by reference.
- the anti-EGFR antibody is a non-functional antibody, for example, humanized ML66. More specifically, the anti-EGFR antibody is huML66.
- the antibody is an anti-CD 123 antibody, such as a humanized huCD123 antibody as described in U.S. Application No. 15/195,401, filed on June 28, 2016, entitled "ANTI-CD123 ANTIBODIES AND CONJUGATES AND DERIVATIVES
- the anti-CD 123 antibody the antibody or antigen -binding fragment thereof comprises: a) at least one heavy chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, CDR1 has the sequence of SSEVIH (SEQ ID NO: 17), CDR2 has the sequence of YIKPYNDGTKYNEKFKG (SEQ ID NO: 18), and, CDR3 has the sequence of EGGNDYYDTMDY (SEQ ID NO: 19); and b) at least one light chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, CDR1 has the sequence of
- RASQDINSYLS (SEQ ID NO:20)
- CDR2 has the sequence of RVNRLVD (SEQ ID NO:21)
- CDR3 has the sequence of LQYDAFPYT (SEQ ID NO:22).
- the anti-CD 123 antibody or antigen-binding fragment thereof comprises an engineered Cys residue (e.g. , C442); an immunoglobulin heavy chain variable domain at least about 90%, 95%, 99% or 100% identical to QXQLVQS G AE VKKPG AS VKVS CKAS G YIFTS S UVIHW VRQ APGQGLE WIG YIKP YND GTKYNEKFKGRATLTSDRSTSTAYMELSSLRSEDTAVYYCAREGGNDYYDTMDYW GQGTLVTVSS (SEQ ID NO:23); and an immunoglobulin light chain variable region having the amino acid sequence at least about 90%, 95%, 99% or 100% identical to
- Xaa the second residue from the N-terminus of SEQ ID NO: 23, is Phe. In other embodiments, Xaa is Val.
- the anti-CD 123 antibody or antigen-binding fragment thereof may comprise: an immunoglobulin heavy chain region having the amino acid sequence of Q VQLVQS GAE VKKPG AS VKVS CKAS G YIFTS S UVIHW VRQ APGQGLE WIG YIKP YND GTKYNEKFKGRATLTSDRSTSTAYMELSSLRSEDTAVYYCAREGGNDYYDTMDYW GQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT S G VHTFP A VLQS S GLYS LS S V VT VPS S S LGTQT YICN VNHKPS NTKVDKKVEPKS CD KTHTCPPCP APELLGGPS VFLFPPKPKDTLMIS RTPE VTC V V VD VS HEDPE VKFNW Y V DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
- the present invention also includes the cell-binding agent-cytotoxic agent conjugates prepared by any methods of the present invention, a composition ⁇ e.g. , a pharmaceutical composition) comprising the cell-binding agent-cytotoxic agent conjugates prepared by any methods of the present invention and a carrier (a pharmaceutically acceptable carrier).
- the present conjugates and compositions are useful for inhibiting abnormal cell growth or treating a proliferative disorder in a mammal ⁇ e.g. , human).
- the present invention includes a method of inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g. , human) comprising administering to said mammal a therapeutically effective amount of the conjugates prepared by the methods of the present invention described above or a
- composition thereof alone or in combination with a second therapeutic agent.
- the proliferative disorder is cancer.
- Cancer can include a hematological cancer or a solid tumor. More specifically, the cancer is leukemia (e.g., acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL) such as acute B
- leukemia e.g., acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL) such as acute B
- B-ALL lymphoblastic leukemia
- CML chronic myelogenous leukemia
- CLL chronic lymphocytic leukemia
- lymphoma melanoma
- lung cancer e.g. , non-small cell lung cancer
- ovarian cancer endometrial cancer, peritoneal cancer, pancreatic cancer, breast cancer, prostate cancer, and cervical cancer.
- the present invention also provides methods of treatment comprising administering to a subject in need of treatment an effective amount of any of the conjugates described above.
- the present invention provides a method for inducing cell death in selected cell populations comprising contacting target cells or tissue containing target cells with an effective amount of a cytotoxic agent comprising any of the conjugates described above.
- the target cells are cells to which the cell-binding agent can bind.
- other active agents such as other anti-tumor agents, may be administered along with the conjugate.
- Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of ordinary skill in the art as the clinical situation warrants.
- suitable carriers, diluents and/or excipients include: (1) Dulbecco' s phosphate buffered saline, pH about 7.4, containing or not containing about 1 mg/mL to 25 mg/mL human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose; and may also contain an antioxidant such as tryptamine and a stabilizing agent such as Tween 20.
