WO2017223405A1 - Anti-polyubiquitin multispecific antibodies - Google Patents

Anti-polyubiquitin multispecific antibodies Download PDF

Info

Publication number
WO2017223405A1
WO2017223405A1 PCT/US2017/038940 US2017038940W WO2017223405A1 WO 2017223405 A1 WO2017223405 A1 WO 2017223405A1 US 2017038940 W US2017038940 W US 2017038940W WO 2017223405 A1 WO2017223405 A1 WO 2017223405A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
antibody
hvr
heavy chain
Prior art date
Application number
PCT/US2017/038940
Other languages
French (fr)
Inventor
Vishva Dixit
Marissa MATSUMOTO
Erick CASTELLANOS
Original Assignee
Genentech, Inc.
F. Hoffmann-La Roche Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech, Inc., F. Hoffmann-La Roche Ag filed Critical Genentech, Inc.
Priority to EP17735332.3A priority Critical patent/EP3475298A1/en
Priority to JP2018566289A priority patent/JP7133477B2/en
Priority to CN201780050175.5A priority patent/CN109563160B/en
Priority to CN202310104155.9A priority patent/CN116143918A/en
Publication of WO2017223405A1 publication Critical patent/WO2017223405A1/en
Priority to US16/211,669 priority patent/US11274145B2/en
Priority to US17/576,344 priority patent/US20220242938A1/en
Priority to JP2022089497A priority patent/JP2022130392A/en
Priority to JP2024083732A priority patent/JP2024122991A/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854—Immunoglobulins
    • G01N33/6857—Antibody fragments
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41—Glycosylation, sialylation, or fucosylation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/526—CH3 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626—Diabody or triabody
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2440/00—Post-translational modifications [PTMs] in chemical analysis of biological material
    • G01N2440/36—Post-translational modifications [PTMs] in chemical analysis of biological material addition of addition of other proteins or peptides, e.g. SUMOylation, ubiquitination

Definitions

  • the present invention relates to anti-polyubiquitin multispecific antibodies and methods of making and using the same.
  • Ubiquitin is a small protein that has important regulatory roles in a wide variety of cellular pathways. The best known of these is ubiquitin' s role in protein degradation, where covalent attachment of ubiquitin to a target protein enables that targeted protein to be recognized and destroyed by the 26S proteasome ⁇ see Wilkinson, Semin. Cell Devel. Biol. 11(3): 141-148 (2000)).
  • the covalent attachment of ubiquitin, a 76 amino acid protein, to a target protein is a three-step enzymatic process (Pickart, Annu. Rev. Biochem. 70: 503-533 (2001)).
  • ubiquitin-activating enzyme El forms an ubiquitin-El thioester in an ATP-dependent reaction.
  • the ubiquitin is transferred from the ubiquitin-El thioester to a member of the ubiquitin- conjugating enzyme (E2) family in the second step.
  • E3 ubiquitin-protein ligase
  • an isopeptide bond is formed between the carboxyl terminus of ubiquitin and the ⁇ -amino group of a lysine residue on the target protein.
  • Enzymes termed deubiquitinases remove ubiquitin moieties from target proteins (Guterman and Glickman, Curr. Prot. Pep. Sci. 5: 201-210 (2004)).
  • Ubiquitin contains seven lysine residues (Lys6, Lysl 1, Lys27, Lys33, Lys29, Lys48, and Lys63), and thus ubiquitin itself may serve as a target protein for ubiquitination (Peng et a/., Nat. Biotechnol. 21 : 921-926 (2003); Pickart and Fushman, Curr. Opin. Chem. Biol. 8:610-616 (2004)).
  • the molecule produced upon ubiquitination of a ubiquitin protein is termed a polyubiquitin molecule, and may comprise two or more ubiquitin moieties. Ubiquitination of ubiquitin may theoretically occur at any of the seven lysine residues (Peng et a/., Nat.
  • polyubiquitin is formed via the linear ubiquitin chain assembly complex (LUBAC) which is composed of two ring finger proteins, HOIL-1L and HOIP. Tokunaga et al., Nat. Cell Biol. 11 : 123-132 (2009). It is believed that genetically encoded, unanchored linear polyubiquitin does not exist in cells as its C-terminus is vulnerable to cleavage by isopeptidase T. Iwai and Tokunaga, EMBO Reports 10:706-713 (2009). This observation suggests that linear ubiquitin chain assembly complex (LUBAC) which is composed of two ring finger proteins, HOIL-1L and HOIP. Tokunaga et al., Nat. Cell Biol. 11 : 123-132 (2009). It is believed that genetically encoded, unanchored linear polyubiquitin does not exist in cells as its C-terminus is vulnerable to cleavage by isopeptidase T. Iwai and Tokunaga, EMBO Reports 10:
  • polyubiquitin is assembled onto a substrate protein post-translationally and that conjugated linear polyubiquitin molecules are potential modulators of protein activity and function.
  • linear polyubiquitination of the F- ⁇ essential modulator (NEMO) has been shown to play a role in NF- ⁇ activation. Id.
  • Polyubiquitin chains comprising two or more Ub to Ub linkages (three or more ubiquitin monomers) can have homogeneous or mixed topology.
  • a chain is homogenous if the same residue is modified during the successive steps of elongation, as in the case of uniformly linear (or Metl-), Lysl 1-, Lys48-, or Lys63-linked chains, while a chain has mixed topology if there are different linkages at different positions in the chain.
  • Komander and Rape Annu. Rev. Biochem. 81 :203-29 (2012).
  • a mixed chain may be (but is not necessarily) branched, wherein the same monomer has at least three different linkages (such as linkages to three other ubiquitin monomers, or a linkage to a substrate polypeptide and linkages to two other ubiquitin monomers).
  • linkages such as linkages to three other ubiquitin monomers, or a linkage to a substrate polypeptide and linkages to two other ubiquitin monomers.
  • linkages such as linkages to three other ubiquitin monomers, or a linkage to a substrate polypeptide and linkages to two other ubiquitin monomers.
  • polyubiquitins having different linkages facilitating further examination of the role of such chains in protein degradation and regulation, targeting and modulating mixed-topology polyubiquitin in pathways that involve it, or at least a useful choice.
  • the antibodies can be useful for detection procedures such as immunohistochemistry, Western blotting, immunoprecipitation, ELISA, etc., and functional assays.
  • an antibody with a greater avidity for a mixed-topology polyubiquitin than a single-topology polyubiquitin wherein the mixed-topology polyubiquitin comprises a first linkage and a second linkage, wherein the first linkage and the second linkage differ from one another.
  • an antibody provided herein comprises a first VH/VL unit specific for the first linkage, and a second VH/VL unit specific for the second linkage.
  • the antibody is a knob-in-hole bispecific antibody; a bispecific antibody comprising a leucine zipper; a cross-linked pair of antibodies; an antibody Fc-heterodimeric molecule; a diabody; a triabody; a tetrabody; a single-chain Fv dimer; a trispecific antibody; an octopus antibody; or a dual acting FAb.
  • the first linkage or the second linkage is a Kl 1 linkage.
  • the first linkage or the second linkage is a K48 linkage.
  • the first linkage or the second linkage is a K63-linkage.
  • the first linkage or the second linkage is a C-terminal to N-terminal -linkage.
  • the first linkage and the second linkage are: a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N-terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N-terminal linkage.
  • the antibody comprises a first half antibody that comprises: a) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 14; b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ
  • the antibody comprises a second half antibody that comprises: a) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 14; b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ
  • the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid
  • HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53
  • HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56
  • one of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53
  • HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8; b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95%) sequence identity to SEQ ID NO: 36; or d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8; b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95%) sequence identity to SEQ ID NO: 36; or d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50; wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
  • the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; b) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; c) one of the first and second half antibodies comprises a VL sequence with at least about 9
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8; b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8; b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
  • the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; b) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; c) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; d) one of the first and second half antibodies comprises a VL sequence of SEQ
  • the antibody is a monoclonal antibody. In some embodiments, the antibody is a mouse, rabbit, human, humanized, or chimeric antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the antibody is an IgGl, IgG2a, IgG2b, IgG3, or IgG4 antibody. In some embodiments, the antibody is an IgGl or IgG4 antibody.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a first heavy chain constant region comprising a knob mutation and the second half antibody comprises a second heavy chain constant region comprising a hole mutation; or wherein the first half antibody comprises a first heavy chain constant region comprising a hole mutation and the second half antibody comprises a second heavy chain constant region comprising a knob mutation.
  • the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V. In some embodiments, the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing
  • the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; b) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; c) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2; b) a light chain sequence of SEQ ID NO: 16; c) a light chain sequence of SEQ ID NO: 30; or d) a light chain sequence of SEQ ID NO: 44.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence of SEQ ID NO: 4; b) a heavy chain sequence of SEQ ID NO: 18; c) a heavy chain sequence of SEQ ID NO: 32; or d) a heavy chain sequence of SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence of SEQ ID NO: 6; b) a heavy chain sequence of SEQ ID NO: 20; c) a heavy chain sequence of SEQ ID NO: 34; or d) a heavy chain sequence of SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2; b) a light chain sequence of SEQ ID NO: 16; c) a light chain sequence of SEQ ID NO: 30; or d) a light chain sequence of SEQ ID NO: 44; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence of SEQ ID NO: 4; b) a heavy chain sequence of SEQ ID NO: 18; c) a heavy chain sequence of SEQ ID NO: 32; or d) a heavy chain sequence of SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence of SEQ ID NO: 6; b) a heavy chain sequence of SEQ ID NO: 20; c) a heavy chain sequence of SEQ ID NO: 34; or d) a heavy chain sequence of SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
  • the antibody comprises first and second half antibodies, wherein: a) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; b) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; c) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; d) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • an antibody that competes with an antibody disclosed herein for binding to a mixed-topology polyubiquitin. Also provided herein is an antibody that binds the same epitopes of a mixed-topology polyubiquitin as an antibody disclosed herein.
  • an antibody provided herein is a bispecific antibody.
  • the antibody is a diabody, triabody, or tetrabody.
  • the antibody is conjugated to a label.
  • the label is a fluorescent, enzymatic, or chromogenic label.
  • the label is a radioisotope, which is optionally a positron emitter, which is optionally 89 Zr.
  • composition comprising an antibody disclosed herein, wherein the composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
  • an immunoconjugate comprising an antibody disclosed herein and a cytotoxic agent.
  • a pharmaceutical formulation comprising a
  • composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
  • an isolated nucleic acid encoding: an antibody disclosed herein; a first half antibody of an antibody disclosed herein; or a second half antibody of an antibody disclosed herein.
  • a host cell comprising a nucleic acid disclosed herein.
  • a method of producing an antibody or half-antibody comprising culturing a host cell disclosed herein so that the antibody or half antibody is produced.
  • Also provided herein is a method of making an antibody disclosed herein, comprising forming the antibody from a first half antibody and a second half antibody.
  • the mixed-topology polyubiquitin is covalently attached to a non-ubiquitin polypeptide.
  • the mixed-topology polyubiquitin is branched. In some embodiments, the mixed-topology polyubiquitin is unbranched.
  • the mixed-topology polyubiquitin comprises a first linkage and a second linkage different from the first linkage, and the first and second linkages are each independently a Kl 1, K48, K63, or C-terminal to N-terminal linkage.
  • the mixed-topology polyubiquitin comprises a Kl 1 linkage and a second linkage different from the Kl 1 linkage.
  • the mixed-topology polyubiquitin comprises a K48 linkage and a second linkage different from the K48 linkage.
  • the mixed-topology polyubiquitin comprises a K63 linkage and a second linkage different from the K63 linkage.
  • the mixed-topology polyubiquitin comprises a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage.
  • the mixed-topology polyubiquitin comprises: a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N- terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N-terminal linkage.
  • Also provided herein is a method of detecting a polyubiquitinated protein in a biological sample, the polyubiquitinated protein being polyubiquitinated at two or more positions with at least first and second polyubiquitins, with the first and second polyubiquitins having different linkages, comprising contacting the biological sample with the antibody of any one of claims 1 to 69 under conditions permissive for binding of the antibody to the
  • the first and second polyubiquitins respectively comprise: a Kl 1 linkage and a second linkage different from the Kl 1 linkage; a K48 linkage and a second linkage different from the K48 linkage; a K63 linkage and a second linkage different from the K63 linkage; a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage; a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N-terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N- terminal linkage.
  • FIG. 1 Figures la-d. Engineering, purification, and characterization of a bispecific anti-Kll K48 polyubiquitin linkage-specific antibody, a, Knob and hole half antibodies were recombinantly expressed separately in CHO cells and affinity purified individually and then assembled in vitro, b, SDS-PAGE analysis of knob and hole half antibodies and assembled bispecific antibodies post purification. Samples were run in the absence (-) or presence (+) of DTT.
  • the HL label denotes a half antibody species and the H2L2 label denotes a full antibody.
  • H heavy chains
  • L light chains
  • c Analytical size- exclusion analysis of the anti-Kl 1 knob and anti-K48 hole half antibodies and the assembled anti-Kl 1/K48 bispecific antibody
  • d Mass spectrometry analysis of the purified anti-Kl 1/K48 bispecific antibody.
  • Top panel is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB.
