WO2018055031A1 - Inhibiteurs de transport acidobasique - Google Patents

Inhibiteurs de transport acidobasique Download PDF

Info

Publication number
WO2018055031A1
WO2018055031A1 PCT/EP2017/073896 EP2017073896W WO2018055031A1 WO 2018055031 A1 WO2018055031 A1 WO 2018055031A1 EP 2017073896 W EP2017073896 W EP 2017073896W WO 2018055031 A1 WO2018055031 A1 WO 2018055031A1
Authority
WO
WIPO (PCT)
Prior art keywords
transport
intracellular
exchange
na7hc0
na7h
Prior art date
Application number
PCT/EP2017/073896
Other languages
English (en)
Inventor
Briggs Ebbe BØDTKJER
Memborg Nicolai TOFT
Original Assignee
Aarhus Universitet
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Aarhus Universitet filed Critical Aarhus Universitet
Publication of WO2018055031A1 publication Critical patent/WO2018055031A1/fr

Links

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57415—Specifically defined cancers of breast
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5094—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for blood cell populations
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872—Intracellular protein regulatory factors and their receptors, e.g. including ion channels

Definitions

  • the present invention relates to methods for prognosis and diagnosis of breast cancer based on the activities of cellular acid-base transporters.
  • Acid-base transporters are potential targets for anti-cancer therapy and knowledge regarding predominant acid-base transport functions in cancer tissue from individual patients would provide vital information for predicting treatment responses to inhibitors of acid-base transporters. Acid-base transporters and local pH modify cell proliferation, migration, and extracellular matrix degradation, and variability in acid-base transport mechanisms in normal breast tissue and malignantly transformed breast tissue may therefore contribute to differences in risk for breast cancer development and the potential for and rate of cancer progression including the risk of metastatic
  • a main object of the present invention is to provide prognostic and diagnostic methods, which are based on measurements of the acid-base transport across the cellular membrane. Regulation of acid-base transport is import to maintain intracellular pH, and changes in acid-base transport are important for cancer development.
  • the present invention relates to a method for determining the prognosis of a breast cancer, said method comprising
  • a method is provided of identifying a patient with increased risk of developing metastatic breast cancer, said method comprising
  • a method is provided of selecting a breast cancer patient for treatment with an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange, said method comprising
  • Na7H + exchange for intracellular pH regulation and c) selecting patients for whom the relative importance of Na7HC0 3 " co- transport and/or Na + /H + exchange for intracellular pH regulation is above or below a predetermined value.
  • a method is provided of treating breast cancer, said method comprising
  • One aspect also relates to a use of an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange for treating a breast cancer in a patient, wherein the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is above or below a predetermined value.
  • FIG. 1 The capacity for pH recovery from intracellular acidification is increased in human breast cancer tissue compared to normal breast tissue both in the presence and absence of C0 2 /HC0 3 " .
  • A. Average traces of intracellular pH (pH,) during NH 4 + - prepulse experiments performed on organoids isolated from human breast cancer and normal breast tissue (n 27-28).
  • B. Rates of Na + -dependent intracellular pH (pH,) recovery plotted as function of intracellular pH in organoids from breast cancer and normal breast tissue (n 27-28). The displayed lines are the result of least-squares linear regression analyses and are all significantly different (P ⁇ 0.01 or P ⁇ 0.001 ).
  • the displayed lines are the result of least-squares linear regression analyses and the stars indicate levels of significance ( * P ⁇ 0.05, *** P ⁇ 0.001 ) when tissue from women with HER2-positive breast cancer is compared to the same type of tissue (cancer or normal) from women with HER2-negative breast cancer.
  • FIG. 3 Na + ,HC0 3 ⁇ -cotransport and C0 2 /HC0 3 " -dependent changes in steady-state intracellular pH are attenuated in normal breast tissue and breast cancer tissue from women with lymph node metastases.
  • the data set presented in Figure 1 is here divided according to whether the women were found to have lymph node metastases (including micro-metastases and individual tumor cell metastases) or not.
  • the displayed lines are the result of least- squares linear regression analyses and the stars indicate levels of significance
  • Intracellular pH is elevated in cancer tissue compared to normal breast tissue (P ⁇ 0.01 for invasive ductal carcinoma, P ⁇ 0.05 for invasive lobular carcinoma; two-way ANOVA) and higher in the presence than absence of C0 2 /HC0 3 " (P ⁇ 0.01 for both
  • FIG. 5 Steady-state intracellular pH in breast cancer tissue is not dependent on the size of the primary breast tumor.
  • the data set presented in Figure 1 C is here plotted as function of primary tumor size.
  • Intracellular intrinsic buffering capacity was not significantly different between organoids isolated from breast cancer tissue and corresponding normal breast tissue.
  • FIG. 7 Breast cancer tissue has increased capacity for net acid extrusion and elevated intracellular pH compared to normal breast tissue.
  • C0 2 /HC0 3 " -free conditions in tissue of the same source (normal breast or breast cancer) when compared by least-squares linear regression analysis.
  • FIG. 8 Na + ,HC0 3 " -cotransport and C0 2 /HC0 3 " -dependent changes in steady-state intracellular pH are increased in HER2-positive (HER2 + ) compared to HER2-negative (HER2 " ) breast cancer tissue.
  • C Steady-state intracellular pH in organoids from breast cancer tissue and normal breast tissue divided according to HER2-status.
  • Figure 9 Na + ,HC0 3 ⁇ -cotransport is increased in estrogen receptor negative (0-10% ER + ) compared to estrogen receptor positive (90-100% ER + ) breast cancer tissue.
  • C Steady-state intracellular pH in organoids isolated from breast cancer tissue and normal breast tissue divided according to ER status.
  • D+E Na + -dependent net base uptake as function of intracellular pH in estrogen receptor negative (D) and estrogen receptor positive (E) tissue. Transport activities were analyzed by least-squares linear regression analyses. ** P ⁇ 0.01 , *** P ⁇ 0.001 , NS: not significantly different vs. C0 2 /HC0 3 " -free conditions.
  • FIG. 10 The C0 2 /HC0 3 " -dependency of net base uptake and steady-state intracellular pH is attenuated in primary tumors from women with lymph node (LN) metastases.
  • C Steady-state intracellular pH in organoids isolated from breast cancer tissue and normal breast tissue grouped according to regional lymph node status.
  • Steady-state intracellular pH in organoids isolated from breast cancer tissue and normal breast tissue is not dependent on primary tumor size or the age of the patient at diagnosis.
  • B Steady-state intracellular pH plotted as function of patient age at time of breast cancer diagnosis.
  • Acid-base transport is vital for intracellular pH regulation, and it is particularly important in cancer tissue due to the high metabolic rate and consequent increased production of acidic waste.
  • cancer cells are very dependent on net acid extrusion that defend against intracellular acidification and thereby maintain intracellular pH in a range permissive for cell metabolism, survival, and proliferation.
  • the invention therefore relates to methods for determining the prognosis of a breast cancer, such as identifying a patient with increased risk of developing metastatic breast cancer; selecting a breast cancer patient for treatment with an inhibitor of Na7HC0 3 " co-transport and/or Na + /H + exchange; and also treating breast cancer, where the prognosis, risk, selection and treatment is based on the activity of Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from the respective patient.
  • the invention provides a method for determining the prognosis of a breast cancer, said method comprising
  • a method is also provided of identifying a patient with increased risk of developing metastatic breast cancer, said method comprising
  • a method is provided of selecting a breast cancer patient for treatment with an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange, said method comprising
  • a method is also provided of treating breast cancer, said method comprising a) determining the Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from a patient,
  • a use of an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange is also provided for treating a breast cancer in a patient, wherein the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is above or below a predetermined value.
  • the term "relative importance" with respect to the cellular acid-base regulators is meant to refer to the extent to which each of the two transporters, Na7HC0 3 " co-transporters and Na + /H + exchangers, compared with each other is responsible for regulation of the intracellular pH.
  • the relative importance of Na7HC0 3 " co-transport and/or Na + /H + exchange for intracellular pH regulation can be determined in a trace experiment as shown in figure 1.
  • the contribution from Na7HC0 3 " co-transport to intracellular pH regulation in a tissue sample from a patient is evaluated based on the increased ability to recover intracellular pH after intracellular acidification (i.e., faster recovery and/or recovery at more alkaline intracellular pH levels) when investigated in the presence compared to the absence of C0 2 /HC0 3 " ; and a higher contribution from Na7HC0 3 " co-transport in a sample is observed as a greater increase in the ability to recover intracellular pH from intracellular acidification compared to a sample with lower contribution from Na7HC0 3 " co-transport.
  • the transport of acid-base equivalents across cell membranes is governed by four types of transporters, Na + ,HC0 3 " -cotransporters (NBC); Na7H + -exchangers (NHE); H + - ATPases (proton pumps) and monocarboxylate transporters (MCT).
  • NBC -cotransporters
  • NHE Na7H + -exchangers