- Example 2 was subsequently introduced into a 50 mM potassium phosphate pH 6.0 solution containing 10 g of anti-CD 123 antibody with reduced C442 engineered cysteine residues. At a final concentration of 2 mg/mL antibody and 15 v/v% DMA, the conjugation reaction was allowed to proceed for 18 h at 25 °C. SEC analysis of the reaction product gives ADC with a DAR (drug to antibody ratio) of 1.9 and a %HMW (percentage of high molecule weight species) of 4.4% vs. 3.7% prior to conjugation.
- DAR drug to antibody ratio
- %HMW percentage of high molecule weight species
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3044391A CA3044391A1 (en) | 2016-11-23 | 2017-11-22 | Selective sulfonation of benzodiazepine derivatives |
| JP2019527831A JP7203729B2 (ja) | 2016-11-23 | 2017-11-22 | ベンゾジアゼピン誘導体の選択的スルホン化 |
| CN202310731029.6A CN116813690A (zh) | 2016-11-23 | 2017-11-22 | 苯并二氮䓬衍生物的选择性磺化 |
| KR1020237030171A KR20230133935A (ko) | 2016-11-23 | 2017-11-22 | 벤조다이아제핀 유도체의 선택적인 설폰화 |
| RU2019118808A RU2773881C2 (ru) | 2016-11-23 | 2017-11-22 | Селективное сульфирование производных бензодиазепина |
| AU2017363237A AU2017363237B2 (en) | 2016-11-23 | 2017-11-22 | Selective sulfonation of benzodiazepine derivatives |
| CN201780084278.3A CN110392685B (zh) | 2016-11-23 | 2017-11-22 | 苯并二氮卓衍生物的选择性磺化 |
| EP17812176.0A EP3544983A2 (en) | 2016-11-23 | 2017-11-22 | Selective sulfonation of benzodiazepine derivatives |
| KR1020197017971A KR102576550B1 (ko) | 2016-11-23 | 2017-11-22 | 벤조다이아제핀 유도체의 선택적인 설폰화 |
| IL266743A IL266743B (en) | 2016-11-23 | 2019-05-20 | Selective sulfonation of benzodiazepine derivatives |
| IL291597A IL291597A (en) | 2016-11-23 | 2022-03-22 | Selective sulfonation of benzodiazepine derivatives |
| AU2022204163A AU2022204163B2 (en) | 2016-11-23 | 2022-06-15 | Selective sulfonation of benzodiazepine derivatives |
| JP2022207896A JP2023036842A (ja) | 2016-11-23 | 2022-12-26 | ベンゾジアゼピン誘導体の選択的スルホン化 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662425761P | 2016-11-23 | 2016-11-23 | |
| US62/425,761 | 2016-11-23 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018098258A2 true WO2018098258A2 (en) | 2018-05-31 |
| WO2018098258A3 WO2018098258A3 (en) | 2018-10-04 |
Family
ID=60655118
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/062989 Ceased WO2018098258A2 (en) | 2016-11-23 | 2017-11-22 | Selective sulfonation of benzodiazepine derivatives |
Country Status (11)
| Country | Link |
|---|---|
| US (5) | US10287256B2 (https=) |
| EP (1) | EP3544983A2 (https=) |
| JP (2) | JP7203729B2 (https=) |
| KR (2) | KR20230133935A (https=) |
| CN (2) | CN110392685B (https=) |
| AU (2) | AU2017363237B2 (https=) |
| CA (1) | CA3044391A1 (https=) |
| IL (2) | IL266743B (https=) |
| MA (1) | MA46887A (https=) |
| TW (2) | TWI845890B (https=) |
| WO (1) | WO2018098258A2 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020092533A2 (en) | 2018-10-30 | 2020-05-07 | Immunogen, Inc. | Methods of treatment using anti-cd123 immunoconjugates |
| WO2020191306A1 (en) * | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| WO2021050871A1 (en) | 2019-09-13 | 2021-03-18 | Mythic Therapeutics, Inc. | Antigen-binding protein constructs and uses thereof |
| US11701428B2 (en) | 2019-04-29 | 2023-07-18 | Immunogen, Inc. | Therapeutic combinations comprising anti-CD123 immunoconjugates |
| WO2024005123A1 (ja) | 2022-06-30 | 2024-01-04 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3769787A1 (en) * | 2015-06-29 | 2021-01-27 | ImmunoGen, Inc. | Conjugates of cysteine engineered antibodies |
| ES2887273T3 (es) | 2015-06-29 | 2021-12-22 | Immunogen Inc | Anticuerpos anti-CD123 y conjugados y derivados de los mismos |
| TWI845890B (zh) * | 2016-11-23 | 2024-06-21 | 美商伊繆諾金公司 | 苯二氮平衍生物之選擇性磺化 |
| WO2020092344A1 (en) * | 2018-10-31 | 2020-05-07 | Health Research, Inc. | Combination treatment with anti-cd123 antibody drug conjugate and parp inhibitor |