  • CPB carboxypeptidase B
  • Figures 2a-c Characterization of the half antibodies and control bispecific antibodies, a, Analytical size-exclusion analysis of the anti-Kl 1 hole and anti-gD knob half antibodies and the assembled anti-Kl 1/gD and anti-K48/gD bispecific control antibodies, b, Mass spectrometry analysis of the affinity purified anti-Kl l knob, anti-Kl l hole, anti-K48 hole, and anti-gD knob half antibodies. Top panel for each half antibody is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB.
  • CPB carboxypeptidase B
  • Top panels indicate a +128 Da addition to the anti-Kl 1 knob, anti-Kl 1 hole, and anti-gD knob half antibodies that disappears upon CPB treatment indicating that it is due to the heavy chain carboxy-terminal lysine still attached to a portion of the antibodies, c, Mass spectrometry analysis of the purified anti-Kl 1/gD and anti-K48/gD control bispecific antibodies.
  • Top panel for each bispecific is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB.
  • CPB carboxypeptidase B
  • VH refers to a heavy chain variable domain and VL refers to a light chain variable domain.
  • an "acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a VL framework or a VH framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • Bindfinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen).
  • binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • Avidity refers to the strength of the sum total of noncovalent interactions between a molecule (e.g., an antibody) and its binding partner (e.g., a target molecule comprising one or more antigens).
  • the avidity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd).
  • Kd dissociation constant
  • a bispecific antibody will generally have a greater avidity for a binding partner comprising epitopes recognized by both of the antigen binding sites of the bispecific antibody than for a binding partner comprising either of the eptiopes individually.
  • Avidity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding avidity are described in the following.
  • the term "functional affinity" is sometimes used in the art to refer to avidity.
  • An "affinity matured” antibody refers to an antibody with one or more alterations in one or more hypervariable regions (HVRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
  • HVRs hypervariable regions
  • antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • multispecific antibody refers to an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of binding to two, or more, different epitopes on one molecule or is capable of binding to epitopes on two, or more, different molecules).
  • An "agonist antibody” as used herein is an antibody which mimics at least one of the functional activities of a polypeptide of interest.
  • an "antagonist antibody” or a “blocking antibody” is an antibody which inhibits or reduces biological activity of the antigen to which it specifically binds. Certain blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • ADC antibody drug conjugate
  • an "antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody and that binds the antigen to which the intact antibody binds.
  • antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
  • an "antibody that binds to the same epitope" as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
  • An exemplary competition assay is provided herein.
  • anti-mixed-topology polyubiquitin antibody and "an antibody that binds to mixed-topology polyubiquitin” refer to an antibody that is capable of binding mixed- topology linked polyubiquitin with sufficient avidity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting mixed-topology polyubiquitin.
  • the extent of binding of an anti-mixed-topology polyubiquitin antibody to an unrelated, non-mixed-topology-linked polyubiquitin protein is less than about 10% of the binding of the antibody to mixed-topology polyubiquitin as measured, e.g., by a
  • an antibody that binds to mixed-topology polyubiquitin has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "8 M or less, e.g. from 10 "8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
  • an anti-mixed-topology polyubiquitin antibody binds to epitopes of the mixed-topology polyubiquitin that are conserved among the mixed-topology polyubiquitin from different species.
  • anti-polyubiquitin antibody refers to an antibody that is capable of specifically binding to a polyubiquitin molecule.
  • anti-ubiquitin antibody and “anti-monoubiquitin antibody” are used interchangeably, and refer to an antibody that is capable of specifically binding to a ubiquitin molecule.
  • cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation.
  • Examples of cancer include, but are not limited to, carcinoma, lymphoma (e.g., Hodgkin's and non-Hodgkin's lymphoma), blastoma, sarcoma, and leukemia.
  • cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, leukemia and other
  • lymphoproliferative disorders and various types of head and neck cancer.
  • chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
  • the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
  • Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of
  • Antibody effector functions refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
  • an "effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • epitope refers to the particular site on an antigen molecule to which an antibody binds.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • first and second are used with reference to elements of a complex structure, e.g., a protein with terti ary /quaternary structure such as an antibody or other assembly such as a polyubiquitin, to refer to those elements (e.g., monomers, chains, domains) without any implication as to the ordering or positioning of the elements; thus a “first” element may be C- or N- terminal to a second element, or closer or farther from one end or another of the structure than a second element.
  • the designation of a half or a linkage as first or second is arbitrary.
  • FR refers to variable domain residues other than hypervariable region (HVR) residues.
  • the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • full length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages.
  • Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non- human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • a "rabbit antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a rabbit or a rabbit cell or derived from a non- rabbit source that utilizes rabbit antibody repertoires or other rabbit antibody-encoding sequences.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al., supra.
  • the subgroup is subgroup III as in Kabat et al., supra.
  • a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
  • a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
  • hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops").
  • native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • HVRs generally comprise amino acid residues from the hypervariable loops and/or from the
  • CDRs complementarity determining regions
  • Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50-52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3).
  • CDR-L1, CDR-L2, CDR-L3, CDR-Hl, CDR-H2, and CDR-H3 occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3.
  • CDR1 in VH CDRs generally comprise the amino acid residues that form the hypervariable loops.
  • CDRs also comprise "specificity determining residues," or "SDRs,” which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a-CDRs.
  • Exemplary a-CDRs (a-CDR- Ll, a-CDR-L2, a-CDR-L3, a-CDR-Hl, a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI, 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3.
  • HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
  • an “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
  • An immunoconjugate is equivalent to the term "antibody drug conjugate” (ADC).
  • An "individual” or “patient” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.
  • An "isolated antibody” is one which has been separated from a component of its natural environment.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoresis (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatography (e.g., ion exchange or reverse phase HPLC).
  • electrophoresis e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
  • chromatography e.g., ion exchange or reverse phase HPLC.
  • An "isolated nucleic acid” refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • Mated-topology polyubiquitin refers to polyubiquitin comprising two or more different Ub to Ub linkages, i.e., different linkages at different positions in the polyubiquitin, and may be branched (wherein at least one monomer is connected to at least three other monomers or to a substrate polypeptide and at least two other monomers) or unbranched (wherein the monomers are not connected to more than two other monomers or to two monomers and a substrate polypeptide).
  • a ubiquitin at the branch point with its C-terminus linked to, e.g., lysine 11 of the previous ubiquitin, while, e.g., the lysine 11 and the lysine 48 of the ubiquitin at the branch point could both be linked to subsequent ubiquitins.
  • none of the ubiquitins would be connected directly to more than two other ubiquitins, but at least one of the ubiquitins would be involved in two different ubiquitin to ubiquitin linkages, e.g., its C-terminus could be linked to lysine 11 of the previous ubiquitin while its lysine 48 is linked to the subsequent ubiquitin.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • a “naked antibody” refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical formulation.
  • Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
  • native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3).
  • VH variable region
  • VL variable region
  • the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a “pharmaceutically acceptable carrier” refers to an ingredient in a
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • substantially free of means that the referenced entity is absent or, if present, is (i) in a sufficiently low quantity so as not to significantly alter a functional property or result of a composition, method, use, or step, as the case may be; (ii) is undetectable by at least one appropriate analytical method, such as mass spectrometry (e.g., MALDI-TOF or any MS procedure used in the Examples), blotting (e.g., Western for a polypeptide), or electrophoresis (e.g., SDS-PAGE with Coomassie blue or silver staining); or (iii) is present in an amount less than or equal to about 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1%, by mass or by mole fraction relative to the total amount of non-solvent material in the composition.
  • mass spectrometry e.g., MALDI-TOF or any MS procedure used in the Examples
  • blotting e.g., Western for
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies disclosed herein are used to delay development of a disease or to slow the progression of a disease.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
  • variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs).
  • FRs conserved framework regions
  • HVRs hypervariable regions
  • VH or VL domain may be sufficient to confer antigen-binding specificity.
  • antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
  • antibodies that bind to mixed-topology polyubiquitin chains are provided. Such antibodies are useful, e.g., for detecting, modulating the activity of, or immunoprecipitating mixed-topology polyubiquitin chains.
  • an antibody has a greater avidity for a mixed-topology polyubiquitin than for a single-topology polyubiquitin, wherein the mixed-topology
  • polyubiquitin comprises a first linkage and a second linkage, wherein the first linkage and the second linkage differ from each other.
  • an antibody is a multispecific antibody that binds a mixed-topology polyubiquitin comprising a first linkage and a second linkage, the antibody comprising a first VH/VL unit specific for the first linkage, and a second VH/VL unit specific for the second linkage, wherein the first linkage and the second linkage differ from each other.
  • an antibody can comprise a first antigen recognition site and a second antigen recognition site, wherein the first antigen recognition site is specific for the first linkage and the second antigen recognition site is specific for the second linkage. Because both antigen recognition sites can specifically engage a mixed-topology polyubiquitin whereas only one antigen recognition site can specifically engage a single-topology polyubiquitin, the antibody has greater avidity for the mixed-topology polyubiquitin.
  • the first linkage is a Kl 1, K48, K63, or C-terminal to N- terminal-linkage.
  • the second linkage is a Kl 1, K48, K63, or C-terminal to N-terminal-linkage.
  • the first and second linkages are independently a Kl 1, K48, K63, or C-terminal to N-terminal-linkage. Unless otherwise indicated, the first and second linkages are different.
  • the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 8, 133,488 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 8, 133,488, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a polyubiquitin.
  • At least one of the HVRs of the second half antibody is not identical to the corresponding HVR of the first half antibody.
  • at least two of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody.
  • at least three of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody.
  • at least four of the HVRs of the second half antibody are not identical to the corresponding HVR of the first half antibody.
  • at least five of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody.
  • the six HVRs of the second half antibody are not identical to the HVRs of the first half antibody.
  • the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 9, 10, 11, 12, 13, and 14, respectively.
  • the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 23, 24, 25, 26, 27, and 28, respectively.
  • the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 37, 38, 39, 40, 41, and 42, respectively.
  • the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 51, 52, 53, 54, 55, and 56, respectively.
  • the second half antibody comprises an HVR-Hl, HVR- H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 9, 10, 11, 12, 13, and 14, respectively.
  • the second half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 23, 24, 25, 26, 27, and 28, respectively.
  • the second half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 37, 38, 39, 40, 41, and 42, respectively.
  • the second half antibody comprises an HVR- Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 51, 52, 53, 54, 55, and 56, respectively.
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28.
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42.
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56;
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42;
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
  • one of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, and the other of the first and second half antibodies comprises
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
  • HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
  • HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
  • HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
  • the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8.
  • VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7
  • a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8.
  • the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22.
  • the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36.
  • the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50.
  • VL and VH sequences of the second half antibody are not identical to its counterpart in the first half antibody.
  • the VL sequence of the second half antibody is not identical to the VL sequence of the first half antibody.
  • the VH sequence of the second half antibody is not identical to the VH sequence of the first half antibody.
  • the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
  • a) one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22.
  • one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36.
  • one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8 and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 50.
  • one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36.
  • one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50.
  • one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36
  • the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50.
  • the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,133,488 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,133,488, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a polyubiquitin.
  • the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a
  • the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,133,488 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8, 133,488, wherein the half antibody binds a
  • the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a
  • the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin.
  • the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a
  • a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to a polyubiquitin.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in a VH sequence.
  • substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
  • the antibody comprises a VH sequence discussed above, including post-translational modifications of that sequence.
  • a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to a polyubiquitin.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in a VL sequence.
  • substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
  • the antibody comprises a VL sequence discussed above, including post-translational modifications of that sequence.
  • the antibody is humanized.
  • the antibody comprises HVRs as in any of the above embodiments, and further comprises a human acceptor framework, e.g. a human immunoglobulin framework or a human consensus framework.
  • the antibody comprises HVRs as in any of the above embodiments and rabbit framework regions.
  • an antibody that binds to the same epitopes as a bispecific antibody provided herein is provided.
  • an antibody is provided that binds to the same epitopes as an antibody comprising first and second half antibodies, wherein:
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
  • first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22;
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
  • first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
  • first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50;
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
  • first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
  • first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; or
  • one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36
  • the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
  • an antibody that competes for binding to a mixed- topology polyubiquitin with a bispecific antibody comprising VH and VL sequences as in one of a) through f) in the preceding paragraph is provided.
  • the antibody is a monoclonal antibody, including a chimeric, humanized or human antibody.
  • the antibody is an antibody fragment, e.g., a dimeric scFv, diabody, or F(ab') 2 fragment.
  • the antibody is a substantially full length antibody, e.g., an IgGl, IgG2a, IgG2b, IgG3, or IgG4 antibody, or other antibody class or isotype as defined herein.
  • the antibody comprises at least one heavy chain with a C- terminal lysine. In some embodiments, the antibody comprises at least one heavy chain lacking a C-terminal lysine. In some embodiments, the antibody comprises only heavy chains without a C-terminal lysine.
  • C-terminal lysines can be removed, e.g., enzymatically, such as by carboxypeptidase treatment, or genetically, such as by deletion or substitution of the lysine codon at the 3' end of a heavy chain coding sequence. Heavy chain C-terminal lysines are located far from antigen binding sites and dispensable for binding activity, and their removal can provide more homogeneous antibody preparations.