  • H + - ATPases proton pumps
  • MCT monocarboxylate transporters
  • the activity of acid-base transporters is preferably determined for Na7HC0 3 " co-transport and/or Na7H + exchange.
  • the Na7HC0 3 " co-transport activity is determined and/or the Na7H + exchange activity is determined.
  • their relative importance for the intracellular pH regulation is determined.
  • the Na7HC0 3 " co-transport activity is determined and the relative importance of Na7HC0 3 " co-transport for intracellular pH regulation is determined.
  • the Na + /H + exchange activity is determined and the relative importance of Na + /H + exchange for intracellular pH regulation is determined.
  • Na7HC0 3 " co-transport is mediated by proteins of the solute carrier 4 (SLC4) family.
  • This family comprise at least 1 1 members and include electrogenic, electroneutral and Na + -driven co-transporters.
  • the methods and uses of the present invention may include determining Na7HC0 3 " co-transport activity mediated by any member of the SLC4 family.
  • the methods and uses comprises determining Na7HC0 3 " co-transport activity mediated by an electroneutral Na7HC0 3 " co-transport, such as SLC4A7 (aka NBCnl ).
  • Na7H + exchange is mediated by another family of solute carrier proteins known as the SLC9-family.
  • Mammalian Na7H + exchangers of the SLC9 family are widely expressed and involved in numerous essential physiological processes. Their primary function is to mediate the 1 :1 exchange of Na + for H + across the cellular membrane. At least 1 1 members exist in this family, and generally, the methods and uses of the present invention may include determining Na7H + exchange activity mediated by any member of the SLC9 family. However, in a more preferred embodiment, the methods and uses comprises determining Na7H + exchange activity mediated by SLC9A1 (aka NHE1 ).
  • the methods and uses provided herein for treatment of breast cancer include providing an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange to the patient.
  • the inhibitor is an NBCnl [SLC4A7] inhibitor or the inhibitor is an NHE1 [SLC9A1] inhibitor.
  • One aspect of the invention relates to a method for breast cancer prognosis.
  • the inventors have surprisingly found that there is a correlation between important prognostic markers for breast cancer and the activities of Na7HC0 3 " co-transport and/or Na7H + exchange in a patient sample.
  • expression of human epidermal growth factor receptor 2 (HER2, a.k.a. ErbB2), presence of lymph node metastases, and histopathology shows specific activity profiles of acid-base transporters.
  • a prognostic method for the prognosis of a breast cancer, said method comprising
  • the method comprises
  • step c) in either method above may comprise identifying a patient for whom the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is above or below a predetermined value as a patient with a poor prognosis.
  • the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is in preferred embodiments indicative of HER2 receptor overexpression or gene amplification, lymph node metastasis, tumour type, tumour size, estrogen receptor status or malignancy grade.
  • a diagnostic method is provided for breast cancer, which is based on the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation.
  • a method for identifying a patient with increased risk of developing metastatic breast cancer comprising a) determining the Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from said patient, and
  • the diagnostic method for determining the presence, risk and/or prognosis of breast cancer in a patient may comprise the steps of:
  • Na+/H+ exchange for intracellular pH regulation with a predetermined value c) determining the presence, risk and/or prognosis of breast cancer in said patient on the basis of the comparison of the relative importance of Na+/ HC0 3 " co- transport and/or Na+/H+ exchange for intracellular pH regulation with a predetermined value.
  • a method for selecting a breast cancer patient for treatment with an inhibitor of Na7HC0 3 " co-transport and/or Na7H + exchange comprising a) determining the Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from a patient, and
  • the method for selecting a breast cancer may comprise the steps of: a) providing or obtaining a sample, such as a cancer tissue sample, from said patient
  • Na7HC0 3 " co-transport and/or Na + /H + exchange on the basis of the comparison of the relative importance of Na+/ HC0 3 " co-transport and/or Na+/H+ exchange for intracellular pH regulation with a predetermined value.
  • the choice of therapy is determined on the basis of the relative importance of Na7HC0 3 " co-transport and/or Na + /H + exchange for intracellular pH regulation.
  • a patient is in one embodiment selected for treatment with a modulator, such as an inhibitor, of Na7HC0 3 " co-transport when the relative importance of Na7HC0 3 " co-transport for intracellular pH regulation is above or below a predetermined value, in which case a modulator, such as an inhibitor, of Na7HC0 3 " co-transport can be provided for treatment of the breast cancer. It is preferred that patient is selected for treatment with an inhibitor of Na7HC0 3 " co- transport when the relative importance of Na7HC0 3 " co-transport for intracellular pH regulation is above a predetermined value, in which case an inhibitor of Na7HC0 3 " co- transport is provided for treatment of the breast cancer.
  • a modulator such as an inhibitor
  • a patient is selected for whom the relative importance of Na7H + exchange for intracellular pH regulation is above or below a predetermined value, in which case a modulator, such as an inhibitor, of Na7H + exchange can be provided. Still, it is preferred that a patient is selected for whom the relative importance of Na7H + exchange for intracellular pH regulation is above a predetermined value, in which case an inhibitor, of Na7H + exchange can be provided.
  • the breast cancer is a triple negative breast cancer, an estrogen receptor-positive breast cancers and/or a HER2-positive breast cancer.
  • the methods for prognosis of a breast cancer provided herein relates to determining whether the breast cancer is a triple negative breast cancer, an estrogen receptor-positive breast cancers and/or a HER2- positive breast cancer.
  • breast cancer tissue from women with lymph node metastases differs in intracellular pH regulatory function from breast cancer tissue obtained from women without lymph node metastases: the contribution from
  • Na7HC0 3 " cotransport to net acid extrusion and intracellular steady-state pH regulation is low in the primary breast cancer tissue and normal breast tissue from women with metastatic dissemination to regional lymph nodes.
  • the difference in intracellular pH regulation in normal breast tissue shows that variation in normal tissue function can predispose to metastatic breast cancer disease.
  • the invention therefore, specifically relates to a prognostic and therapeutic method, wherein a reduced relative importance of Na7HC0 3 " co-transport is indicative of increased risk of developing metastatic breast cancer.
  • Such methods may also be used to infer a suitable treatment or monitorization program in order to prevent or ameliorate the cancer progress.
  • the methods and uses provided herein for diagnosis, prognosis, risk assessment or treatment generally comprises determining the Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from a patient.
  • the sample can be any relevant suitable biological sample comprising live cells from the patient.
  • the sample is a tissue sample, preferably a sample of breast tissue.
  • the tissue may be cancer derived, for example be taken from a tumour, in certain embodiments, such as methods and uses related to treatment and prognosis of breast cancer.
  • the sample may also comprise or consist of normal tissue, for example taken from breast tissue adjacent to a tumour or from a woman without diagnosed cancer.
  • the sample can be a biopsy taken by usual methods available in the art.
  • the sample is a needle biopsy such as a core needle biopsy (CNB), however a fine needle biopsy (FNAB) can also be employed.
  • CB core needle biopsy
  • FNAB fine needle biopsy
  • the medical professional locates the lump or suspicious area and guides the needle there. If the lump can't be felt, ultrasound might be used to watch the needle on a screen as it moves toward and into the mass
  • the medical professional may also use stereotactic needle biopsy to guide the needle.
  • stereotactic needle biopsy computers map the exact location of the mass using mammograms taken from 2 angles, which is then used to guide the needle to the right spot. A computer then pinpoints exactly where in the abnormal area the needle tip needs to go.
  • tissue is drawn out. Vacuum-assisted biopsies can be done with special biopsy systems. For these procedures, the skin is numbed and a small cut (less than 1 ⁇ 4 inch) is made. A hollow probe is put in through the cut and guided into the abnormal area of breast tissue using x-rays, ultrasound, or MRI. Tissue is then pulled into the probe through a hole in its side, and a rotating knife inside the probe cuts the tissue sample from the rest of the breast. This allows multiple tissue samples to be removed through one small opening.
  • the breast cancer diagnostic and prognostic methods provided herein are based on needle biopsies as described above.
  • a surgical biopsy may be needed.
  • a surgical biopsy is done by cutting the breast to take out all or part of the lump so it can be looked at under a microscope.
  • biopsy tissue samples can be obtained from the removed material. This may also be called an open biopsy.
  • the present disclosure provides methods for prognosis and diagnosis of breast cancer. These methods can also be used to determine a specific suitable treatment for the relevant patients, for whom the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is above or below a predetermined value. For example, breast cancer patients can be selected for a specific treatment with modulators, such as inhibitors, of Na7HC0 3 " co-transport and/or Na7H + exchange.
  • a method is provided of treating breast cancer, the method comprising a) determining the Na7HC0 3 " co-transport activity and/or Na7H + exchange activity in cells of a sample from a patient,
  • the method may comprise the steps of:
  • g) providing a modulator, such as an inhibitor, of Na7HC0 3 " co-transport and/or Na7H + exchange to said patient
  • a modulator such as an inhibitor
  • the choice of therapy is determined on the basis of the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation.
  • One aspect also provides a use of a modulator, such as an inhibitor, of Na7HC0 3 " co- transport and/or Na + /H + exchange for treating a breast cancer in a patient, wherein the relative importance of Na7HC0 3 " co-transport and/or Na7H + exchange for intracellular pH regulation is above or below a predetermined value.
  • the method of treating breast cancer comprises
  • patient is selected for treatment with an inhibitor of Na7HC0 3 " co- transport when the relative importance of Na7HC0 3 " co-transport for intracellular pH regulation is above a predetermined value, in which case an inhibitor of Na7HC0 3 " co- transport is provided for treatment of the breast cancer.
  • a patient is selected for whom the relative importance of Na7H + exchange for intracellular pH regulation is above a predetermined value, in which case an inhibitor, of Na7H + exchange can be provided.
  • the therapeutic methods and uses comprises providing or administering an inhibitor of Na7HC0 3 " co-transport.
  • the therapeutic methods and uses comprises providing or administering an inhibitor of Na7H + exchange.
  • the inhibitor is an inhibitor of Na7HC0 3 " co-transport; i.e. an inhibitor of a gene product of the SLC4-family, preferably an inhibitor of SLC4A7 (NBCnl ).
  • the inhibitor may be any relevant compound, such as an antibody or a small molecule.
  • the small molecule is cariporide.
  • Cariporide is a selective inhibitor of Na7H + exchange, and thus in one embodiment, Cariporide is provided for use in treatment of breast cancer in a patient, wherein the relative importance of Na + /H + exchange for intracellular pH regulation is above a predetermined value.
  • the inhibitor may also be an antibody or antigen binding fragment thereof targeting a gene product of the SLC4-family and/or the SLC9-family, in particular SLC4A7 (NBCnl ) or SLC9A1 (NHE1 ).
  • the antibody or antigen binding fragment thereof specifically recognize and bind an extracellular polypeptide region of gene product of the SLC4-family and/or the SLC9-family, in particular SLC4A7 (NBCnl ) or SLC9A1 (NHE1 ).
  • the antibody or antigen binding fragment thereof specifically recognize and bind an extracellular polypeptide region comprises or consists of a sequence selected from any one of SEQ ID NO: 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16 or a fragment thereof.
  • the extracellular polypeptide region may comprise or consist of a sequence selected from SEQ ID NO: 14, 15 and 16.
  • the antibody or antigen binding fragment thereof is preferably capable of inhibiting the cellular function of the SLC4 protein family, such as NBCnl -mediated Na + -dependent HC0 3 " transport and/or SLC9 protein family, such as NHE1 -mediated Na + -dependent hTtransport.
  • the therapeutic methods and uses provided herein may further comprise providing a further therapeutic agent, such as an additional anti breast cancer agent.
  • a further therapeutic agent such as an additional anti breast cancer agent.
  • an estrogen-receptor modulator or a HER2 antibody could be provided or administered, or a regulator of an ion transporter, such as a Na7H + exchanger (NHE), a
  • the treatment can be applied at any stage of a breast cancer and can also be used for prophylactic treatment of breast cancer.
  • the treatment according to the present invention involves both prophylactic and curative treatment as well as prevention and amelioration of symptoms or associated with a breast cancer and prevention of disease progression.
  • the therapeutic methods and uses could be combined with chemotherapy and/or radiotherapy.
  • the uses, medicaments and methods of treatment may also be used before or after surgical therapy.
  • Antibody or antigen binding fragment
  • An antibody or antigen binding fragment thereof is provided for use in treatment of breast cancer, which antibody is capable of targeting and modulating the activity of a gene product of the SLC4-family and/or the SLC9-family, in particular SLC4A7
  • the provided antibody is capable of inhibiting either Na7HC0 3 " co-transport activity and/or Na7H + exchange activity.
  • the antibody is capable of inhibiting cellular NBCnl - mediated Na + -dependent HC0 3 " transport.
  • the antibody or antigen binding fragment thereof preferably specifically recognizes and binds an extracellular polypeptide region of human NBCnl .
  • the extracellular polypeptide region comprises or consists of a sequence selected from any one of SEQ ID NO: 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16 or a fragment thereof.
  • the extracellular polypeptide region comprises or consists of a human sequence selected from any one of SEQ ID NO: 14, 15, 16 or a fragment thereof, such as a fragment of 5- 25, such as 10-25, such as 10-20 amino acids thereof.
  • the antibody or antigen binding fragment thereof is capable of inhibiting cellular NBCnl - mediated Na + -dependent HC0 3 " transport.
  • the antibody may be any polypeptide or protein capable of recognising and binding an antigen in a gene product of the SLC4 or SLC9 families, in particular NBCnl or NHE1 , preferably an extracellular polypeptide region.
  • the antibody is capable of specifically binding said antigen.
  • specifically binding is meant binding with at least 10 times higher affinity to the antigen than to a non-specific antigen (e.g. BSA).
  • the antibody binds with an affinity corresponding to a K D of about 10 "7 M or less, such as about 10 "8 M or less, such as about 10 "9 M or less, for example about 10 "10 M or less, or even about 10 "11 M or even less, when measured as apparent affinities based on IC 5 o values.
  • said antibody is a naturally occurring antibody or a functional homologue thereof.
  • a naturally occurring antibody is a heterotetrameric glycoprotein capable of recognising and binding an antigen comprising two identical heavy (H) chains and two identical light (L) chains inter-connected by disulfide bonds.
  • Each heavy chain comprises or preferably consists of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as C H ).
  • Each light chain comprises, or preferably consists of, a light chain variable region (abbreviated herein as V
  • _ light chain variable region
  • _ light chain constant region
  • the V H and V L regions can be further subdivided into regions of hypervariability, termed
  • Each V H and V L comprises and preferably consists of three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the naturally occurring antibody may also be a heavy-chain antibody (HCAbs) as produced by camelids (camels, dromedaries and llamas). HCAbs are homodimers of heavy chains only, devoid of light chains and the first constant domain (Hamers- Casterman et al., 1993).
  • NAR New or Nurse Shark Antigen Receptor
  • V variable
  • NAR proteins constitute a single immunoglobulin variable-like domain (Greenberg, A. S., Avila, D., Hughes, M., Hughes, A., McKinney, E. C. & Flajnik, M. F. (1995) Nature (London) 374, 168-173.) which is much lighter than an antibody molecule.
  • Naturally occurring antibodies according to the invention may consist of one heterotetramer or they may comprise several identical heterotetramers.
  • the naturally occurring antibody according to the invention may for example be selected from the group consisting of IgG, IgM, IgA, IgD and IgE.
  • the subunit structures and three-dimensional configurations of these different classes of immunoglobulins are well known.
  • Naturally occurring antibodies according to the invention may be antibodies of a particular species, for example the antibody may be a murine, a rat, a rabbit, a goat, a sheep, a chicken, a donkey, a camelid or a human antibody.
  • the antibody according to the invention may however also be a hybrid between antibodies from several species, for example the antibody may be a chimeric antibody, such as a humanised antibody.
  • the antibody according to the invention may be a monoclonal antibody, such as a naturally occurring monoclonal antibody or it may be polyclonal antibodies, such as naturally occurring polyclonal antibodies.
  • the antibody may be any protein or polypeptide containing an antigen binding site, such as a single polypeptide, a protein or a glycoprotein.
  • the antigen binding site comprises at least one CDR, or more preferably a variable region.
  • the antigen binding site may comprise a V H and/or V L .
  • _ together may contain the antigen binding site, however, either one of the V H or the V
  • the CDRs may identify the specificity of the antibody and accordingly it is preferred that the antigen binding site comprises one or more CDRs, preferably at least 1 , more preferably at least 2, yet more preferably at least 3, even more preferably at least 4, yet more preferably at least 5, even more preferably 6 CDRs. It is preferable that the antigen binding site comprises at least one CDR3, more preferably at least the CDR3 of the heavy chain.
  • the antibody may for example be an antigen binding fragment of an antibody, preferably an antigen binding fragment of a naturally occurring antibody, a
  • heterospecific antibody a single chain antibody or a recombinant antibody.
  • An antibody according to the invention may comprise one or more antigen binding sites.
  • Naturally occurring heterotetrameric antibodies comprises two antigen binding sites.
  • the antibody of the invention may be a human antibody or a humanised antibody.
  • the antibody according to the invention may be a human or a humanised antibody.
  • a human antibody as used herein is an antibody, which is obtained from a system using human immunoglobulin sequences.
  • Human antibodies may for example be antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom.
  • Human antibodies may also be isolated from a host cell transformed to express the antibody, e.g., from a transfectoma.
  • Human antibodies may also be isolated from a recombinant, combinatorial human antibody library.
  • the antibody according to the invention may be a chimeric antibody, i.e. an antibody comprising regions derived from different species.
  • the chimeric antibody may for example comprise variable regions from one species of animal and constant regions from another species of animal.