| CN113189184B (zh) * | 2021-04-28 | 2022-09-09 | 浙江大学 | 含有半胱氨酸的毛细管凝胶电泳样品缓冲液 |
Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
| US7276499B2 (en) | 1999-11-24 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
| US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7388026B2 (en) | 2002-04-05 | 2008-06-17 | Immunogen, Inc. | Prodrugs of CC-1065 analogs |
| US20080171040A1 (en) | 2004-06-01 | 2008-07-17 | Genentech, Inc. | Antibody-drug conjugates and methods |
| US7414073B2 (en) | 2002-08-02 | 2008-08-19 | Immunogen Inc. | Cytotoxic agents containing novel potent taxanes and their therapeutic use |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| US20080305044A1 (en) | 2004-11-29 | 2008-12-11 | Seattle Genetics, Inc. | Engineered Antibodies and Immunoconjugates |
| WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| WO2009134976A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen, Inc | Potent conjugates and hydrophilic linkers |
| WO2010043880A1 (en) | 2008-10-17 | 2010-04-22 | Spirogen Limited | Unsymmetrical pyrrolobenzodiazepine-dimers for treatment of proliferative diseases |
| WO2010091150A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen, Inc. | Novel benzodiazepine derivatives |
| WO2011130616A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines used to treat proliferative diseases |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2012058592A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Non-antagonistic egfr-binding molecules and immunoconjugates thereof |
| WO2012112708A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives and methods of preparation |
| US8557966B2 (en) | 2010-02-24 | 2013-10-15 | Immunogen, Inc. | Folate receptor 1 antibodies and immunoconjugates and uses thereof |
| US8577966B2 (en) | 2010-01-29 | 2013-11-05 | Smartebook.Com Co., Ltd. | Content sharing system and content sharing method |
| WO2013177481A1 (en) | 2012-05-25 | 2013-11-28 | Immunogen, Inc. | Benzodiazepines and conjugates thereof |
| US8765917B2 (en) | 2010-03-12 | 2014-07-01 | Immunogen, Inc. | CD37-binding molecules and immunoconjugates thereof |
| US8790649B2 (en) | 2010-10-29 | 2014-07-29 | Immunogen, Inc. | EGFR-binding molecules and immunoconjugates thereof |
| US20160082114A1 (en) | 2014-09-03 | 2016-03-24 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
Family Cites Families (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9422383D0 (en) | 1994-11-05 | 1995-01-04 | Wellcome Found | Antibodies |
| AU2005218642B2 (en) | 2004-03-02 | 2011-04-28 | Seagen Inc. | Partially loaded antibodies and methods of their conjugation |
| KR101270829B1 (ko) | 2004-09-23 | 2013-06-07 | 제넨테크, 인크. | 시스테인 유전자조작 항체 및 접합체 |
| PL1879901T3 (pl) | 2005-04-21 | 2010-06-30 | Medimmune Ltd | Pirolobenzodiazepiny |
| US8008453B2 (en) | 2005-08-12 | 2011-08-30 | Amgen Inc. | Modified Fc molecules |
| AU2010270979B2 (en) | 2009-06-22 | 2015-04-23 | Medimmune, Llc | Engineered Fc regions for site-specific conjugation |
| JP6494533B2 (ja) | 2013-02-28 | 2019-04-03 | イミュノジェン・インコーポレーテッド | 細胞結合剤及び細胞毒性剤としてのマイタンシノイドを含む複合体 |
| WO2014134457A2 (en) | 2013-02-28 | 2014-09-04 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2014134486A2 (en) | 2013-02-28 | 2014-09-04 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| CN115124573A (zh) * | 2013-09-02 | 2022-09-30 | 杭州多禧生物科技有限公司 | 应用于细胞结合分子-药物共轭体的新型细胞毒性分子 |
| WO2015196089A1 (en) | 2014-06-20 | 2015-12-23 | Bioalliance C.V. | Anti-cd22 antibody-drug conjugates and methods of using thereof |
| SG11201610620UA (en) | 2014-06-20 | 2017-01-27 | Bioalliance Cv | Anti-folate receptor aplha (fra) antibody-drug conjugates and methods of using thereof |
| CN106999604B (zh) | 2014-09-02 | 2021-08-03 | 伊缪诺金公司 | 用于配制抗体药物缀合物组合物的方法 |
| EP3189057A1 (en) | 2014-09-03 | 2017-07-12 | ImmunoGen, Inc. | Cytotoxic benzodiazepine derivatives |