  • the antibody comprises first and second half antibodies, wherein the first or second half antibody comprises
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18;
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32; or
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46,
  • the antibody comprises first and second half antibodies, wherein the first or second half antibody comprises
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20;
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34; or
  • a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48,
  • the antibody comprises first and second half antibodies, wherein
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20,
  • the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32; k) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46; or
  • one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34,
  • first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46,
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
  • an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1-7 below.
  • an antibody provided herein has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM, and optionally is > 10 _13 M. (e.g. 10 _8 M or less, e.g. from 10 _8 M to 10 _13 M, e.g., from 10 _9 M to 10 _ 13 M).
  • Kd dissociation constant
  • Kd is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay.
  • Solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293 :865-881(1999)).
  • MICROTITER ® multi-well plates (Thermo Scientific) are coated overnight with 5 ⁇ g/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbent plate (Nunc #269620)
  • 100 pM or 26 pM [ 125 I] -antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al., Cancer Res.
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN- 20 ® ) in PBS. When the plates have dried, 150 ⁇ /well of scintillant (MICRO SCINT-20TM; Packard) is added, and the plates are counted on a TOPCOUNTTM gamma counter (Packard) for ten minutes.
  • MICRO SCINT-20TM MICRO SCINT-20TM; Packard
  • Kd is measured using surface plasmon resonance assays using a BIACORE ® -2000 or a BIACORE ® -3000 (BIAcore, Inc., Piscataway, NJ) at 25°C with immobilized antigen CM5 chips at -10 response units (RU).
  • carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with /V-ethyl-N'- (3- dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (-0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups.
  • a spectrometer such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
  • a spectrometer such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
  • an antibody provided herein is an antibody fragment.
  • Antibody fragments include, but are not limited to, F(ab') 2 fragments, dimeric single chain Fv, and other fragments described below.
  • F(ab') 2 fragments include, but are not limited to, F(ab') 2 fragments, dimeric single chain Fv, and other fragments described below.
  • scFv fragments see, e.g., Pluckthiin, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458.
  • Fab and F(ab') 2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Patent No. 5,869,046.
  • the antibody is a diabody.
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993).
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Patent No. 6,248,516 B l).
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
  • recombinant host cells e.g. E. coli or phage
  • an antibody provided herein is a chimeric antibody.
  • Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
  • a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody is a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • HVRs e.g., CDRs, (or portions thereof) are derived from a non-human antibody
  • FRs or portions thereof
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
  • a non-human antibody e.g., the antibody from which the HVR residues are derived
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit" method (see, e.g., Sims et al. J. Immunol. 151 :2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol, 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci.
  • an antibody provided herein is a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
  • Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol, 133 : 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cei! hybridoma technology are also described in Li et al., Proc. Natl. Acad. Set.
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
  • Antibodies may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NT, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol.
  • Phage typically display antibody fragments, either as single- chain Fv (scFv) fragments or as Fab fragments.
  • Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).
  • Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574,
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
  • an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody.
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
  • Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole” engineering (see, e.g., U.S. Patent No. 5,731, 168).
  • the antibody comprises first and second half antibodies, wherein the first half antibody comprises a first heavy chain constant region comprising a knob mutation and the second heavy chain comprises a second heavy chain constant region comprising a hole mutation; or wherein the first half antibody comprises a first heavy chain constant region comprising a hole mutation and the second heavy chain comprises a second heavy chain constant region comprising a knob mutation.
  • the antibody is an IgGl antibody and the knob mutation comprises a T366W mutation.
  • the antibody is an IgGl antibody and the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V.
  • the antibody is an IgG4 antibody and the knob mutation comprises a T366W mutation.
  • the antibody is an IgG4 antibody and the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
  • the foregoing numbering of the positions of mutation(s) is EU numbering.
  • the actual position(s) of the mutation(s) in a heavy chain sequence may vary, e.g., depending on the length of the preceding variable region, such as by up to 10 positions.
  • Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992)); using "diabody” technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci.
  • the antibody is a diabody.
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993).
  • the antibody is a triabody.
  • the triabody comprises a first antigen recognition site, a second antigen recognition site, and a third antigen recognition site, wherein at least one of the antigen recognition sites differs from the other antigen recognition sites.
  • the triabody comprises first, second, and third antigen recognition sites that bind three different polyubiquitins.
  • the triabody comprises first, second, and third antigen recognition sites that bind any three polyubiquitins selected from a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a Relinked polyubiquitin, and a C-terminal to N-terminal-linked polyubiquitin.
  • Each antigen recognition site can comprise a combination of HVRs or of a VL and VH discussed above.
  • the antibody is a tetrabody.
  • the tetrabody comprises a first antigen recognition site, a second antigen recognition site, a third antigen recognition site, and a fourth antigen recognition site, wherein at least one or at least two of the antigen recognition sites differ from the other antigen recognition sites.
  • the tetrabody comprises first, second, and third antigen recognition sites that bind three different polyubiquitins.
  • the tetrabody comprises first, second, and third antigen recognition sites that bind any three polyubiquitins selected from a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a K63 -linked polyubiquitin, and a C-terminal to N- terminal-linked polyubiquitin. In some embodiments, the tetrabody comprises first, second, third, and fourth antigen recognition sites that bind four different polyubiquitins.
  • the tetrabody comprises first, second, third, and fourth antigen recognition sites that bind a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a K63 -linked polyubiquitin, and a C-terminal to N-terminal-linked polyubiquitin.
  • Each antigen recognition site can comprise a combination of HVRs or a combination of a VL and VH discussed above.
  • octopus antibodies Engineered antibodies with three or more functional antigen binding sites, including "Octopus antibodies,” are also included herein (see, e.g. US 2006/0025576A1).
  • the term octopus antibody is used in the sense of those discussed in US 2006/0025576A1 and is not meant to refer to an antibody produced by or obtained from an octopus.
  • the antibody or fragment herein also includes a "Dual Acting FAb” or “DAF” comprising two antigen binding sites that binds two different antigens (see, US 2008/0069820, for example).
  • the two different antigens can be any of the polyubiquitins discussed above, such as Kl 1-, K48-, K63-, or C-terminal to N-terminal-linked polyubiquitins.
  • amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired
  • antibody variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HVRs and FRs.
  • Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions.” More substantial changes are provided in Table 1 under the heading of
  • amino acid side chain classes may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
  • Amino acids may be grouped according to common side-chain properties:
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
  • a parent antibody e.g. a humanized or human antibody
  • the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
  • An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
  • Alterations may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g.,
  • Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).)
  • affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created.
  • the library is then screened to identify any antibody variants with the desired affinity.
  • Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized.
  • HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.
  • CDR-H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may be outside of HVR "hotspots" or SDRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by
  • a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g., alanine or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex is used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • ADEPT enzyme
  • an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated.
  • Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
  • the carbohydrate attached thereto may be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997).
  • oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure.
  • modifications of the oligosaccharide in an antibody may be made in order to create antibody variants with certain improved properties.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%.
  • the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Examples of cell lines capable of producing defucosylated antibodies include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al., especially at Example 11), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
  • Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean- Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided.
  • Such antibody variants may have improved CDC function.
  • Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence ⁇ e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification ⁇ e.g. a substitution) at one or more amino acid positions.
  • an antibody variant possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991).
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat 7 Acad. Sci. USA 83 :7059-7063 (1986)) and Hellstrom, I et al., Proc.
  • non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Nat 'lAcad. Sci. USA 95:652-656 (1998).
  • Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity.
  • a CDC assay may be performed (see, for example, Gazzano- Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al., Blood 101 : 1045-1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103 :2738-2743 (2004)).
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int 'l. Immunol. 18(12): 1759-1769 (2006)).
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
  • an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alterations are made in the Fc region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No. 6, 194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
  • CDC Complement Dependent Cytotoxicity
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826).
  • cysteine engineered antibodies e.g., "thioMAbs”
  • one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; K149 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • Cysteine engineered antibodies may be generated as described, e.g., in U.S. Patent No. 7,521,541. e) Antibody Derivatives
  • an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
  • Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
  • carboxymethylcellulose dextran
  • polyvinyl alcohol polyvinyl pyrrolidone
  • poly-1, 3-dioxolane poly-l,3,6-trioxane
  • ethyl ene/maleic anhydride copolymer polyaminoacids (either
  • polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)).
  • the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
  • Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567.
  • isolated nucleic acid encoding an antibody described herein is provided.
  • Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
  • a method of making an antibody disclosed herein comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • components of a multispecific antibody e.g., a first half antibody and second half antibody
  • all components of a multispecific antibody are expressed in the same cell or cell culture.
  • nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Patent Nos.
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat.
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts. See, e.g., US Patent Nos.
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
  • monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N. Y. Acad. Sci. 383 :44-68 (1982); MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR " CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
  • Antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
  • an antibody is tested for its antigen binding activity, e.g., by known methods such as ELISA, FACS or Western blot.
  • competition assays may be used to identify an antibody that competes with any of the antibodies described herein for binding to a mixed-topology polyubiquitin.
  • a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by an antibody described herein.
  • immobilized mixed-topology polyubiquitin is incubated with a solution comprising a first labeled antibody that binds thereto (e.g., any of the antibodies described herein) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to the mixed-topology polyubiquitin.
  • the second antibody may be present in a hybridoma supernatant.
  • polyubiquitin is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to mixed-topology polyubiquitin, excess unbound antibody is removed, and the amount of label associated with immobilized mixed-topology polyubiquitin is measured. If the amount of label associated with immobilized mixed-topology polyubiquitin is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to the mixed-topology polyubiquitin. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).
  • Immunoconjugates comprising an antibody disclosed herein conjugated to one or more cytotoxic agents are provided, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes (i.e., a radioconjugate).
  • cytotoxic agents such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes (i.e., a radioconjugate).
  • Immunoconjugates allow for the targeted delivery of a drug moiety to a tumor or other diseased cell or tissue, and, in some embodiments intracellular accumulation therein, where systemic administration of unconjugated drugs may result in unacceptable levels of toxicity to normal cells (Polakis P. (2005) Current Opinion in Pharmacology 5:382-387).
  • ADC Antibody-drug conjugates
  • ADC are targeted chemotherapeutic molecules which combine properties of both antibodies and cytotoxic drugs by targeting potent cytotoxic drugs to antigen-expressing tumor cells (Teicher, B.A. (2009) Current Cancer Drug Targets 9:982- 1004), thereby enhancing the therapeutic index by maximizing efficacy and minimizing off- target toxicity (Carter, P.J. and Senter P.D. (2008) The Cancer Jour. 14(3): 154-169; Chari, R.V. (2008) Acc. Chem. Res. 41 :98-107 .
  • the ADC compounds include those with anticancer activity. In some embodiments,
  • the ADC compounds include an antibody conjugated, i.e. covalently attached, to the drug moiety.
  • the antibody is covalently attached to the drug moiety through a linker.
  • the antibody-drug conjugates (ADC) may selectively deliver an effective dose of a drug to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved while increasing the therapeutic index ("therapeutic window").
  • the drug moiety (D) of the antibody-drug conjugates (ADC) may include any compound, moiety or group that has a cytotoxic or cytostatic effect.
  • Drug moieties may impart their cytotoxic and cytostatic effects by mechanisms including but not limited to tubulin binding, DNA binding or intercalation, and inhibition of RNA polymerase, protein synthesis, and/or topoisomerase.
  • Exemplary drug moieties include, but are not limited to, a maytansinoid, dolastatin, auristatin, calicheamicin, pyrrolobenzodiazepine (PBD), nemorubicin and its derivatives, PNU- 159682, anthracycline, duocarmycin, vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, and stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity.
  • PNU- 159682 anthracycline, duocarmycin, vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, and stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity.
  • any of the antibodies provided herein is useful for detecting the presence of mixed-topology polyubiquitin in a biological sample.
  • the term “detecting” as used herein encompasses quantitative or qualitative detection.
  • a “biological sample” comprises, e.g., a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous colon, colorectal, small intestine, endometrial, pancreatic, breast, lung, prostate, or ovarian tissue).
  • an antibody disclosed herein is for use in a method of diagnosis or detection.
  • a method of detecting the presence of mixed-topology polyubiquitin in a biological sample comprises contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to mixed-topology polyubiquitin, and detecting whether a complex is formed between the antibody and mixed-topology polyubiquitin in the biological sample.
  • Such method may be an in vitro or in vivo method.
  • an antibody is used to select subjects eligible for therapy with an anti-mixed-topology polyubiquitin antibody, e.g. where mixed-topology polyubiquitin is a biomarker for selection of patients.
  • the biological sample is a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous tissue).
  • a method of detecting a polyubiquitinated protein in a biological sample comprising contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to the polyubiquitinated protein, and detecting whether a complex is formed between the antibody and the polyubiquitinated protein in the biological sample.
  • an antibody is used to select subjects eligible for therapy with an antibody disclosed herein, e.g. where the
  • the biological sample is a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous tissue).
  • an antibody disclosed herein is used in vivo to detect, e.g., by in vivo imaging, mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages in a subject, e.g., for the purposes of diagnosing, prognosing, or staging a disease, determining the appropriate course of therapy, or monitoring response to therapy.
  • One method known in the art for in vivo detection is immuno-positron emission tomography
  • a method for detecting a mixed-topology polyubiquitin in a subject comprising administering a labeled antibody to a subject, and detecting the labeled anti-mixed-topology polyubiquitin antibody in the subject.