  • a chimeric antibody can be an antibody having variable regions which derive from a mouse monoclonal antibody and constant regions which are human. Such antibodies may also be referred to as humanised antibodies.
  • the antibody according to the invention may also be a humanised antibody, which is encoded partly by sequences obtained from human germline immunoglobulin sequences and partly from other sequences. Said other sequences are preferably germline immunoglobulins from other species, more preferably from other mammalian species.
  • a humanised antibody may be an antibody in which the antigen binding site is derived from an immunoglobulin from a non-human species, preferably from a non-human mammal, e.g. from a mouse or a rat, whereas some or all of the remaining immunoglobulin-derived parts of the molecule is derived from a human immunoglobulin.
  • the antigen binding site from said non-human species may for example consist of a complete V L or V H or both or one or more CDRs grafted onto appropriate human framework regions in V L or V H or both.
  • the CDRs can be from a mouse or rat monoclonal antibody and the other regions of the antibody are of human origin.
  • Antigen binding fragments of antibodies are fragments of antibodies retaining the ability to specifically bind to an antigen.
  • said fragment is an antigen binding fragment of a naturally occurring antibody.
  • antigen binding fragments of naturally occurring antibodies include for example (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and Cm domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and Cm domains; (iv) a Fv fragment consisting of the V
  • Fab fragments may be prepared by papain digestion.
  • F(ab') 2 fragments may be prepared by pepsin treatment.
  • the antigen binding fragment of an antibody preferably comprise at least one complementarity determining region (CDR) or more preferably a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
  • CDR complementarity determining region
  • an antigen binding fragment of an antibody is binding-domain immunoglobulin fusion proteins comprising (i) an antigen binding site fused to an immunoglobulin hinge region polypeptide, (ii) an immunoglobulin heavy chain CH2 constant region fused to the hinge region, and (iii) an immunoglobulin heavy chain CH3 constant region fused to the CH2 constant region.
  • the antigen binding site can be a heavy chain variable region or a light chain variable region.
  • the antigen binding fragment of an antibody may also be diabodies, which are small antibody fragments with two antigen-binding sites.
  • Diabodies preferably comprises a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH-VL).
  • VH heavy chain variable domain
  • VL light chain variable domain
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/1 1 161 ; and Hollinger et al., Proc. Natl. Acad Sci. USA 90: 6444-6448 (1993).
  • Antibodies can be produced using antigenic epitope-bearing peptides or polypeptides derived from an SLC4 family or SLC9 family member, in particular NBCnl or NHE1 .
  • Antigenic epitope-bearing peptides and polypeptides of the present invention preferably contain a sequence of at least four, or between 5 and 100, such as between 10 and 100, such as between 15 and 80, for example between 15 and 70, such as between 15 and 60, such as between 15 and 60, such as between 15 and 40, such as between 15 and 30 amino acids contained within NBCnl , such as SEQ ID NO: 1 or 2 or 14, 15 and/or 16.
  • peptides or polypeptides comprising a larger portion of NBCnl , for example containing from 100 amino acids and any length up to and including the entire amino acid sequence of NBCnl are also useful as antigenic epitope-bearing peptides or polypeptides for producing antibodies of the present invention.
  • the antibodies of the present invention are preferably produced using peptides or polypeptides comprising a region of an extracellular loop of NBCnl or a fragment thereof, such as at least four, or between 5 and 100, such as between 10 and 100, such as between 15 and 80, for example between 15 and 70, such as between 15 and 60, such as between 15 and 60, such as between 15 and 40, such as between 15 and 30 amino acids thereof.
  • the antigenic epitope-bearing peptides or polypeptides comprise or consists of:
  • EL4 human: PSPKLHVPEKFEPTHPERGWIISPLGDNPW (SEQ ID NO: 8)
  • EL4 mouse: PSPKLHVPEKFEPTDPSRGWIISPLGDNPW (SEQ ID NO: 9)
  • EL5 human and mouse: SISHVNSLKVESECSAPGEQPKFLGIREQR (SEQ ID NO: 10)
  • GLILDIKRKAPFFLSDFKDALSLQC SEQ ID NO: 1 1
  • any fragment of any of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16 may be also be used, for example a fragment comprising at least four amino acids, such as between 5 and 75, such as between 10 and 75, such as between 15 and 70, for example between 15 and 60, such as between 15 and 60, such as between 15 and 50, such as between 15 and 40, such as between 15 and 30 amino acids thereof.
  • the antibodies are produced using peptides comprising an extracellular polypeptide region of NBCnl and preferably, the extracellular polypeptide region comprises or consists of a sequence selected from any one of SEQ ID NO: 14, 15 and/or 16 or a fragment thereof, such as a fragment of 5-25, such as 10-25, such as 10-20 amino acids thereof.
  • the antigenic epitope-bearing peptides or polypeptides are human, such as SEQ ID NO: 5, 6, 8, 10, 1 1 , 12, 13, 14, 15 and 16.
  • amino acid sequence of the epitope-bearing peptide is selected to provide substantial solubility in aqueous solvents (i.e., the sequence includes relatively hydrophilic residues, while hydrophobic residues are preferably avoided). Moreover, amino acid sequences containing proline residues may also be desirable for antibody production.
  • Recombinant antibodies of the invention may for example be produced using a synthetic library or by phage display, preferably using the extracellular domains of NBCnl to generate antibodies against extracellular domains of NBCnl . Since selection of recombinant antibodies from phage display libraries and synthetic libraries do not build on immunogenicity principles, but solely on binding ability, it is capable of providing antibodies that bind to a more diverse array of epitopes. For example, antibodies binding to synthetic peptides corresponding to surface exposed regions of NBCnl can be isolated. Next, antibodies binding to cells with high expression levels of NBCnl may be isolated. The first step may follow any conventional selection protocol (e.g. Mandrup OA, Friis NA, Lykkemark S, Just J and Kristensen P.
  • any conventional selection protocol e.g. Mandrup OA, Friis NA, Lykkemark S, Just J and Kristensen P.
  • Recombinant antibodies may be produced in microbial host organisms, such as bacteria, yeast or cell cultures of cells derived from multicellular organisms. Frequently, Escherichia coli is useful as host organism. Frequently, recombinant antibodies are fragments of naturally occurring antibodies comprising at least one antigen binding site, such as a Fab fragment, a Fv fragment or the recombinant antibody is a scFV.
  • Recombinant antibodies may be identified using various systems, such as phage display or ribosome display.
  • the present invention relates to methods of producing antibodies targeting extracellular regions of NBCnl using phage display.
  • the starting point of phage display is usually a library of antibodies, such as single chain antibodies or fragments of naturally occurring antibodies expressed by a phage.
  • Various different kinds of phages are suitable for use in phage display, e.g. M13, fd filamentous phage, T4, T7 or ⁇ phage. Phagemids may also be used, but that usually requires use of a helper phage.
  • the library comprises in the range of 10 7 to 10 15 , such as 10 9 to 10 11 different phages.
  • the antibodies may be either of native or immune origin.
  • the antibodies of the library may be fused to a phage coat protein (e.g. g3p or g8p) in order to ensure display on the surface.
  • fragment may be encoded by a nucleic acid sequence, which is cloned upstream or downstream of a nucleic acid encoding a phage coat protein, which is operably linked to a suitable promoter.
  • the genomic information coding for antibody e.g. for the antibody variable domains may be obtained from B cells of non-immunised or immunised donors using recombinant DNA technology to amplify the VH and VL gene segments and cloning into an appropriate phage.
  • Synthetic libraries may be prepared by rearranging VH and VL gene segments in vitro and/or by introducing artificial sequences into VH and VL gene segments.
  • synthetic libraries may be prepared using a VH and VL gene framework, but introducing into this artificial complementarity determining regions (CDRs), which may be encoded by random oligonucleotides.
  • CDRs complementarity determining regions
  • the library may also be different libraries, which are then combined in the host cell.
  • one library may comprise heavy chain sequences, such as the heavy chain Fv fragment or Fab fragment or VH and the other light chain sequences, such as the light chain Fv fragment or Fab fragment VL.
  • rounds of selection e.g. 2, 3, 4, 5 or 5, such as 2 to 5 or 2 to 4 or 2 to 3 rounds of selection are performed.
  • This may be done by immobilising the antigen, contacting the antigen with the phage and isolation of bound phages.
  • the antigen may be immobilised on any suitable solid surface, such as a plastic surface, beads (such as magnetic beads)
  • an antibody useful in the therapeutic methods and uses provided herein can be produced and selected in a method comprising the steps of a) Providing an antibody library, preferably a bacteriophage library, which may comprise in the range of 10 7 to 10 15 , such as 10 9 to 10 11 , different phages b) Providing one or more antigens of a gene product of the SLC4A or SLC9A
  • NHE1 or NBCnl antigens preferably an antigen of an
  • the method may comprise additional rounds of selection, such as 2, 3, 4, 5, 5 rounds of selection or more, where a library consisting of the selected antibodies in step d) are contacted with the antigen and again selecting antibodies, which bind the respective antigen.
  • additional rounds of selection such as 2, 3, 4, 5, 5 rounds of selection or more
  • the method comprises repeating steps a) -d) once or twice or more, preferably 1 , 2, 3 times, where the antibody library in step a) of additional rounds corresponds to the antibodies selected in step d) of the previous round.