| MA41645A (fr) | 2015-03-04 | 2018-01-09 | Abbvie Stemcentrx Llc | Anticorps issus de génie génétique spécifiques au site et méthodes d'utilisation |
| ES2887273T3 (es) | 2015-06-29 | 2021-12-22 | Immunogen Inc | Anticuerpos anti-CD123 y conjugados y derivados de los mismos |
| EP3769787A1 (en) | 2015-06-29 | 2021-01-27 | ImmunoGen, Inc. | Conjugates of cysteine engineered antibodies |
| MX2018009487A (es) | 2016-02-05 | 2019-01-31 | Millennium Pharm Inc | Conjugados de anticuerpo y fármaco dirigidos contra gcc. |
| TWI845890B (zh) | 2016-11-23 | 2024-06-21 | 美商伊繆諾金公司 | 苯二氮平衍生物之選擇性磺化 |
-
2017
- 2017-11-22 TW TW111103323A patent/TWI845890B/zh not_active IP Right Cessation
- 2017-11-22 EP EP17812176.0A patent/EP3544983A2/en not_active Withdrawn
- 2017-11-22 JP JP2019527831A patent/JP7203729B2/ja active Active
- 2017-11-22 TW TW106140599A patent/TWI755450B/zh not_active IP Right Cessation
- 2017-11-22 WO PCT/US2017/062989 patent/WO2018098258A2/en not_active Ceased
- 2017-11-22 AU AU2017363237A patent/AU2017363237B2/en not_active Ceased
- 2017-11-22 CA CA3044391A patent/CA3044391A1/en active Pending
- 2017-11-22 KR KR1020237030171A patent/KR20230133935A/ko not_active Ceased
- 2017-11-22 KR KR1020197017971A patent/KR102576550B1/ko active Active
- 2017-11-22 CN CN201780084278.3A patent/CN110392685B/zh not_active Expired - Fee Related
- 2017-11-22 US US15/820,648 patent/US10287256B2/en active Active
- 2017-11-22 CN CN202310731029.6A patent/CN116813690A/zh active Pending
- 2017-11-22 MA MA046887A patent/MA46887A/fr unknown
-
2019
- 2019-03-26 US US16/364,801 patent/US10494348B2/en active Active
- 2019-05-20 IL IL266743A patent/IL266743B/en unknown
- 2019-10-30 US US16/669,121 patent/US10822313B2/en active Active
-
2020
- 2020-09-17 US US17/023,545 patent/US11572349B2/en active Active
-
2022
- 2022-03-22 IL IL291597A patent/IL291597A/en unknown
- 2022-06-15 AU AU2022204163A patent/AU2022204163B2/en not_active Expired - Fee Related
- 2022-12-26 JP JP2022207896A patent/JP2023036842A/ja active Pending
- 2022-12-30 US US18/091,653 patent/US20230391733A1/en not_active Abandoned
Patent Citations (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US7276499B2 (en) | 1999-11-24 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US7368565B2 (en) | 2001-05-31 | 2008-05-06 | Immunogen Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
| US7388026B2 (en) | 2002-04-05 | 2008-06-17 | Immunogen, Inc. | Prodrugs of CC-1065 analogs |
| US7414073B2 (en) | 2002-08-02 | 2008-08-19 | Immunogen Inc. | Cytotoxic agents containing novel potent taxanes and their therapeutic use |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7557189B2 (en) | 2002-11-07 | 2009-07-07 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US20080171040A1 (en) | 2004-06-01 | 2008-07-17 | Genentech, Inc. | Antibody-drug conjugates and methods |
| US20080305044A1 (en) | 2004-11-29 | 2008-12-11 | Seattle Genetics, Inc. | Engineered Antibodies and Immunoconjugates |
| US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
| WO2009134976A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen, Inc | Potent conjugates and hydrophilic linkers |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| WO2010043880A1 (en) | 2008-10-17 | 2010-04-22 | Spirogen Limited | Unsymmetrical pyrrolobenzodiazepine-dimers for treatment of proliferative diseases |
| WO2010091150A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen, Inc. | Novel benzodiazepine derivatives |
| US8577966B2 (en) | 2010-01-29 | 2013-11-05 | Smartebook.Com Co., Ltd. | Content sharing system and content sharing method |
| US8557966B2 (en) | 2010-02-24 | 2013-10-15 | Immunogen, Inc. | Folate receptor 1 antibodies and immunoconjugates and uses thereof |
| US8765917B2 (en) | 2010-03-12 | 2014-07-01 | Immunogen, Inc. | CD37-binding molecules and immunoconjugates thereof |