  • the labeled antibody comprises (e.g., is conjugated to) a positron emitter, such as 68 Ga, 18 F, 64 Cu, 86 Y, 76 Br, 89 Zr, and 124 I.
  • the positron emitter is 89 Zr.
  • Nonlimiting exemplary methods of making and using 89 Zr-labeled antibodies are described, e.g., in PCT Publication No. WO 2011/056983.
  • the labeled antibody is a cysteine engineered antibody conjugated to one or more zirconium complexes. See, e.g., WO 2011/056983.
  • a method of diagnosis or detection comprises contacting a first antibody disclosed herein which is immobilized to a substrate with a biological sample to be tested for the presence of mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages, exposing the substrate to a second antibody that binds mixed-topology polyubiquitin or the polyubiquitinated protein, and detecting whether the second antibody is bound to a complex between the first antibody and mixed-topology polyubiquitin or the polyubiquitinated protein in the biological sample (sometimes referred to as a sandwich assay).
  • a substrate may be any supportive medium, e.g., glass, metal, ceramic, polymeric beads, slides, chips, and other substrates.
  • a biological sample comprises a cell or tissue ⁇ e.g., biopsy material, including cancerous or potentially cancerous colon, colorectal, small intestine, endometrial, pancreatic or ovarian tissue).
  • the first or second antibody is any of the antibodies described herein.
  • the antibodies disclosed herein are labeled.
  • Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
  • Exemplary labels include, but are not limited to, the radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Patent No.
  • luciferin 2,3-dihydrophthalazinediones
  • horseradish peroxidase HRP
  • alkaline phosphatase alkaline phosphatase
  • ⁇ -galactosidase glucoamylase
  • lysozyme saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase
  • heterocyclic oxidases such as uncase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP
  • HRP horseradish peroxidase
  • a label is a positron emitter.
  • Positron emitters include but are not limited to 68 Ga, 18 F, 64 Cu, 86 Y, 76 Br, 89 Zr, and 124 I. In a particular
  • a positron emitter is 89 Zr.
  • Presence of mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages in a sample can be analyzed by a number of methodologies using an antibody disclosed herein, many of which are known in the art and understood by the skilled artisan, including, but not limited to, immunohistochemistry ("IHC"), Western blot analysis, immunoprecipitation, molecular binding assays, ELISA, ELIFA, fluorescence activated cell sorting (“FACS”), quantitative blood based assays (as for example Serum ELISA),.
  • IHC immunohistochemistry
  • Western blot analysis Western blot analysis
  • immunoprecipitation immunoprecipitation
  • molecular binding assays ELISA
  • ELIFA fluorescence activated cell sorting
  • FACS fluorescence activated cell sorting
  • quantitative blood based assays as for example Serum ELISA
  • Typical protocols for evaluating the status of proteins are found, for example in Ausubel et al, eds., 1995, Current Protocols In Molecular Biology, Unit 15 (Immunoblotting). Multiplexed immunoassays such as those available from Rules Based Medicine or Meso Scale Discovery (“MSD”) may also be used.
  • MSD Meso Scale Discovery
  • a composition is provided that is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
  • Monospecific antibodies are antibodies that do not comprise more than one type of antigen recognition site, e.g., antibodies with only one set of six CDRs or antibodies in which each set of six CDRs is identical.
  • Antibodies in which a first set of CDRs varies only slightly from any other sets of CDRs, e.g., with respect to a small number of amino acid residues, wherein the differences do not result in preferential binding to a different antigen, are also considered monospecific.
  • An unassembled half antibody is not stably associated (covalently or noncovalently) with another half antibody, e.g., appears as a single heavy /light chain unit when analyzed by an appropriate technique, such as size exclusion chromatography, mass spectrometry, or electrophoresis.
  • compositions of an antibody or immunoconjugate as described herein are prepared by mixing such antibody or immunoconjugate having the desired degree of purity with one or more optional pharmaceutically acceptable carriers ⁇ Remington's
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride;
  • hexamethonium chloride benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol;
  • polypeptides such as serum albumin, gelatin, or immunoglobulins
  • proteins such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g.
  • Zn- protein complexes Zn- protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
  • exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLE EX ® , Baxter
  • sHASEGPs and methods of use including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968.
  • a sHASEGP is combined with one or more additional glycosaminoglycanases such as
  • Exemplary lyophilized antibody or immunoconjugate formulations are described in US Patent No. 6,267,958.
  • Aqueous antibody or immunoconjugate formulations include those described in US Patent No. 6,171,586 and WO2006/044908, the latter formulations including a histidine-acetate buffer.
  • the formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
  • hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • macroemulsions for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody or immunoconjugate, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • formulations to be used for in vivo administration are generally sterile.
  • Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
  • any of the antibodies or immunoconjugates provided herein may be used in methods, e.g., therapeutic methods.
  • an antibody or immunoconjugate disclosed herein for use as a medicament is provided.
  • an antibody or immunoconjugate disclosed herein for use in a method of treatment is provided.
  • an antibody or immunoconjugate disclosed herein for use in treating mixed-topology polyubiquitin-positive cancer is provided.
  • An "individual” according to any of the above embodiments may be a human.
  • compositions comprising any of the antibodies or immunoconjugate provided herein, e.g., for use in any of the above therapeutic methods.
  • a pharmaceutical formulation comprises any of the antibodies or immunoconjugates provided herein and a pharmaceutically acceptable carrier.
  • Antibodies or immunoconjugates provided herein can be used either alone or in combination with other agents in a therapy.
  • an antibody or immunoconjugate provided herein may be co-administered with at least one additional therapeutic agent.
  • Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody or immunoconjugate provided herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
  • An antibody or immunoconjugate (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include
  • Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
  • Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
  • Antibodies or immunoconjugates would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the antibody or immunoconjugate need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody or immunoconjugate present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
  • an antibody or immunoconjugate when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody or immunoconjugate, the severity and course of the disease, whether the antibody or
  • immunoconjugate is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody or immunoconjugate, and the discretion of the attending physician.
  • the antibody or immunoconjugate is suitably administered to the patient at one time or over a series of treatments.
  • an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the disorder and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an antibody or immunoconjugate disclosed herein.
  • the label or package insert indicates that the composition is used for treating the condition of choice.
  • the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the
  • composition comprises an antibody or immunoconjugate; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent.
  • the article of manufacture in this embodiment may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline Ringer's solution or dextrose solution.
  • It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • Bispecific antibodies were generated using a knobs-into-holes heterodimerization approach.
  • Merchant, A. M. et al. An efficient route to human bispecific IgG. Nat Biotechnol 16, 677-681, doi: 10.1038/nbt0798-677 (1998).
  • T366W knock or T366S, L368A, and Y407V (hole) mutations were introduced into the CH3 domains of anti-Kl 1 and anti-K48 polyubiquitin linkage-specific antibodies.
  • As a control an anti-gD antibody recognizing an irrelevant protein was used.
  • the knob and hole mutations were chosen to allow preferential heterodimerization of the respective heavy chains of the antibodies.
  • the heavy chain variable domains were those of SEQ ID NO: 8 (for anti-Kl 1 polyubiquitin linkage-specificity), SEQ ID NO: 22 (for anti-K48 polyubiquitin linkage- specificity), and a non-specific anti-gD control antibody. These variable domains were subcloned into a modified pRK vector (Genentech) containing the human IgGl heavy chain constant domains with either the knob (T366W) or hole (T366S, L368A, and Y407V) mutations in the CH3 domain.
  • knob and hole mutations Due to the lengths of variable regions, the actual positions of the knob and hole mutations can vary slightly, e.g., by 1 to 10 positions. For example, in SEQ ID NOs: 4 and 6, the T to W and T to S substitutions, respectively, are reflected at the 369 th rather than the 366 th amino acid residue. It is understood that references to knob and hole mutations at positions such as 366, 368, and 407 of a heavy chain are to be interpreted with adjustments, if appropriate, in light of the length of the variable region.
  • the light chain variable domains were similarly subcloned into a modified pRK vector (Genentech) containing the human kappa light chain constant domain.
  • the pRK vector carries a constitutive strong signal peptide for extracellular expression in mammalian cells.
  • the anti-Kl 1 antibody was cloned as both knob and hole mutants (encoding heavy chains comprising SEQ ID NOs: 4 and 6, respectively), the anti-K48 was cloned as a hole mutant (encoding a heavy chain comprising SEQ ID NO: 20), and the anti-gD was cloned as a knob mutant.
  • the sequence table also provides a knob mutant of the anti-Kl 1 antibody (SEQ ID NO: 18); knob and hole mutants of an anti-K63 heavy chain (SEQ ID NOs: 32 and 34, respectively); and knob and hole mutants of an anti-linear polyubiquitin heavy chain (SEQ ID NOs: 46 and 48, respectively).
  • knob or hole heavy chain mutants were transiently co-transfected into CHO cells using PEI as previously described (see Wong, A. W., Baginski, T. K. & Reilly, D. E. Enhancement of DNA uptake in FUT8-deleted CHO cells for transient production of afucosylated antibodies.
  • the affinity -purified knob and hole antibodies are a mixture of monomers (half antibodies) and homodimers as seen by SDS-PAGE, analytical size-exclusion chromatography (SEC), multi-angle light scattering (MALS), and liquid chromatography-mass spectrometry (LC-MS) (Fig. lb, lc, 2a, 2b, Tables 2, 3), consistent with previously described knob and hole antibodies.
  • SEC analytical size-exclusion chromatography
  • MALS multi-angle light scattering
  • LC-MS liquid chromatography-mass spectrometry
  • the theoretical mass of the anti-K48 hole/anti-Kl 1 knob bispecific is 144,613.19 Da, corresponding to the major peak in Fig. Id.
  • the predicted peak positions for the anti-K48 hole and anti-Kl 1 knob homodimers are indicated based on their theoretical masses of
  • the predicted peak positions for the anti-Kl 1 hole homodimers, anti-K48 hole homodimers, and anti-gD knob homodimers are indicated based on their theoretical masses of 144,329.96 Da, 144,485.90, and 146,916.32 Da, respectively.
  • Antibodies were injected over an XB ridge Protein BEH analytical SEC column coupled to a DAWN HELEOS II Multi-Angle Light Scatter detector for molar mass and polydispersity measurement. The elution time of individual peaks off the SEC column is given in minutes.
  • Antibodies were deglycosylated with PNGaseF and analyzed by liquid chromatography-mass spectrometry (LC-MS).
  • the theoretical masses are for the non-reduced, deglycosylated antibodies and assume complete removal of the carboxy-terminal lysine residue during mammalian cell expression.
  • the mass difference is reported as the difference between the experimental mass and the theoretical mass. N/O a , not observed.
  • knob and hole homodimers are non-covalent in nature (i.e. the hinge disulfides are not formed) as they are disrupted in the reverse-phase chromatography step of LC-MS leading to detection of only monomers by MS (Fig. 2b, Table 3).
  • Bispecific antibodies were assembled from half antibodies in vitro using annealing, reduction, and oxidation.
  • the anti-Kl 1/K48 bispecific antibody was assembled in vitro from the affinity purified anti-Kl 1 knob and anti-K48 hole antibodies using a modified version of the previously described method of annealing, reduction, and oxidation (Shatz, W. et al. Knobs-into-holes antibody production in mammalian cell lines reveals that asymmetric afucosylation is sufficient for full antibody-dependent cellular cytotoxicity.
  • knob and hole half antibodies were mixed at a 1 : 1 mass ratio and the pH of the mixture was adjusted to 8.5 with 15% (v/v) of 800 mM arginine, pH 10.0.
  • a 200-fold molar excess of reduced glutathione (Sigma Aldrich) in 800 mM arginine, pH 10.0 was added and the assembly reaction was incubated at room temperature for 72 hours with exposure to air to allow annealing of the knob and hole half antibodies and formation of the hinge disulfides.
  • Anti-Kl 1/gD and anti-K48/gD control bispecific antibodies were similarly assembled.
  • the resulting heterodimers were further purified using hydrophopbic interaction (HIC) and cation-exchange (CEX) chromatography to remove any excess half antibodies and homodimers.
  • the bispecific antibodies migrate as a -150 kDa band on SDS-PAGE, elute as a sharp peak on analytical SEC, and are monodisperse with a molar mass consistent with that of a full antibody (Fig. lb, lc, 2a, Table 2).
  • Assembled bispecific antibodies were purified by hydrophobic interaction chromatography (HIC). Briefly, the assembly reaction was conditioned with 3 volumes of buffer A (25 mM sodium phosphate, 1 M ammonium sulfate, pH 6.5) to a final concentration of 0.75 M ammonium sulfate. The assembly reaction was filtered, loaded onto a 5 ⁇ , 7.8 x 75 mm ProPac HIC- 10 column (Dionex), followed by washing with buffer A. A 0-100% buffer B (25 mM sodium phosphate, pH 6.5, 25% isopropanol) linear gradient over 40 column volumes (CVs) was performed to separate the bispecific antibody from any unreacted half antibodies or aggregated protein. Identity of the eluting peaks was monitored by SDS-PAGE and mass spectrometry (see below for method details).
  • bispecific antibodies were further purified by cation-exchange
  • the HIC pooled material was dialyzed into 20 mM sodium acetate, pH 5.0, loaded onto a 10 ⁇ Mono S 5/50 GL column (GE Healthcare), and washed with buffer A (20 mM sodium acetate, pH 5.0).