  • the antibodies of the library are in one embodiment selected for their ability to bind peptides or polypeptide fragments of a gene product of the SLC4A or SLC9A families, such as NHE1 or NBCnl , in particular extracellular fragments (e.g. a polypeptide region comprising a sequence selected from any one of SEQ ID NO: 5-10 or SEQ ID NO: 14-16 or a fragment thereof), or the full-length protein, preferably natively folded.
  • the antigens are immobilized on a solid surface, for example on solid beads.
  • the provided antigen may be provided as epithelial organoids, for example, epithelial organoids of breast cancer tissue.
  • the antigens are provided as epithelial organoids and suitable antibodies are selected by their binding ability to antigens presented on these epithelial organoids.
  • suitable antibodies can be identified based on the different binding abilities to epithelial organoids of breast cancers from e.g. NBCnl KO and WT mice.
  • Polyclonal antibodies to recombinant protein or isolated from natural sources can be prepared using methods well-known to those of skill in the art. See, for example, Green et al., “Production of Polyclonal Antisera,” in Immunochemical Protocols (Manson, ed.), pages 1 to 5 (Humana Press 1992), and Williams et al., "Expression of foreign proteins in E. coli using plasmid vectors and purification of specific polyclonal antibodies," in DNA Cloning 2: Expression Systems, 2nd Edition, Glover et al. (eds.), page 15 (Oxford University Press 1995).
  • the immunogenicity of a polypeptide can be increased through the use of an adjuvant, such as alum (aluminum hydroxide) or Freund's complete or incomplete adjuvant.
  • Polypeptides useful for immunization also include fusion polypeptides, such as fusions of or a portion thereof with an immunoglobulin polypeptide or with maltose binding protein.
  • the polypeptide immunogen may be a full- length molecule or a portion thereof. If the polypeptide portion is "hapten-like,” such portion may be advantageously joined or linked to a macromolecular carrier (such as keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) or tetanus toxoid) for immunization.
  • KLH keyhole limpet hemocyanin
  • BSA bovine serum albumin
  • tetanus toxoid tetanus toxoid
  • polyclonal antibodies are typically raised in animals such as horses, cows, dogs, chicken, rats, mice, rabbits, guinea pigs, goats, or sheep
  • an antibody specific for a polypeptide according to the present invention may also be derived from a subhuman primate antibody.
  • General techniques for raising diagnostically and therapeutically useful antibodies in baboons may be found, for example, in Goldenberg et al., international patent publication No. WO 91/1 1465, and in Losman et al., Int. J. Cancer 46:310 (1990).
  • the antibodies or antigen binding fragments provided herein specifically recognize and bind a gene product of the SLC4 or SLC9 families, such as NHE1 or NBCnl antigens, in particular an extracellular polypeptide region.
  • Such antibodies and antigen binding fragment thereof can be produced by known methods and/or methods described elsewhere herein. Suitable antibodies and antigen binding fragment thereof can be tested in a number of different assays. In particular, the binding abilities of an isolated antibody or antigen binding fragment thereof can be determined in an ELISA assay.
  • the antibody or antigen binding fragment thereof provided herein is capable of displacing one or more reference antibodies in a competitive ELISA assay.
  • suitable antibodies and antigen binding fragment thereof can be analysed by immunoblotting, typically where isolated organoid membranes are incubated with the candidate antibody as primary antibody, and following washing detected by incubating with a detectable secondary antibody, which is typically conjugated to horseradish peroxidase for detection.
  • Suitable antibodies and antigen binding fragment thereof can also be analysed by immunohistochemistry. For example paraffin-embedded sections of breast tissue can be used and incubated with the candidate antibodies for NBCnl , and antigen binding can subsequently be detected by incubation with a detectable secondary antibody, which is typically conjugated to horseradish peroxidase.
  • the function of suitable antibodies or antigen binding fragment thereof may also be determined on the basis of their ability to inhibit Na7HC0 3 " co-transport and/or Na7H + exchange.
  • the antibody or antigen binding fragment thereof provided herein is capable of inhibiting cellular Na7HC0 3 " co-transport and/or Na7H + exchange, e.g.
  • NBCnl -mediated Na + -dependent HC0 3 " transport or NHE1 mediated Na7H + exchange One approach could be to test the ability to inhibit Na7HC0 3 " co- transport and/or Na7H + exchange in cells, for example in cancer cells, such as epithelial breast cancer organoids.
  • NBCnl is involved in maintaining cellular pH and in particular in avoiding low pH in cancer cells. Therefore, the function of antibodies and antigen binding fragments thereof in recognizing and binding NBCnl and inhibiting cellular Na + -dependent HC0 3 " transport can be determined by measuring intracellular pH in human cells and for example mice cells from NBCnl KO vs. WT mice.
  • Intracellular pH can also be determined in human cancer cell lines, such as MCF7.
  • the intracellular pH may be determined in organoids from human and/or mice NBCnl KO vs. WT, preferably in epithelial breast cancer organoids.
  • Antibodies or antigen binding fragments thereof, for which the intracellular pH is decreased when supplied to cells or organoids, are functional as NBCnl inhibitors, and are
  • Intracellular pH can be determined as described in the example.
  • pH can be determined as recovery of pH, from acidosis in isolated organoids loaded with BCECF-AM.
  • Epifluorescence is typically measured with a camera-based fluorescence imaging system during alternating excitation at approximately 485 and 440 nm.
  • the 485/440 BCECF fluorescence ratio can be converted to pH, using the high-[K + ] nigericin calibration technique.
  • Intracellular acidification can be induced with the NH 4 + prepulse technique, and acid-base transport activities calculated as the product of the pH, recovery rate and the buffering capacity of that same organoid.
  • Intracellular buffering capacity can be calculated based on the change in pH, upon washout of NH 4 CI with the assumption that NH 3 is in equilibrium across cell membranes.
  • the therapeutic methods and uses provided herein may involve administration or provision of a therapeutic agent, in particular modulators of Na7HC0 3 " co-transport and/or Na + /H + exchange to a patient.
  • modulators are preferably inhibitors and may be chosen from antibodies, peptides and small molecules, such as cariporide for inhibition of Na7H + exchange.
  • any suitable route of administration may be employed for providing a human being with an effective dose of a peptide, small molecule or an antibody or antigen binding fragment thereof as provided herein.
  • oral, rectal, vaginal, topical, parenteral, ocular, pulmonary, nasal, and the like may be employed.
  • Other examples of administration include sublingual, intravenous, intramuscular, intrathecal, subcutaneous, cutaneous and transdermal administration.
  • the administration comprises inhalation, injection or implantation.
  • the administration of the compound according to the present invention can result in a local (topical) effect or a body-wide (systemic) effect.
  • the antibody or antigen binding fragment thereof is administered by intravenous injection/infusion.
  • Dosage forms include tablets, troches, dispersions, suspensions, solutions, capsules, creams, ointments, aerosols, and the like.
  • compounds of the invention are administered orally or intravenously.
  • the effective dose employed of a peptide, small molecule or an antibody or antigen binding fragment thereof may vary depending on the particular compound, the mode of administration, the condition being treated and the severity of the condition being treated. Such dosage may be ascertained readily by a person skilled in the art.
  • a peptide, small molecule or an antibody or antigen binding fragment thereof of the present invention is administered at a dosage of from about 0.1 milligram to about 100 milligram per kilogram of body weight.
  • the total dosage is from about 1 .0 milligrams to about 1000 milligrams, preferably from about 1 milligram to about 50 milligrams.
  • the total dose will generally be from about 1 milligram to about 350 milligrams.
  • the dosage for an adult human may be as low as 0.1 mg.
  • the dosage regimen may be adjusted within this range or even outside of this range to provide the optimal therapeutic response.
  • the weekly dosage of a peptide, small molecule or an antibody or antigen binding fragment thereof is preferably 4-8 mg/kg bodyweight.
  • weekly dosage may vary over the course of treatment.
  • an effective dose of a peptide, small molecule or an antibody or antigen binding fragment thereof may be administered as an initial loading dose of 4-8 mg/kg bodyweight and subsequent doses of 1 -5 mg/kg bodyweight, where e.g. the initial loading dose is administered in week 1 , and the subsequent doses are administered weekly in the following weeks.
  • a complete course of treatment should preferably result in a total dose of 20-300 mg/kg bodyweight; more preferred 50-200 mg/kg bodyweight, such as about 1 10 mg/kg bodyweight regardless of the dosing regimen employed.
  • the effective dose is preferably infused intravenously, for example by infusion in 5-180 minutes, preferably between 10 and 120 minutes, such as between 30 and 90 minutes.
  • Biopsies of human breast cancer and normal breast tissue were sampled from women undergoing breast-conserving breast cancer surgery at Regionshospitalet Randers, Denmark.
  • the included patients had breast tumors larger than 10 mm, were 35 to 85 years of age, and presented with surgically operable breast cancer diagnosed by triple- test (i.e., clinical examination, mammography, and ultrasonography of the breast combined with fine needle aspiration cytology and/or core needle biopsy).
  • triple- test i.e., clinical examination, mammography, and ultrasonography of the breast combined with fine needle aspiration cytology and/or core needle biopsy.