| WO2011130616A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines used to treat proliferative diseases |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2012058592A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Non-antagonistic egfr-binding molecules and immunoconjugates thereof |
| US8790649B2 (en) | 2010-10-29 | 2014-07-29 | Immunogen, Inc. | EGFR-binding molecules and immunoconjugates thereof |
| WO2012112708A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives and methods of preparation |
| WO2012128868A1 (en) | 2011-02-15 | 2012-09-27 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2013177481A1 (en) | 2012-05-25 | 2013-11-28 | Immunogen, Inc. | Benzodiazepines and conjugates thereof |
| US20160082114A1 (en) | 2014-09-03 | 2016-03-24 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
Non-Patent Citations (9)
| Title |
|---|
| "McGraw-Hill Dictionary of Chemical Terms", 1984, MCGRAW-HILL BOOK COMPANY |
| "The Chemistry of Heterocyclic Compounds, A series of Monographs", vol. 13-14,16, 1950, JOHN WILEY & SONS |
| ELIEL, E.; WILEN, S.: "Stereochemistry of Organic Compounds", 1994, JOHN WILEY & SONS, INC. |
| ISALM; DENT: "Bioconjugation", 1999, GROVES DICTIONARIES INC., pages: 218 - 363 |
| J. AM. CHEM. SOC., vol. 82, 1960, pages 5566 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH |
| P. G.M. WUTS; T. W. GREENE: "Protective Groups in Organic Synthesis", 2007, JOHN WILEY & SONS |
| P. WUTS; T. GREENE: "Protective Groups in Organic Synthesis", 2007, J. WILEY & SONS |
| PAQUETTE, LEO A.: "Principles of Modern Heterocyclic Chemistry", 1968, W. A. BENJAMIN |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020092533A2 (en) | 2018-10-30 | 2020-05-07 | Immunogen, Inc. | Methods of treatment using anti-cd123 immunoconjugates |
| CN113329768A (zh) * | 2018-10-30 | 2021-08-31 | 伊缪诺金公司 | 使用抗cd123免疫缀合物的治疗方法 |
| JP2022513405A (ja) * | 2018-10-30 | 2022-02-07 | イミュノジェン, インコーポレイテッド | 抗cd123免疫複合体を用いた治療法 |
| EP3873524A4 (en) * | 2018-10-30 | 2022-11-09 | Immunogen, Inc. | TREATMENT METHODS USING ANTI-CD123 IMMUNOCONJUGATES |
| WO2020191306A1 (en) * | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| CN113631194A (zh) * | 2019-03-21 | 2021-11-09 | 伊缪诺金公司 | 制备细胞结合剂-药物缀合物的方法 |
| JP2022527449A (ja) * | 2019-03-21 | 2022-06-02 | イミュノジェン・インコーポレーテッド | 細胞結合剤-薬物複合体の調製方法 |
| US11833214B2 (en) | 2019-03-21 | 2023-12-05 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| US11701428B2 (en) | 2019-04-29 | 2023-07-18 | Immunogen, Inc. | Therapeutic combinations comprising anti-CD123 immunoconjugates |
| WO2021050871A1 (en) | 2019-09-13 | 2021-03-18 | Mythic Therapeutics, Inc. | Antigen-binding protein constructs and uses thereof |
| WO2024005123A1 (ja) | 2022-06-30 | 2024-01-04 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11572349B2 (en) | Selective sulfonation of benzodiazepine derivatives | |
| US20250011340A1 (en) | Benzodiazepine derivatives and antibody conjugates thereof | |
| RU2773881C2 (ru) | Селективное сульфирование производных бензодиазепина | |
| RU2834224C1 (ru) | Конъюгаты сконструированных антител с цистеиновыми заменами | |
| HK40044772A (en) | Conjugates of cysteine engineered antibodies | |
| HK1254782B (en) | Conjugates of cysteine engineered antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17812176 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3044391 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019527831 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20197017971 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017363237 Country of ref document: AU Date of ref document: 20171122 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017812176 Country of ref document: EP Effective date: 20190624 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2017812176 Country of ref document: EP |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 291597 Country of ref document: IL |