  • buffer A (20 mM sodium acetate, pH 5.0).
  • buffer B (20 mM sodium acetate, pH 5.0, 1 M NaCl) linear gradient over 40 CVs was performed and the desired fractions pooled.
  • the purified bispecific antibodies were formulated in 20 mM histidine acetate, 240 mM sucrose, 0.02% Tween-20, pH 5.5.
  • LC-MS was used to confirm the identity of the purified, annealed species (Fig. Id, 2c, Table 3). To reduce heterogeneity the antibodies were deglycosylated with PNGaseF before analysis.
  • the major species in the anti-Kl 1/K48 assembly is indeed the bispecific with an observed mass of 144,617.30 Da that is within 4.11 Da of the theoretical mass (144,613.19 Da).
  • the anti-Kl 1 monospecific antibody and the anti-Kl 1/K48 bispecific antibody were labeled with Alexa Fluor® 488 and Alexa Fluor® 546, respectively, according to the manufacturer's instructions using Alexa Fluor® Protein Labeling Kits (ThermoFisher).
  • anti-K48 knob HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG underlined)
  • anti-K63 knob HC (with VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS signal sequence REEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD underlined)
  • anti-K63 mature knob HC NVFSCSVMHEALHNHYTQKSLSLSPGK MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFN VKTGLIHWVRQAPGKGLEWVAYITPYYGSTSYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICN HKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLT
  • anti-linear knob HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG underlined)
  • HVRs VASITPSSGQTDYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY
  • HC heavy chain
  • LC light chain
  • HCVR heavy chain variable region
  • HVR hypervariable region

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Epidemiology (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention provides antibodies having greater avidity for a mixed-topology polyubiquitin than a single-topology polyubiquitin and multispecific anti-polyubiquitin antibodies, and methods of using the same.

Description

ANTI-POLYUBIQUITIN MULTISPECIFIC ANTIBODIES
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of priority of US Provisional Application No. 62/354,305, filed June 24, 2016, which is incorporated by reference herein in its entirety for any purpose.
FIELD OF THE INVENTION
[0002] The present invention relates to anti-polyubiquitin multispecific antibodies and methods of making and using the same.
INTRODUCTION AND SUMMARY
[0003] Ubiquitin is a small protein that has important regulatory roles in a wide variety of cellular pathways. The best known of these is ubiquitin' s role in protein degradation, where covalent attachment of ubiquitin to a target protein enables that targeted protein to be recognized and destroyed by the 26S proteasome {see Wilkinson, Semin. Cell Devel. Biol. 11(3): 141-148 (2000)). The covalent attachment of ubiquitin, a 76 amino acid protein, to a target protein is a three-step enzymatic process (Pickart, Annu. Rev. Biochem. 70: 503-533 (2001)). First, ubiquitin-activating enzyme El forms an ubiquitin-El thioester in an ATP-dependent reaction. The ubiquitin is transferred from the ubiquitin-El thioester to a member of the ubiquitin- conjugating enzyme (E2) family in the second step. In the third step, with the assistance of a ubiquitin-protein ligase (E3), an isopeptide bond is formed between the carboxyl terminus of ubiquitin and the ε-amino group of a lysine residue on the target protein. Enzymes termed deubiquitinases remove ubiquitin moieties from target proteins (Guterman and Glickman, Curr. Prot. Pep. Sci. 5: 201-210 (2004)).
[0004] Ubiquitin contains seven lysine residues (Lys6, Lysl 1, Lys27, Lys33, Lys29, Lys48, and Lys63), and thus ubiquitin itself may serve as a target protein for ubiquitination (Peng et a/., Nat. Biotechnol. 21 : 921-926 (2003); Pickart and Fushman, Curr. Opin. Chem. Biol. 8:610-616 (2004)). The molecule produced upon ubiquitination of a ubiquitin protein is termed a polyubiquitin molecule, and may comprise two or more ubiquitin moieties. Ubiquitination of ubiquitin may theoretically occur at any of the seven lysine residues (Peng et a/., Nat.
Biotechnol. 21 : 921-926 (2003)), so that different species of polyubiquitins exist having isopeptide bonds to different lysine residues within ubiquitin. Polyubiquitin chains with internal isopeptide linkages at all seven lysine residues have been reported. Iwai and Tokunaga, EMBO Reports 10:706-713 (2009). [0005] Additionally, linear polyubiquitin linkages form in which the C-terminal glycine of ubiquitin is conjugated to the a-amino group of the N-terminal methionine of another ubiquitin molecule. Iwai and Tokunaga, EMBO Reports 10:706-713 (2009). Linear
polyubiquitin is formed via the linear ubiquitin chain assembly complex (LUBAC) which is composed of two ring finger proteins, HOIL-1L and HOIP. Tokunaga et al., Nat. Cell Biol. 11 : 123-132 (2009). It is believed that genetically encoded, unanchored linear polyubiquitin does not exist in cells as its C-terminus is vulnerable to cleavage by isopeptidase T. Iwai and Tokunaga, EMBO Reports 10:706-713 (2009). This observation suggests that linear
polyubiquitin is assembled onto a substrate protein post-translationally and that conjugated linear polyubiquitin molecules are potential modulators of protein activity and function. Id. For example, linear polyubiquitination of the F-κΒ essential modulator (NEMO) has been shown to play a role in NF-κΒ activation. Id.
[0006] Polyubiquitin chains comprising two or more Ub to Ub linkages (three or more ubiquitin monomers) can have homogeneous or mixed topology. A chain is homogenous if the same residue is modified during the successive steps of elongation, as in the case of uniformly linear (or Metl-), Lysl 1-, Lys48-, or Lys63-linked chains, while a chain has mixed topology if there are different linkages at different positions in the chain. Komander and Rape, Annu. Rev. Biochem. 81 :203-29 (2012). A mixed chain may be (but is not necessarily) branched, wherein the same monomer has at least three different linkages (such as linkages to three other ubiquitin monomers, or a linkage to a substrate polypeptide and linkages to two other ubiquitin monomers). Id. Mixed topology chains have been reported in the contexts of NF-κΒ signaling and protein trafficking. Id.; see also Refs. 7-10 therein. Additionally, the same protein can be polyubiquitinated at two or more positions with at least first and second polyubiquitins, with the first and second polyubiquitins having different linkages.
[0007] The traditional method for determining linkages of trypsin digest and LC-MS/MS is not believed to be feasible with branched chains. Cleavage by trypsin after additional lysine and arginine residues between Kl 1 and K48 in the primary sequence of ubiquitin prevents identification of the modified Kl 1 and K48 within a single peptide.
[0008] Indirect approaches for detecting branched polyubiquitin chains have been described. In order to demonstrate the existence of branched chains, a combination of Kl 1R and K48R ubiquitin mutants and an engineered ubiquitin containing an inserted TEV cleavage site were used as well as chimeric E2 enzymes to reprogram the specificity of linkages synthesized by the anaphase-promoting complex/cyclosome. See Meyer, H. J. & Rape, M. Cell 157, 910- 921 (2014). [0009] Multispecific antibodies that bind mixed-topology polyubiquitin and/or have specificity for different polyubiquitin linkages could provide benefits such as simplifying the detection of mixed-topology polyubiquitin chains or proteins polyubiquitinated with
polyubiquitins having different linkages, facilitating further examination of the role of such chains in protein degradation and regulation, targeting and modulating mixed-topology polyubiquitin in pathways that involve it, or at least a useful choice.
[0010] Provided herein are multispecific anti -polyubiquitin antibodies and
immunoconjugates and methods of using the same. The antibodies can be useful for detection procedures such as immunohistochemistry, Western blotting, immunoprecipitation, ELISA, etc., and functional assays.
[0011] Provided herein is an antibody with a greater avidity for a mixed-topology polyubiquitin than a single-topology polyubiquitin, wherein the mixed-topology polyubiquitin comprises a first linkage and a second linkage, wherein the first linkage and the second linkage differ from one another. Also provided herein is a multispecific antibody that binds a mixed- topology polyubiquitin comprising a first linkage and a second linkage, the antibody comprising a first antigen recognition site specific for the first linkage, and a second antigen recognition site specific for the second linkage, wherein the first linkage and the second linkage differ from one another.
[0012] In some embodiments, an antibody provided herein comprises a first VH/VL unit specific for the first linkage, and a second VH/VL unit specific for the second linkage. In some embodiments, the antibody is a knob-in-hole bispecific antibody; a bispecific antibody comprising a leucine zipper; a cross-linked pair of antibodies; an antibody Fc-heterodimeric molecule; a diabody; a triabody; a tetrabody; a single-chain Fv dimer; a trispecific antibody; an octopus antibody; or a dual acting FAb.
[0013] In some embodiments, the first linkage or the second linkage is a Kl 1 linkage.
[0014] the first linkage or the second linkage is a K48 linkage.
[0015] the first linkage or the second linkage is a K63-linkage.
[0016] the first linkage or the second linkage is a C-terminal to N-terminal -linkage.
[0017] the first linkage and the second linkage are: a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N-terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N-terminal linkage.
[0018] In some embodiments, the antibody comprises a first half antibody that comprises: a) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 14; b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28; c) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42; or d) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
[0019] In some embodiments, the antibody comprises a second half antibody that comprises: a) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 14; b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28; c) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42; or d) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56, wherein the HVRs of the second half antibody are not identical to the HVRs of the first half antibody.
[0020] In some embodiments, the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28; b) one of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 42; c) one of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56; d) one of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42; e) one of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
(i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56; or f) one of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and (vi) HVR- L3 comprising the amino acid sequence of SEQ ID NO: 42, and the other of the first and second half antibodies comprises (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53, (iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and (vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
[0021] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8; b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95%) sequence identity to SEQ ID NO: 36; or d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50.
[0022] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8; b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95%) sequence identity to SEQ ID NO: 36; or d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50; wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
[0023] In some embodiments, the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22; b) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; c) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50; d) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; e) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50; or f) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36, and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50.
[0024] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8; b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
[0025] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8; b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
[0026] In some embodiments, the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22; b) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; c) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; d) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; e) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; or f) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
[0027] In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a mouse, rabbit, human, humanized, or chimeric antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the antibody is an IgGl, IgG2a, IgG2b, IgG3, or IgG4 antibody. In some embodiments, the antibody is an IgGl or IgG4 antibody.
[0028] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a first heavy chain constant region comprising a knob mutation and the second half antibody comprises a second heavy chain constant region comprising a hole mutation; or wherein the first half antibody comprises a first heavy chain constant region comprising a hole mutation and the second half antibody comprises a second heavy chain constant region comprising a knob mutation.
[0029] In some embodiments, the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V. In some embodiments, the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
[0030] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44.
[0031] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0032] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0033] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0034] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0035] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
[0036] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0037] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0038] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0039] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0040] In some embodiments, the antibody comprises first and second half antibodies, wherein: a) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; b) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; c) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; d) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95%) sequence identity to SEQ ID NO: 6, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; e) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95%) sequence identity to SEQ ID NO: 6, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; f) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; g) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; h) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; i) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95%) sequence identity to SEQ ID NO: 32, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; j) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95%) sequence identity to SEQ ID NO: 20, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; k) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95%) sequence identity to SEQ ID NO: 20, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; or 1) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34, and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0041] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2; b) a light chain sequence of SEQ ID NO: 16; c) a light chain sequence of SEQ ID NO: 30; or d) a light chain sequence of SEQ ID NO: 44.
[0042] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence of SEQ ID NO: 4; b) a heavy chain sequence of SEQ ID NO: 18; c) a heavy chain sequence of SEQ ID NO: 32; or d) a heavy chain sequence of SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0043] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0044] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a heavy chain sequence of SEQ ID NO: 6; b) a heavy chain sequence of SEQ ID NO: 20; c) a heavy chain sequence of SEQ ID NO: 34; or d) a heavy chain sequence of SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0045] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0046] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2; b) a light chain sequence of SEQ ID NO: 16; c) a light chain sequence of SEQ ID NO: 30; or d) a light chain sequence of SEQ ID NO: 44; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0047] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence of SEQ ID NO: 4; b) a heavy chain sequence of SEQ ID NO: 18; c) a heavy chain sequence of SEQ ID NO: 32; or d) a heavy chain sequence of SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0048] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0049] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a heavy chain sequence of SEQ ID NO: 6; b) a heavy chain sequence of SEQ ID NO: 20; c) a heavy chain sequence of SEQ ID NO: 34; or d) a heavy chain sequence of SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0050] In some embodiments, the antibody comprises first and second half antibodies, wherein the second half antibody comprises a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6; b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
[0051] In some embodiments, the antibody comprises first and second half antibodies, wherein: a) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20; b) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; c) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; d) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18; e) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; f) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; g) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34; h) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; i) the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; j) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32; k) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; or 1) the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0052] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0053] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0054] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0055] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0056] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0057] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0058] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0059] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0060] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0061] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0062] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0063] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0064] Also provided herein is an antibody that competes with an antibody disclosed herein for binding to a mixed-topology polyubiquitin. Also provided herein is an antibody that binds the same epitopes of a mixed-topology polyubiquitin as an antibody disclosed herein.
[0065] In some embodiments, an antibody provided herein is a bispecific antibody. In some embodiments, the antibody is a diabody, triabody, or tetrabody.