  • the clinical and pathological characteristics of the included patients were evaluated as part of the standard treatment and pathological evaluation.
  • Epithelial organoids were isolated from the primary breast cancer and normal breast tissue using the following procedure [6]: tissue samples were cut into 1 mm large pieces in phosphate-buffered saline containing (in mM): 154.2 Na + , 4.1 K + , 140.6 CI “ , 8.1 HP0 4 2" , and 1.5 H 2 P0 4 " ; pH 7.4. The tissue was then transferred to Tissue Culture Flat Tubes (Techno Plastic Products AG) containing advanced DMEM/F12 culture medium (Life Technologies, Denmark) supplemented with 10% fetal bovine serum (Biochrom AG, Germany) and a final concentration of 450 lU/mL collagenase type 3 (Worthington Biochemical Corporation, NJ, USA).
  • the culture flasks were then transferred to a shaking incubator (at -60 revolutions per minute) and left overnight in an atmosphere of 5% C0 2 at 37°C.
  • portions of the tissue suspensions were transferred to Eppendorf tubes and organoids were allowed to sediment for 20 minutes in the incubator without shaking.
  • intracellular pH recordings were performed on freshly isolated organoids directly without cell culture.
  • Intracellular intrinsic buffering capacity was calculated based on the change in intracellular pH upon addition and washout of NH 4 CI in absence of C0 2 /HC0 3 " .
  • the C0 2 /HC0 3 " -containing salt solution used for intracellular pH recordings had the following composition (in mM): 140 Na + , 4 K + , 1 .6 Ca 2+ , 1 .2 Mg 2+ , 122 CI " , 24 HC0 3 " , 1 .2 S0 4 2” , 1.18 H 2 P0 4 ⁇ , 10 HEPES, 5.5 glucose, and 0.03 EDTA.
  • Na + -free solutions Na + was substituted with an equimolar amount of /V-methyl-D-glucammonium
  • NMDG + except for NaHC0 3 , which was replaced with choline-HC0 3 .
  • HC0 3 ⁇ -free solutions HC0 3 ⁇ was substituted with an equimolar amount of Cl ⁇ .
  • HC0 3 ⁇ -containing solutions were aerated with a gas mixture of 5% C0 2 balance air, HC0 3 ⁇ -free solutions were gassed with atmospheric air (nominally C0 2 -free); pH was adjusted to 7.4 at 37°C. All solutions contained 5 mM probenecid to inhibit cellular extrusion of BCECF by the organic anion transporter.
  • Na + ,HC0 3 " -cotransport is observed as an ability of cells to recover intracellular pH faster and/or at more alkaline intracellular pH levels when C0 2 /HC0 3 " is present during the NH 4 + -prepulse experiments ( Figure 1A,B).
  • the NaVhT-exchange activity can be evaluated based on the Na + -dependent intracellular pH recovery in the absence of C0 2 /HC0 3 " (Fig. 1 A,B).
  • Our findings support that Na + ,HC0 3 " -cotransport (NBCnl ) and Na7H + -exchange (NHE1 ) are the major acid-base transporters responsible for net acid extrusion in breast cancer tissue.
  • HER2 receptors and HER2 gene amplification are important prognostic factors in human breast cancer tissue and determine whether targeted therapy against the HER2 receptor (e.g., the monoclonal antibody trastuzumab) is a therapeutic option.
  • targeted therapy against the HER2 receptor e.g., the monoclonal antibody trastuzumab
  • the intracellular pH regulatory function in breast cancer tissue depends on the HER2 status: HER2-positive breast cancer tissue has a much higher Na + ,HC0 3 " -cotransport activity than HER2-negative breast cancer tissue (Fig. 2A,C), and this higher C0 2 /HC0 3 " -dependent net acid extrusion is also reflected in a larger C0 2 /HC0 3 " -dependent elevation of steady-state intracellular pH (Fig. 2A,E).
  • the present example shows that the relative contribution from Na + ,HC0 3 " -cotransport and Na7H + -exchange to intracellular pH control can be evaluated in breast tissue biopsies from women with breast cancer. Using the same approach, it will also be possible to assess the contribution from other acid-base transporters (e.g., H + -
  • Acid-base transporters are potential targets for anti-cancer therapy and information regarding the relative contribution from different acid-base transporters to intracellular pH control is valuable for identifying patients most likely to respond to pharmacological therapy targeting acid-base transport.
  • targeted therapies e.g., anti-HER2 or anti-estrogen
  • RNA- and protein expression levels are poor correlates for functional activity, a more qualified prediction of treatment responses can be made based on analyses of the functional contribution of the protein.
  • breast cancer tissue from women with lymph node metastases differs in intracellular pH regulatory function from breast cancer tissue obtained from women without lymph node metastases: the contribution from
  • Na + ,HC0 3 " -cotransport to net acid extrusion and intracellular steady-state pH regulation is low in the primary breast cancer tissue and normal breast tissue from women with metastatic dissemination to regional lymph nodes.
  • the difference in intracellular pH regulation in normal breast tissue shows that variation in normal tissue function can predispose to metastatic breast cancer disease.
  • a link between acid-base transporter function and cancer metastasis is possible and it is noted that the net acid extrusion from cells can contribute to local extracellular acidification, which can facilitate degradation of extracellular matrix components.
  • Acid-base transporters can also establish intracellular and extracellular pH gradients between the leading and rear end of migrating cells, which can promote cell migration by coordinating cytoskeletal rearrangement and interaction between cells and the extracellular matrix.
  • biopsies from women with breast cancer can be used to evaluate the contribution from specific acid-base transport mechanisms to intracellular pH control in normal breast tissue and primary breast carcinomas. This information can be used to
  • Na + ,HC0 3 " -cotransport is observed as an ability of cells to recover intracellular pH faster and/or at more alkaline intracellular pH levels when C0 2 /HC0 3 " is present during the NH 4 + -prepulse experiments (Fig. 7A,B).
  • the Na7H + -exchange activity can be evaluated based on the Na + -dependent intracellular pH recovery in the absence of CO2/HCO 3 " (Fig. 7A,B).
  • Our findings support that Na + ,HC0 3 " -cotransport (NBCnl ) and Na7H + -exchange (NHE1 ) are the major acid-base transporters responsible for net acid extrusion in breast cancer tissue.
  • HER2 receptors and HER2 gene amplification are important prognostic factors in human breast cancer tissue and determine whether targeted therapy against the HER2 receptor (e.g., the monoclonal antibody trastuzumab) is a therapeutic option.
  • targeted therapy against the HER2 receptor e.g., the monoclonal antibody trastuzumab
  • HER2-positive breast cancer tissue Fig. 8A,D
  • Fig. 8B,E HER2-negative breast cancer tissue
  • C0 2 /HC0 3 " -dependent net acid extrusion is also reflected in a larger C0 2 /HC0 3 " -dependent elevation of steady-state intracellular pH (Fig. 8C).
  • Estrogen receptors are usually expressed in breast tissue but may become
  • Estrogen receptors can be targeted
  • estrogen receptor modulators e.g., tamoxifen
  • tamoxifen e.g., tamoxifen
  • Fig. 9 C0 2 /HC0 3 ⁇ -dependent and - independent acid-base transport mechanisms contribute to net base uptake (Fig 9A,B,D,E); but at low intracellular pH, Na + ,HC0 3 " -cotransport is accentuated in estrogen receptor negative compared to estrogen receptor positive breast cancer tissue.
  • Estrogen receptor expression does not significantly affect steady-state intracellular pH (Fig. 9C).
  • the present example shows that the relative contribution from Na + ,HC0 3 " -cotransport and Na7H + -exchange to intracellular pH control can be evaluated in breast tissue biopsies from women with breast cancer. Using the same approach, it will also be possible to assess the contribution from other acid-base transporters (e.g., H + - ATPases and monocarboxylate transporters) if appropriate transport inhibitors are applied.
  • acid-base transporters e.g., H + - ATPases and monocarboxylate transporters
  • Acid-base transporters are potential targets for anti-cancer therapy and information regarding the relative contribution from different acid-base transporters to intracellular pH control is valuable for identifying patients most likely to respond to pharmacological therapy targeting acid-base transport.
  • targeted therapies e.g., anti-HER2 or anti-estrogen
  • RNA- and protein expression levels are poor correlates for functional activity, a more qualified prediction of treatment responses can be made based on analyses of the functional contribution of the protein.
  • the present example shows that primary breast tumors from women with lymph node metastases differ in intracellular pH regulatory function from primary breast tumors from women without lymph node metastases: the contribution from Na + ,HC0 3 ⁇ - cotransport to net acid extrusion and intracellular steady-state pH regulation is low in the primary breast cancer tissue from women with metastatic dissemination to regional lymph nodes.
  • the difference in intracellular pH regulation in primary breast tumor tissue supports that variation in acid-base transport function can facilitate
  • Acid-base transporters can also establish intracellular and extracellular pH gradients between the leading and rear end of migrating cells, which can promote cell migration by coordinating cytoskeletal rearrangement and interaction between cells and the extracellular matrix.
  • biopsies from women with breast cancer can be used to evaluate the contribution from specific acid-base transport mechanisms to intracellular pH control in normal breast tissue and primary breast carcinomas. This information can be used to
  • Human NBCnl DNA sequence variant a cloned from breast cancer tissue.
  • the underlined 5 ' -region indicates a region, which differs from SEG ID NO: 2.
  • Human NBCnl DNA sequence variant b cloned from breast cancer tissue The underlined 5 ' -region indicates a region, which differs from SEG ID NO: 1.
  • NBCn1_EL3h1.1 [Hz]-HNNLDKLTSYSCVCTEPPNPSNETLAQWKKDNITA-amide (SEQ ID NO: 14)
  • NBCn1_EL3h2.1 [Hz]-LAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSA-amide (SEQ ID NO: 15).
  • NBCn1_EL3h3.1 CTEPPNPSNETLAQWKKDNITAHNISWRNLTVSE-amide (SEQ ID NO: 16).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Chemical & Material Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Cell Biology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Ecology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