[0066] In some embodiments, the antibody is conjugated to a label. In some
embodiments, the label is a fluorescent, enzymatic, or chromogenic label. In some embodiments, the label is a radioisotope, which is optionally a positron emitter, which is optionally 89Zr.
[0067] Also provided herein is a composition comprising an antibody disclosed herein, wherein the composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies. [0068] Also provided herein is an immunoconjugate comprising an antibody disclosed herein and a cytotoxic agent.
[0069] Also provided herein is a pharmaceutical formulation comprising a
pharmaceutically acceptable carrier and at least one of an the antibody or immunoconjugate disclosed herein. In some embodiments, the composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
[0070] Also provided herein is an isolated nucleic acid encoding: an antibody disclosed herein; a first half antibody of an antibody disclosed herein; or a second half antibody of an antibody disclosed herein. Also provided herein is a host cell comprising a nucleic acid disclosed herein. Also provided herein is a method of producing an antibody or half-antibody comprising culturing a host cell disclosed herein so that the antibody or half antibody is produced.
[0071] Also provided herein is a method of making an antibody disclosed herein, comprising forming the antibody from a first half antibody and a second half antibody.
[0072] Also provided herein is a method of detecting a mixed-topology polyubiquitin in a biological sample comprising contacting the biological sample with an antibody disclosed herein under conditions permissive for binding of the antibody to the mixed-topology polyubiquitin, and detecting whether a complex is formed between the antibody and mixed- topology polyubiquitin in the biological sample. In some embodiments, the mixed-topology polyubiquitin is covalently attached to a non-ubiquitin polypeptide. In some embodiments, the mixed-topology polyubiquitin is branched. In some embodiments, the mixed-topology polyubiquitin is unbranched. In some embodiments, the mixed-topology polyubiquitin comprises a first linkage and a second linkage different from the first linkage, and the first and second linkages are each independently a Kl 1, K48, K63, or C-terminal to N-terminal linkage. In some embodiments, the mixed-topology polyubiquitin comprises a Kl 1 linkage and a second linkage different from the Kl 1 linkage. In some embodiments, the mixed-topology polyubiquitin comprises a K48 linkage and a second linkage different from the K48 linkage. In some embodiments, the mixed-topology polyubiquitin comprises a K63 linkage and a second linkage different from the K63 linkage. In some embodiments, the mixed-topology polyubiquitin comprises a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage. In some embodiments, wherein the mixed-topology polyubiquitin comprises: a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N- terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N-terminal linkage. [0073] Also provided herein is a method of detecting a polyubiquitinated protein in a biological sample, the polyubiquitinated protein being polyubiquitinated at two or more positions with at least first and second polyubiquitins, with the first and second polyubiquitins having different linkages, comprising contacting the biological sample with the antibody of any one of claims 1 to 69 under conditions permissive for binding of the antibody to the
polyubiquitinated protein, and detecting whether a complex is formed between the antibody and polyubiquitinated protein in the biological sample. In some embodiments, the first and second polyubiquitins respectively comprise: a Kl 1 linkage and a second linkage different from the Kl 1 linkage; a K48 linkage and a second linkage different from the K48 linkage; a K63 linkage and a second linkage different from the K63 linkage; a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage; a Kl 1 linkage and a K48 linkage; a Kl 1 linkage and a K63 linkage; a Kl 1 linkage and a C- to N-terminal linkage; a K48 linkage and a K63 linkage; a K48 linkage and a C- to N-terminal linkage; or a K63 linkage and a C- to N- terminal linkage.
BRIEF DESCRIPTION OF THE FIGURES
[0074] Figures la-d. Engineering, purification, and characterization of a bispecific anti-Kll K48 polyubiquitin linkage-specific antibody, a, Knob and hole half antibodies were recombinantly expressed separately in CHO cells and affinity purified individually and then assembled in vitro, b, SDS-PAGE analysis of knob and hole half antibodies and assembled bispecific antibodies post purification. Samples were run in the absence (-) or presence (+) of DTT. The HL label denotes a half antibody species and the H2L2 label denotes a full antibody. In the reduced samples the heavy chains (H) and light chains (L) are indicated, c, Analytical size- exclusion analysis of the anti-Kl 1 knob and anti-K48 hole half antibodies and the assembled anti-Kl 1/K48 bispecific antibody, d, Mass spectrometry analysis of the purified anti-Kl 1/K48 bispecific antibody. Top panel is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB.
[0075] Figures 2a-c. Characterization of the half antibodies and control bispecific antibodies, a, Analytical size-exclusion analysis of the anti-Kl 1 hole and anti-gD knob half antibodies and the assembled anti-Kl 1/gD and anti-K48/gD bispecific control antibodies, b, Mass spectrometry analysis of the affinity purified anti-Kl l knob, anti-Kl l hole, anti-K48 hole, and anti-gD knob half antibodies. Top panel for each half antibody is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB. Arrows in the top panels indicate a +128 Da addition to the anti-Kl 1 knob, anti-Kl 1 hole, and anti-gD knob half antibodies that disappears upon CPB treatment indicating that it is due to the heavy chain carboxy-terminal lysine still attached to a portion of the antibodies, c, Mass spectrometry analysis of the purified anti-Kl 1/gD and anti-K48/gD control bispecific antibodies. Top panel for each bispecific is in the absence of carboxypeptidase B (CPB) and the bottom panel is after digest with CPB.
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
I. DEFINITIONS
[0076] As used herein, VH refers to a heavy chain variable domain and VL refers to a light chain variable domain.
[0077] An "acceptor human framework" for the purposes herein is a framework comprising the amino acid sequence of a VL framework or a VH framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
[0078] As used herein, "about" refers to a value that is 10% more or less than a stated value, gives results functionally equivalent to the stated value, or rounds to the stated value.
[0079] "Affinity" refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
[0080] "Avidity" refers to the strength of the sum total of noncovalent interactions between a molecule (e.g., an antibody) and its binding partner (e.g., a target molecule comprising one or more antigens). The avidity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). A bispecific antibody will generally have a greater avidity for a binding partner comprising epitopes recognized by both of the antigen binding sites of the bispecific antibody than for a binding partner comprising either of the eptiopes individually. Avidity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding avidity are described in the following. The term "functional affinity" is sometimes used in the art to refer to avidity.
[0081] An "affinity matured" antibody refers to an antibody with one or more alterations in one or more hypervariable regions (HVRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
[0082] The term "antibody" is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity. The term "multispecific antibody" as used herein refers to an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of binding to two, or more, different epitopes on one molecule or is capable of binding to epitopes on two, or more, different molecules).
[0083] An "agonist antibody" as used herein is an antibody which mimics at least one of the functional activities of a polypeptide of interest.
[0084] An "antagonist antibody" or a "blocking antibody" is an antibody which inhibits or reduces biological activity of the antigen to which it specifically binds. Certain blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
[0085] The term "antibody drug conjugate" (ADC) as used herein is equivalent to the term "immunoconjugate".
[0086] An "antibody fragment" refers to a molecule other than an intact antibody that comprises a portion of an intact antibody and that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
[0087] An "antibody that binds to the same epitope" as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more. An exemplary competition assay is provided herein.
[0088] The terms "anti-mixed-topology polyubiquitin antibody" and "an antibody that binds to mixed-topology polyubiquitin" refer to an antibody that is capable of binding mixed- topology linked polyubiquitin with sufficient avidity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting mixed-topology polyubiquitin. In some embodiments, the extent of binding of an anti-mixed-topology polyubiquitin antibody to an unrelated, non-mixed-topology-linked polyubiquitin protein is less than about 10% of the binding of the antibody to mixed-topology polyubiquitin as measured, e.g., by a
radioimmunoassay (RIA). In certain embodiments, an antibody that binds to mixed-topology polyubiquitin has a dissociation constant (Kd) of < ΙμΜ, < 100 nM, < 10 nM, < 1 nM, < 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10"8 M or less, e.g. from 10"8 M to 10"13 M, e.g., from 10"9 M to 10"13 M). In certain embodiments, an anti-mixed-topology polyubiquitin antibody binds to epitopes of the mixed-topology polyubiquitin that are conserved among the mixed-topology polyubiquitin from different species.
[0089] As used herein, the term "anti-polyubiquitin antibody" refers to an antibody that is capable of specifically binding to a polyubiquitin molecule.
[0090] As used herein, the terms "anti-ubiquitin antibody" and "anti-monoubiquitin antibody" are used interchangeably, and refer to an antibody that is capable of specifically binding to a ubiquitin molecule.
[0091] The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation. Examples of cancer include, but are not limited to, carcinoma, lymphoma (e.g., Hodgkin's and non-Hodgkin's lymphoma), blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, leukemia and other
lymphoproliferative disorders, and various types of head and neck cancer.
[0092] The term "chimeric" antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
[0093] The "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGi, IgG2, IgG3, IgG4, IgAi, and IgA2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. [0094] The term "cytotoxic agent" as used herein refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof; and the various antitumor or anticancer agents disclosed below.
[0095] "Effector functions" refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
[0096] An "effective amount" of an agent, e.g., a pharmaceutical formulation, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
[0097] The term "epitope" refers to the particular site on an antigen molecule to which an antibody binds.
[0098] The term "Fc region" herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In some embodiments, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
[0099] As used herein, "first," "second," etc. are used with reference to elements of a complex structure, e.g., a protein with terti ary /quaternary structure such as an antibody or other assembly such as a polyubiquitin, to refer to those elements (e.g., monomers, chains, domains) without any implication as to the ordering or positioning of the elements; thus a "first" element may be C- or N- terminal to a second element, or closer or farther from one end or another of the structure than a second element. Thus, for example, with reference to the halves of a bispecific antibody or to linkages in a mixed-topology polyubiquitin, the designation of a half or a linkage as first or second is arbitrary.
[0100] "Framework" or "FR" refers to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
[0101] The terms "full length antibody," "intact antibody," and "whole antibody" are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
[0102] The terms "host cell," "host cell line," and "host cell culture" are used
interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include "transformants" and "transformed cells," which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0103] A "human antibody" is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non- human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
[0104] A "rabbit antibody" is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a rabbit or a rabbit cell or derived from a non- rabbit source that utilizes rabbit antibody repertoires or other rabbit antibody-encoding sequences.
[0105] A "human consensus framework" is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3. In some embodiments, for the VL, the subgroup is subgroup kappa I as in Kabat et al., supra. In some embodiments, for the VH, the subgroup is subgroup III as in Kabat et al., supra.
[0106] A "humanized" antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs. In certain embodiments, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. A "humanized form" of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization.
[0107] The term "hypervariable region" or "HVR," as used herein, refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops"). Generally, native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3). HVRs generally comprise amino acid residues from the hypervariable loops and/or from the
"complementarity determining regions" (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition. Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50-52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3).
(Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987).) Exemplary CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-Hl, CDR-H2, and CDR-H3) occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3. (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).) With the exception of CDR1 in VH, CDRs generally comprise the amino acid residues that form the hypervariable loops. CDRs also comprise "specificity determining residues," or "SDRs," which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a-CDRs. Exemplary a-CDRs (a-CDR- Ll, a-CDR-L2, a-CDR-L3, a-CDR-Hl, a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI, 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3. (See Almagro and Fransson, Front. Biosci. 13 : 1619-1633 (2008).) Unless otherwise indicated, HVR residues and other residues in the variable domain (e.g., FR residues) are numbered herein according to Kabat et al., supra.
[0108] An "immunoconjugate" is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent. An immunoconjugate is equivalent to the term "antibody drug conjugate" (ADC).
[0109] An "individual" or "patient" or "subject" is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human. [0110] An "isolated antibody" is one which has been separated from a component of its natural environment. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoresis (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatography (e.g., ion exchange or reverse phase HPLC). For a review of methods for assessment of antibody purity, see, e.g., Flatman et al., J.
Chromatogr. B 848:79-87 (2007).
[0111] An "isolated nucleic acid" refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0112] "Mixed-topology polyubiquitin" refers to polyubiquitin comprising two or more different Ub to Ub linkages, i.e., different linkages at different positions in the polyubiquitin, and may be branched (wherein at least one monomer is connected to at least three other monomers or to a substrate polypeptide and at least two other monomers) or unbranched (wherein the monomers are not connected to more than two other monomers or to two monomers and a substrate polypeptide). Thus, in a branched mixed-topology polyubiquitin, there would be a ubiquitin at the branch point with its C-terminus linked to, e.g., lysine 11 of the previous ubiquitin, while, e.g., the lysine 11 and the lysine 48 of the ubiquitin at the branch point could both be linked to subsequent ubiquitins. In an unbranched mixed-topology polyubiquitin, none of the ubiquitins would be connected directly to more than two other ubiquitins, but at least one of the ubiquitins would be involved in two different ubiquitin to ubiquitin linkages, e.g., its C-terminus could be linked to lysine 11 of the previous ubiquitin while its lysine 48 is linked to the subsequent ubiquitin.
[0113] The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
[0114] A "naked antibody" refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel. The naked antibody may be present in a pharmaceutical formulation.
[0115] "Native antibodies" refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3). Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain. The light chain of an antibody may be assigned to one of two types, called kappa (κ) and lambda (λ), based on the amino acid sequence of its constant domain.
[0116] "Or" is used in the inclusive sense, i.e., equivalent to "and/or," unless the context requires otherwise.
[0117] "Percent (%) amino acid sequence identity" with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
[0118] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y
[0119] where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
[0120] The term "pharmaceutical formulation" refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
[0121] A "pharmaceutically acceptable carrier" refers to an ingredient in a
pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
[0122] As used herein, "substantially free of means that the referenced entity is absent or, if present, is (i) in a sufficiently low quantity so as not to significantly alter a functional property or result of a composition, method, use, or step, as the case may be; (ii) is undetectable by at least one appropriate analytical method, such as mass spectrometry (e.g., MALDI-TOF or any MS procedure used in the Examples), blotting (e.g., Western for a polypeptide), or electrophoresis (e.g., SDS-PAGE with Coomassie blue or silver staining); or (iii) is present in an amount less than or equal to about 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1%, by mass or by mole fraction relative to the total amount of non-solvent material in the composition.
[0123] As used herein, "treatment" (and grammatical variations thereof such as "treat" or "treating") refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies disclosed herein are used to delay development of a disease or to slow the progression of a disease.
[0124] The term "variable region" or "variable domain" refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). (See, e.g., Kindt et al. Kuby
Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).) A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
[0125] The term "vector," as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors."
II. COMPOSITIONS AND METHODS
[0126] In some aspects, antibodies that bind to mixed-topology polyubiquitin chains are provided. Such antibodies are useful, e.g., for detecting, modulating the activity of, or immunoprecipitating mixed-topology polyubiquitin chains.
A. Exemplary Antibodies
[0127] In some embodiments, an antibody has a greater avidity for a mixed-topology polyubiquitin than for a single-topology polyubiquitin, wherein the mixed-topology
polyubiquitin comprises a first linkage and a second linkage, wherein the first linkage and the second linkage differ from each other. In some embodiments, an antibody is a multispecific antibody that binds a mixed-topology polyubiquitin comprising a first linkage and a second linkage, the antibody comprising a first VH/VL unit specific for the first linkage, and a second VH/VL unit specific for the second linkage, wherein the first linkage and the second linkage differ from each other. For example, an antibody can comprise a first antigen recognition site and a second antigen recognition site, wherein the first antigen recognition site is specific for the first linkage and the second antigen recognition site is specific for the second linkage. Because both antigen recognition sites can specifically engage a mixed-topology polyubiquitin whereas only one antigen recognition site can specifically engage a single-topology polyubiquitin, the antibody has greater avidity for the mixed-topology polyubiquitin.
[0128] In some embodiments, the first linkage is a Kl 1, K48, K63, or C-terminal to N- terminal-linkage. In some embodiments, the second linkage is a Kl 1, K48, K63, or C-terminal to N-terminal-linkage. In some embodiments, the first and second linkages are independently a Kl 1, K48, K63, or C-terminal to N-terminal-linkage. Unless otherwise indicated, the first and second linkages are different.
[0129] The antibodies, antibody sequences, and sequence listing disclosed in U.S. Patent No. 7,763,245 are incorporated herein by reference. In some embodiments, the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a polyubiquitin.
[0130] The antibodies, antibody sequences, and sequence listing disclosed in U.S. Patent No. 8, 133,488 are incorporated herein by reference. In some embodiments, the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 8, 133,488 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 8, 133,488, wherein the half antibody binds a polyubiquitin.
[0131] The antibodies, antibody sequences, and sequence listing disclosed in U.S. Patent No. 8,992,919 are incorporated herein by reference. In some embodiments, the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a polyubiquitin.
[0132] The antibodies, antibody sequences, and sequence listing disclosed in U.S. Patent No. 9,321,844 are incorporated herein by reference. In some embodiments, the first or second half antibody comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 selected from the HVRs disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a polyubiquitin.
[0133] Unless otherwise indicated, at least one of the HVRs of the second half antibody is not identical to the corresponding HVR of the first half antibody. In some embodiments, at least two of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody. In some embodiments, at least three of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody. In some embodiments, at least four of the HVRs of the second half antibody are not identical to the corresponding HVR of the first half antibody. In some embodiments, at least five of the HVRs of the second half antibody are not identical to the corresponding HVRs of the first half antibody. In some embodiments, the six HVRs of the second half antibody are not identical to the HVRs of the first half antibody.
[0134] In some embodiments, the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 9, 10, 11, 12, 13, and 14, respectively. In some embodiments, the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 23, 24, 25, 26, 27, and 28, respectively. In some embodiments, the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 37, 38, 39, 40, 41, and 42, respectively. In some embodiments, the first half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 51, 52, 53, 54, 55, and 56, respectively.
[0135] In some embodiments, the second half antibody comprises an HVR-Hl, HVR- H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 9, 10, 11, 12, 13, and 14, respectively. In some embodiments, the second half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 23, 24, 25, 26, 27, and 28, respectively. In some embodiments, the second half antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 37, 38, 39, 40, 41, and 42, respectively. In some embodiments, the second half antibody comprises an HVR- Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 comprising the amino acid sequences of SEQ ID NOs: 51, 52, 53, 54, 55, and 56, respectively. [0136] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28.
[0137] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42.
[0138] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56;
[0139] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42;
[0140] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56; or [0141] In some embodiments, one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
[0142] In some embodiments, the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8. In some
embodiments, the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22. In some embodiments, the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36. In some embodiments, the first or second half antibody comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50.
[0143] Unless otherwise indicated, at least one of the VL and VH sequences of the second half antibody is not identical to its counterpart in the first half antibody. In some embodiments, the VL sequence of the second half antibody is not identical to the VL sequence of the first half antibody. In some embodiments, the VH sequence of the second half antibody is not identical to the VH sequence of the first half antibody. In some embodiments, the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
[0144] In some embodiments, a) one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22. In some embodiments, one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36. In some embodiments, one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 8, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 50. In some embodiments, one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36. In some embodiments, one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 22, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50. In some embodiments, one of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 36, and the other of the first and second half antibodies comprises a VL sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 50.
[0145] In some embodiments, the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a polyubiquitin.
[0146] In some embodiments, the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,133,488 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,133,488, wherein the half antibody binds a polyubiquitin.
[0147] In some embodiments, the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a polyubiquitin.
[0148] In some embodiments, the first or second half antibody comprises VH and VL sequences at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the VH and VL sequences of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a polyubiquitin.
[0149] In some embodiments, the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 7,763,245 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 7,763,245, wherein the half antibody binds a
polyubiquitin.
[0150] In some embodiments, the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,133,488 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8, 133,488, wherein the half antibody binds a
polyubiquitin.
[0151] In some embodiments, the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 8,992,919 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 8,992,919, wherein the half antibody binds a
polyubiquitin.
[0152] In some embodiments, the first or second half antibody comprises the VH and VL sequences of an antibody disclosed in U.S. Patent No. 9,321,844 that binds a polyubiquitin. In some embodiments, the first or second half antibody comprises a combination of VH and VL sequences disclosed in U.S. Patent No. 9,321,844, wherein the half antibody binds a
polyubiquitin.
[0153] In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to a polyubiquitin. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in a VH sequence. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs). Optionally, the antibody comprises a VH sequence discussed above, including post-translational modifications of that sequence.
[0154] In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an antibody comprising that sequence retains the ability to bind to a polyubiquitin. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in a VL sequence. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs). Optionally, the antibody comprises a VL sequence discussed above, including post-translational modifications of that sequence.
[0155] In some embodiments, the antibody is humanized. In some embodiments, the antibody comprises HVRs as in any of the above embodiments, and further comprises a human acceptor framework, e.g. a human immunoglobulin framework or a human consensus framework. In some embodiments, the antibody comprises HVRs as in any of the above embodiments and rabbit framework regions.
[0156] In some aspects, an antibody that binds to the same epitopes as a bispecific antibody provided herein is provided. For example, in certain embodiments, an antibody is provided that binds to the same epitopes as an antibody comprising first and second half antibodies, wherein:
a) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22;
b) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
c) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50;
d) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
e) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; or
f) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36, and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
[0157] In some embodiments, an antibody that competes for binding to a mixed- topology polyubiquitin with a bispecific antibody comprising VH and VL sequences as in one of a) through f) in the preceding paragraph is provided.
[0158] In some embodiments, the antibody is a monoclonal antibody, including a chimeric, humanized or human antibody. In some embodiments, the antibody is an antibody fragment, e.g., a dimeric scFv, diabody, or F(ab')2 fragment. In another embodiment, the antibody is a substantially full length antibody, e.g., an IgGl, IgG2a, IgG2b, IgG3, or IgG4 antibody, or other antibody class or isotype as defined herein.
[0159] In some embodiments, the antibody comprises at least one heavy chain with a C- terminal lysine. In some embodiments, the antibody comprises at least one heavy chain lacking a C-terminal lysine. In some embodiments, the antibody comprises only heavy chains without a C-terminal lysine. C-terminal lysines can be removed, e.g., enzymatically, such as by carboxypeptidase treatment, or genetically, such as by deletion or substitution of the lysine codon at the 3' end of a heavy chain coding sequence. Heavy chain C-terminal lysines are located far from antigen binding sites and dispensable for binding activity, and their removal can provide more homogeneous antibody preparations.
[0160] In some embodiments, the antibody comprises first and second half antibodies, wherein the first or second half antibody comprises
a) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4;
b) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18;
c) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32; or
d) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0161] In some embodiments, the antibody comprises first and second half antibodies, wherein the first or second half antibody comprises
a) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6;
b) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20;
c) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34; or
d) a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48,
optionally wherein a C-terminal lysine is missing from one or more chains.
[0162] In some embodiments, the antibody comprises first and second half antibodies, wherein
a) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20;
b) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34;
c) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
d) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18;
e) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32;
f) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46;
g) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34;
h) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
i) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 48;
j) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 32; k) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 20,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46; or
1) one of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 34,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 46,
optionally wherein a C-terminal lysine is missing from one or more chains.
[0163] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0164] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0165] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0166] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0167] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0168] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
[0169] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0170] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0171] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0172] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0173] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0174] In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
[0175] In a further aspect, an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1-7 below.
1. Antibody Affinity
[0176] In certain embodiments, an antibody provided herein has a dissociation constant (Kd) of < ΙμΜ, < 100 nM, < 10 nM, < 1 nM, < 0.1 nM, < 0.01 nM, or < 0.001 nM, and optionally is > 10_13 M. (e.g. 10_8 M or less, e.g. from 10_8 M to 10_13 M, e.g., from 10_9 M to 10_ 13 M).
[0177] In some embodiments, Kd is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay. Solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293 :865-881(1999)). To establish conditions for the assay, MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 μg/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C). In a non-adsorbent plate (Nunc #269620), 100 pM or 26 pM [125I] -antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al., Cancer Res. 57:4593-4599 (1997)). The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN- 20®) in PBS. When the plates have dried, 150 μΐ/well of scintillant (MICRO SCINT-20™; Packard) is added, and the plates are counted on a TOPCOUNT™ gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays. [0178] In some embodiments, Kd is measured using surface plasmon resonance assays using a BIACORE®-2000 or a BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ) at 25°C with immobilized antigen CM5 chips at -10 response units (RU). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with /V-ethyl-N'- (3- dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 μg/ml (-0.2 μΜ) before injection at a flow rate of 5 μΐ/minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% polysorbate 20 (TWEEN-20™) surfactant (PBST) at 25°C at a flow rate of approximately 25 μΐ/min. Association rates (kon) and dissociation rates (k0ff) are calculated using a simple one-to-one Langmuir binding model
(BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (Kd) is calculated as the ratio k0ff/kon See, e.g., Chen et al., J. Mol. Biol. 293 :865-881 (1999). If the on-rate exceeds 106 M"
1 s~l by the surface plasmon resonance assay above, then the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity (excitation = 295 nm; emission = 340 nm, 16 nm band-pass) at 25°C of a 20 nM anti-antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing
concentrations of antigen as measured in a spectrometer, such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-AMINCO™ spectrophotometer (ThermoSpectronic) with a stirred cuvette.
2. Antibody Fragments
[0179] In certain embodiments, an antibody provided herein is an antibody fragment. Antibody fragments include, but are not limited to, F(ab')2 fragments, dimeric single chain Fv, and other fragments described below. For a review of certain antibody fragments, see Hudson et al. Nat. Med. 9: 129-134 (2003). For a review of scFv fragments, see, e.g., Pluckthiin, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458. For discussion of Fab and F(ab')2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Patent No. 5,869,046.
[0180] In some embodiments, the antibody is a diabody. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993).
[0181] Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Patent No. 6,248,516 B l).
[0182] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
3. Chimeric and Humanized Antibodies
[0183] In certain embodiments, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)). In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In a further example, a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[0184] In certain embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[0185] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13 : 1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat Ί Acad. Sci. USA
86: 10029-10033 (1989); US Patent Nos. 5, 821,337, 7,527,791, 6,982,321, and 7,087,409;
Kashmiri et al, Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing "resurfacing"); Dall'Acqua et al., Methods 36:43-60 (2005) (describing "FR shuffling"); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83 :252-260 (2000) (describing the "guided selection" approach to FR shuffling).
[0186] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit" method (see, e.g., Sims et al. J. Immunol. 151 :2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol, 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13 : 1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272: 10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271 :22611-22618 (1996)).