La présente invention concerne des procédés et des utilisations pour diagnostiquer, pronostiquer et traiter le cancer du sein par détermination de l'activité de co-transport de Na+/HCO3 – et/ou l'activité d'échange Na+/H+ dans des cellules d'un échantillon d'un patient, et la détermination de l'importance relative du co-transport de Na+/HCO3 – co-transport et/ou l'échange Na+/H+ pour la régulation du pH intracellulaire et comparaison d'une valeur prédéterminée déterminant le diagnostic, le pronostic et le traitement.
PCT/EP2017/073896 2016-09-21 2017-09-21 Inhibiteurs de transport acidobasique WO2018055031A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DKPA201670746 2016-09-21
DKPA201670746 2016-09-21

Publications (1)

Publication Number Publication Date
WO2018055031A1 true WO2018055031A1 (fr) 2018-03-29

Family

ID=60001882

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/073896 WO2018055031A1 (fr) 2016-09-21 2017-09-21 Inhibiteurs de transport acidobasique

Country Status (1)

Country Link
WO (1) WO2018055031A1 (fr)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0404097A2 (fr) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Récepteurs mono- et oligovalents, bispécifiques et oligospécifiques, ainsi que leur production et application
WO1991011465A1 (fr) 1990-01-26 1991-08-08 Immunomedics, Inc. Vaccins contre le cancer et des maladies infectieuses
WO1993011161A1 (fr) 1991-11-25 1993-06-10 Enzon, Inc. Proteines multivalentes de fixation aux antigenes
US20030118592A1 (en) 2001-01-17 2003-06-26 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US20030133939A1 (en) 2001-01-17 2003-07-17 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0404097A2 (fr) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Récepteurs mono- et oligovalents, bispécifiques et oligospécifiques, ainsi que leur production et application
WO1991011465A1 (fr) 1990-01-26 1991-08-08 Immunomedics, Inc. Vaccins contre le cancer et des maladies infectieuses
WO1993011161A1 (fr) 1991-11-25 1993-06-10 Enzon, Inc. Proteines multivalentes de fixation aux antigenes
US20030118592A1 (en) 2001-01-17 2003-06-26 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US20030133939A1 (en) 2001-01-17 2003-07-17 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins

Non-Patent Citations (23)

* Cited by examiner, † Cited by third party
Title
ANNE PODER ANDERSEN ET AL: "Roles of acid-extruding ion transporters in regulation of breast cancer cell growth in a 3-dimensional microenvironment", MOLECULAR CANCER, vol. 15, no. 1, 6 June 2016 (2016-06-06), XP055429128, DOI: 10.1186/s12943-016-0528-0 *
E. BOEDTKJER ET AL: "Physiology, Pharmacology and Pathophysiology of the pH Regulatory Transport Proteins NHE1 and NBCn1: Similarities, Differences, and Implications for Cancer Therapy", CURRENT PHARMACEUTICAL DESIGN, vol. 18, no. 10, 1 April 2012 (2012-04-01), NL, pages 1345 - 1371, XP055149666, ISSN: 1381-6128, DOI: 10.2174/138161212799504830 *
EBBE BOEDTKJER ET AL: "Contribution of Na + ,HCO 3 - -cotransport to cellular pH control in human breast cancer: A role for the breast cancer susceptibility locus NBCn1 (SLC4A7)", INTERNATIONAL JOURNAL OF CANCER, vol. 132, no. 6, 15 March 2013 (2013-03-15), US, pages 1288 - 1299, XP055429586, ISSN: 0020-7136, DOI: 10.1002/ijc.27782 *
ELLEN FRIDAY ET AL: "Role of Epidermal Growth Factor Receptor (EGFR)-Signaling Versus Cellular Acidosis Via Na+/H+ Exchanger1(NHE1)-Inhibition in Troglitazone-Induced Growth Arrest of Breast Cancer- Derived Cells MCF-7", CELLULAR PHYSIOLOGY AND BIOCHEMISTRY., vol. 20, no. 6, 30 October 2007 (2007-10-30), CH, pages 751 - 762, XP055429055, ISSN: 1015-8987 *
GITTE LAURITZEN ET AL: "The Na+/H+ exchanger NHE1, but not the Na+, cotransporter NBCn1, regulates motility of MCF7 breast cancer cells expressing constitutively active ErbB2", CANCER LETTERS, vol. 317, no. 2, 1 April 2012 (2012-04-01), US, pages 172 - 183, XP055150071, ISSN: 0304-3835, DOI: 10.1016/j.canlet.2011.11.023 *
GLOVER ET AL.: "DNA Cloning 2: Expression Systems, 2nd Edition,", 1995, OXFORD UNIVERSITY PRESS, article WILLIAMS ET AL.: "Expression of foreign proteins in E. coli using plasmid vectors and purification of specific polyclonal antibodies", pages: 15
GREENBERG, A. S.; AVILA, D.; HUGHES, M.; HUGHES, A.; MCKINNEY, E. C.; FLAJNIK, M. F., NATURE, vol. 374, 1995, pages 168 - 173
HOLLINGER ET AL., PROC. NATL. ACAD SCI. USA, vol. 90, 1993, pages 6444 - 6448
J. L. WALLACE ET AL: "The effect of 17-[beta] oestradiol, resveratrol, and genistein on Na+/H+ exchange in breast cancer cells lines", PROCEEDINGS OF THE NUTRITION SOCIETY, vol. 71, no. OCE1, 1 January 2012 (2012-01-01), GB, XP055429206, ISSN: 0029-6651, DOI: 10.1017/S0029665112000389 *
KRISTINE GLUNDE ET AL: "Extracellular Acidification Alters Lysosomal Trafficking in Human Breast Cancer Cells", NEOPLASIA, vol. 5, no. 6, 1 November 2003 (2003-11-01), US, pages 533 - 545, XP055429571, ISSN: 1476-5586, DOI: 10.1016/S1476-5586(03)80037-4 *
LAURITZEN G ET AL: "NBCn1 and NHE1 expression and activity in @DNErbB2 receptor-expressing MCF-7 breast cancer cells: Contributions to pH"i regulation and chemotherapy resistance", EXPERIMENTAL CELL RESEARCH, ELSEVIER, AMSTERDAM, NL, vol. 316, no. 15, 10 September 2010 (2010-09-10), pages 2538 - 2553, XP027166206, ISSN: 0014-4827, [retrieved on 20100611] *
LOSMAN ET AL., INT. J. CANCER, vol. 46, 1990, pages 310
MANDRUP OA; FRIIS NA; LYKKEMARK S; JUST J; KRISTENSEN P: "A novel heavy domain antibody library with functionally optimized complementarity determining regions", PLOS ONE, vol. 8, 2013, pages e76834, XP055084673, DOI: doi:10.1371/journal.pone.0076834
MANSON,: "Immunochemical Protocols", 1992, HUMANA PRESS, article GREEN ET AL.: "Production of Polyclonal Antisera", pages: 1 - 5
S. R. AMITH ET AL: "Regulation of the Na+/H+ Exchanger (NHE1) in Breast Cancer Metastasis", CANCER RESEARCH, vol. 73, no. 4, 7 February 2013 (2013-02-07), US, pages 1259 - 1264, XP055429575, ISSN: 0008-5472, DOI: 10.1158/0008-5472.CAN-12-4031 *
SCHAMMIM R. AMITH ET AL: "Na+/H+ exchange in the tumour microenvironment: does NHE1 drive breast cancer carcinogenesis?", INTERNATIONAL JOURNAL OF DEVELOPMENTAL BIOLOGY., vol. 59, no. 7-8-9, 1 January 2015 (2015-01-01), ES, pages 367 - 377, XP055429186, ISSN: 0214-6282, DOI: 10.1387/ijdb.140336lf *
SCHAMMIM RAY AMITH ET AL: "Assessing Na+/H+ exchange and cell effector functionality in metastatic breast cancer", BIOCHIMIE OPEN, vol. 2, 1 June 2016 (2016-06-01), pages 16 - 23, XP055429687, ISSN: 2214-0085, DOI: 10.1016/j.biopen.2016.01.001 *
SCHAMMIM RAY AMITH ET AL: "KR-33028, a potent inhibitor of the Na+/H+ exchanger NHE1, suppresses metastatic potential of triple-negative breast cancer cells", BIOCHEMICAL PHARMACOLOGY, vol. 118, 10 August 2016 (2016-08-10), US, pages 31 - 39, XP055429195, ISSN: 0006-2952, DOI: 10.1016/j.bcp.2016.08.010 *
SCHAMMIM RAY AMITH ET AL: "The Na+/H+ exchanger (NHE1) as a novel co-adjuvant target in paclitaxel therapy of triple-negative breast cancer cells", ONCOTARGET, vol. 6, no. 2, 26 November 2014 (2014-11-26), pages 1262 - 1275, XP055429676, DOI: 10.18632/oncotarget.2860 *
SORENSEN MD; AGERHOLM IE; CHRISTENSEN B; KOLVRAA S; KRISTENSEN P: "Microselection--affinity selecting antibodies against a single rare cell in a heterogeneous population", J CELL MOL MED, vol. 14, 2010, pages 1953 - 1961
SORENSEN MD; KRISTENSEN P: "Selection of antibodies against a single rare cell present in a heterogeneous population using phage display", NAT PROTOC, vol. 6, 2011, pages 509 - 522
SORENSEN MD; MELCHJORSEN CJ; MANDRUP OA; KRISTENSEN P: "Raising antibodies against circulating foetal cells from maternal peripheral blood", PRENAT DIAGN, vol. 33, 2013, pages 284 - 291
WARD, NATURE, vol. 341, 1989, pages 544 - 546

Similar Documents

Publication Publication Date Title
US10775383B2 (en) PD-L1 antibodies and uses thereof
US10273308B2 (en) Methods of producing antibodies specific for p95
US10620211B2 (en) Histochemical assay for evaluating expression of programmed death ligand 1 (PD-L1)
EP1874823B1 (fr) Anticorps de l'isoforme de l'antigene nucleaire des cellules proliferatives cancereuses specifiques (pcnacs) et leurs utilisations
KR101976219B1 (ko) 유방암의 바이오마커
JP2006510008A (ja) アクチビンβＣのレベルの調節によって特徴付けられる状態のための診断方法、治療方法、および有用な薬剤
WO2011090166A1 (fr) Marqueur de cancer de l'œsophage
US20150093331A1 (en) Biomarkers for breast cancer
US20210324059A1 (en) Monoclonal antibodies against ambra-1
CN113677994A (zh) 用于评估t细胞功能和预测对疗法的应答的方法和药剂
US20160341733A1 (en) Detection and treatment of cancer
EP3203238A1 (fr) Réactifs permettant de détecter ou de diagnostiquer des cellules cancéreuses à capacité invasive élevée
US20100190199A1 (en) Gpr30 estrogen receptor in breast and ovarian cancers
EP3690051A1 (fr) Anticorps monoclonal anti-ckap4
JPWO2009044561A1 (ja) 抗ｐｒｏＮＴ／ＮＭＮモノクローナル抗体
WO2018055031A1 (fr) Inhibiteurs de transport acidobasique
US20210396758A1 (en) Monoclonal antibodies against loricrin
EP4403581A1 (fr) Anticorps anti-ck2 alpha ou fragment de celui-ci

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17777827

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17777827

Country of ref document: EP

Kind code of ref document: A1