4. Human Antibodies
[0187] In certain embodiments, an antibody provided herein is a human antibody.
Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
[0188] Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous
immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23 : 1117-1125 (2005). See also, e.g., U.S. Patent Nos. 6,075, 181 and 6,150,584 describing XENOMOUSE™ technology; U.S. Patent No.
5,770,429 describing HuMAB® technology; U.S. Patent No. 7,041,870 describing K-M
MOUSE® technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VELOCIMOUSE® technology). Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
[0189] Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol, 133 : 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cei! hybridoma technology are also described in Li et al., Proc. Natl. Acad. Set. USA, 103 :3557-3562 (2006). Additional methods include those described, for example, in U.S. Patent No. 7, 189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical
Pharmacology, 27(3): 185-91 (2005).
[0190] Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
5. Library-Derived Antibodies
[0191] Antibodies may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NT, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, NT, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).
[0192] In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev.
Immunol, 12: 433-455 (1994). Phage typically display antibody fragments, either as single- chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574,
2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
[0193] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
6. Multispecific Antibodies
[0194] In certain embodiments, an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody. Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites. Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
[0195] Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole" engineering (see, e.g., U.S. Patent No. 5,731, 168). In some embodiments, the antibody comprises first and second half antibodies, wherein the first half antibody comprises a first heavy chain constant region comprising a knob mutation and the second heavy chain comprises a second heavy chain constant region comprising a hole mutation; or wherein the first half antibody comprises a first heavy chain constant region comprising a hole mutation and the second heavy chain comprises a second heavy chain constant region comprising a knob mutation. In some embodiments, the antibody is an IgGl antibody and the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgGl antibody and the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V. In some embodiments, the antibody is an IgG4 antibody and the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgG4 antibody and the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations. The foregoing numbering of the positions of mutation(s) is EU numbering. The actual position(s) of the mutation(s) in a heavy chain sequence may vary, e.g., depending on the length of the preceding variable region, such as by up to 10 positions. [0196] Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992)); using "diabody" technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444- 6448 (1993)); and using single-chain Fv (sFv) dimers (see,e.g. Gruber et al., J. Immunol, 152:5368 (1994)); and preparing trispecific antibodies as described, e.g., in Tutt et al. J.
Immunol. 147: 60 (1991). In some embodiments, the antibody is a diabody. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993).
[0197] Triabodies and tetrabodies are described in Hudson et al., Nat. Med. 9: 129-134 (2003). In some embodiments, the antibody is a triabody. In some embodiments, the triabody comprises a first antigen recognition site, a second antigen recognition site, and a third antigen recognition site, wherein at least one of the antigen recognition sites differs from the other antigen recognition sites. In some embodiments, the triabody comprises first, second, and third antigen recognition sites that bind three different polyubiquitins. In some embodiments, the triabody comprises first, second, and third antigen recognition sites that bind any three polyubiquitins selected from a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a Relinked polyubiquitin, and a C-terminal to N-terminal-linked polyubiquitin. Each antigen recognition site can comprise a combination of HVRs or of a VL and VH discussed above.
[0198] In some embodiments, the antibody is a tetrabody. In some embodiments, the tetrabody comprises a first antigen recognition site, a second antigen recognition site, a third antigen recognition site, and a fourth antigen recognition site, wherein at least one or at least two of the antigen recognition sites differ from the other antigen recognition sites. In some embodiments, the tetrabody comprises first, second, and third antigen recognition sites that bind three different polyubiquitins. In some embodiments, the tetrabody comprises first, second, and third antigen recognition sites that bind any three polyubiquitins selected from a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a K63 -linked polyubiquitin, and a C-terminal to N- terminal-linked polyubiquitin. In some embodiments, the tetrabody comprises first, second, third, and fourth antigen recognition sites that bind four different polyubiquitins. In some embodiments, the tetrabody comprises first, second, third, and fourth antigen recognition sites that bind a Kl 1 -linked polyubiquitin, a K48-linked polyubiquitin, a K63 -linked polyubiquitin, and a C-terminal to N-terminal-linked polyubiquitin. Each antigen recognition site can comprise a combination of HVRs or a combination of a VL and VH discussed above.
[0199] Engineered antibodies with three or more functional antigen binding sites, including "Octopus antibodies," are also included herein (see, e.g. US 2006/0025576A1). The term octopus antibody is used in the sense of those discussed in US 2006/0025576A1 and is not meant to refer to an antibody produced by or obtained from an octopus.
[0200] The antibody or fragment herein also includes a "Dual Acting FAb" or "DAF" comprising two antigen binding sites that binds two different antigens (see, US 2008/0069820, for example). For example, the two different antigens can be any of the polyubiquitins discussed above, such as Kl 1-, K48-, K63-, or C-terminal to N-terminal-linked polyubiquitins.
7. Antibody Variants
[0201] In certain embodiments, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired
characteristics, e.g., antigen-binding. a) Substitution, Insertion, and Deletion Variants
[0202] In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs and FRs. Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions." More substantial changes are provided in Table 1 under the heading of
"exemplary substitutions," and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TA BL E 1
Figure imgf000054_0001
Original Exemplary Preferred
Residue Substitutions Substitutions
Asn (N) Gin; His; Asp, Lys; Arg Gin
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gin (Q) Asn; Glu Asn
Glu (E) Asp; Gin Asp
Gly (G) Ala Ala
His (H) Asn; Gin; Lys; Arg Arg
lie (I) Leu; Val; Met; Ala; Phe; Norleucine Leu
Leu (L) Norleucine; He; Val; Met; Ala; Phe He
Lys (K) Arg; Gin; Asn Arg
Met (M) Leu; Phe; He Leu
Phe (F) Trp; Leu; Val; He; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) He; Leu; Met; Phe; Ala; Norleucine Leu
[0203] Amino acids may be grouped according to common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
[0204] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0205] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
[0206] Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g.,
Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).) In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
[0207] In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR "hotspots" or SDRs. In certain embodiments of the variant VH and VL sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
[0208] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by
Cunningham and Wells (1989) Science, 244: 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as arg, asp, his, lys, and glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex is used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
[0209] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody. b) Glycosylation variants
[0210] In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
[0211] Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The
oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody may be made in order to create antibody variants with certain improved properties.
[0212] In some embodiments, antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ± 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to "defucosylated" or "fucose-deficient" antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/0851 19; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004);
Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al., especially at Example 11), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
[0213] Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean- Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.). c) Fc region variants
[0214] In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence {e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification {e.g. a substitution) at one or more amino acid positions.
[0215] In certain embodiments, an antibody variant possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat 7 Acad. Sci. USA 83 :7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat 'lAcad. Sci. USA 82: 1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987)). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry
(CellTechnology, Inc. Mountain View, CA; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, WI). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Nat 'lAcad. Sci. USA 95:652-656 (1998). Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano- Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al., Blood 101 : 1045-1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103 :2738-2743 (2004)). FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int 'l. Immunol. 18(12): 1759-1769 (2006)).
[0216] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
[0217] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Patent No. 6,737,056; WO 2004/056312, and Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001).)
[0218] In certain embodiments, an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
[0219] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No. 6, 194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
[0220] Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826).
[0221] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Patent No.
5,648,260; U.S. Patent No. 5,624,821; and WO 94/29351 concerning other examples of Fc region variants. d) Cysteine engineered antibody variants
[0222] In certain embodiments, it may be desirable to create cysteine engineered antibodies, e.g., "thioMAbs," in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In certain embodiments, any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; K149 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Patent No. 7,521,541. e) Antibody Derivatives
[0223] In certain embodiments, an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethyl ene/maleic anhydride copolymer, polyaminoacids (either
homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, proly propylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
[0224] In another embodiment, conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided. In some embodiments, the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
B. Recombinant Methods and Compositions
[0225] Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567. In some embodiments, isolated nucleic acid encoding an antibody described herein is provided. Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In a further embodiment, a host cell comprising such nucleic acid is provided. In some such embodiments, a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody. In some embodiments, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell). In some embodiments, a method of making an antibody disclosed herein is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium). [0226] In some embodiments, components of a multispecific antibody (e.g., a first half antibody and second half antibody) are expressed in separate cells or cell cultures and then combined in vitro. In other embodiments, all components of a multispecific antibody are expressed in the same cell or cell culture.
[0227] For recombinant production of an antibody, nucleic acid encoding an antibody, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
[0228] Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Patent Nos.
5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Me thods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, describing expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
[0229] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized," resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat.
Biotech. 22: 1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).
[0230] Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
[0231] Plant cell cultures can also be utilized as hosts. See, e.g., US Patent Nos.
5,959,177, 6,040,498, 6,420,548, 7, 125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants).
[0232] Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23 :243-251 (1980)); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N. Y. Acad. Sci. 383 :44-68 (1982); MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR" CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003).
C. Assays
[0233] Antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
[0234] In some aspects, an antibody is tested for its antigen binding activity, e.g., by known methods such as ELISA, FACS or Western blot.
[0235] In another aspect, competition assays may be used to identify an antibody that competes with any of the antibodies described herein for binding to a mixed-topology polyubiquitin. In certain embodiments, such a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by an antibody described herein.
Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
[0236] In an exemplary competition assay, immobilized mixed-topology polyubiquitin is incubated with a solution comprising a first labeled antibody that binds thereto (e.g., any of the antibodies described herein) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to the mixed-topology polyubiquitin. The second antibody may be present in a hybridoma supernatant. As a control, mixed-topology
polyubiquitin is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to mixed-topology polyubiquitin, excess unbound antibody is removed, and the amount of label associated with immobilized mixed-topology polyubiquitin is measured. If the amount of label associated with immobilized mixed-topology polyubiquitin is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to the mixed-topology polyubiquitin. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).
D. Immunoconjugates
[0237] Immunoconjugates comprising an antibody disclosed herein conjugated to one or more cytotoxic agents are provided, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes (i.e., a radioconjugate).
[0238] Immunoconjugates allow for the targeted delivery of a drug moiety to a tumor or other diseased cell or tissue, and, in some embodiments intracellular accumulation therein, where systemic administration of unconjugated drugs may result in unacceptable levels of toxicity to normal cells (Polakis P. (2005) Current Opinion in Pharmacology 5:382-387).
[0239] Antibody-drug conjugates (ADC) are targeted chemotherapeutic molecules which combine properties of both antibodies and cytotoxic drugs by targeting potent cytotoxic drugs to antigen-expressing tumor cells (Teicher, B.A. (2009) Current Cancer Drug Targets 9:982- 1004), thereby enhancing the therapeutic index by maximizing efficacy and minimizing off- target toxicity (Carter, P.J. and Senter P.D. (2008) The Cancer Jour. 14(3): 154-169; Chari, R.V. (2008) Acc. Chem. Res. 41 :98-107 .
[0240] The ADC compounds include those with anticancer activity. In some
embodiments, the ADC compounds include an antibody conjugated, i.e. covalently attached, to the drug moiety. In some embodiments, the antibody is covalently attached to the drug moiety through a linker. The antibody-drug conjugates (ADC) may selectively deliver an effective dose of a drug to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved while increasing the therapeutic index ("therapeutic window").
[0241] The drug moiety (D) of the antibody-drug conjugates (ADC) may include any compound, moiety or group that has a cytotoxic or cytostatic effect. Drug moieties may impart their cytotoxic and cytostatic effects by mechanisms including but not limited to tubulin binding, DNA binding or intercalation, and inhibition of RNA polymerase, protein synthesis, and/or topoisomerase. Exemplary drug moieties include, but are not limited to, a maytansinoid, dolastatin, auristatin, calicheamicin, pyrrolobenzodiazepine (PBD), nemorubicin and its derivatives, PNU- 159682, anthracycline, duocarmycin, vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, and stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity. E. Methods and Compositions for Diagnostics and Detection
[0242] In certain embodiments, any of the antibodies provided herein is useful for detecting the presence of mixed-topology polyubiquitin in a biological sample. The term "detecting" as used herein encompasses quantitative or qualitative detection. A "biological sample" comprises, e.g., a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous colon, colorectal, small intestine, endometrial, pancreatic, breast, lung, prostate, or ovarian tissue).
[0243] In some embodiments, an antibody disclosed herein is for use in a method of diagnosis or detection. In a further aspect, a method of detecting the presence of mixed-topology polyubiquitin in a biological sample is provided. In certain embodiments, the method comprises contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to mixed-topology polyubiquitin, and detecting whether a complex is formed between the antibody and mixed-topology polyubiquitin in the biological sample. Such method may be an in vitro or in vivo method. In some embodiments, an antibody is used to select subjects eligible for therapy with an anti-mixed-topology polyubiquitin antibody, e.g. where mixed-topology polyubiquitin is a biomarker for selection of patients. In some embodiments, the biological sample is a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous tissue).
[0244] In some embodiments, a method of detecting a polyubiquitinated protein in a biological sample, the polyubiquitinated protein being polyubiquitinated at two or more positions with at least first and second polyubiquitins, with the first and second polyubiquitins having different linkages, is provided. In certain embodiments, the method comprises contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to the polyubiquitinated protein, and detecting whether a complex is formed between the antibody and the polyubiquitinated protein in the biological sample. Such method may be an in vitro or in vivo method. In some embodiments, an antibody is used to select subjects eligible for therapy with an antibody disclosed herein, e.g. where the
polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages is a biomarker for selection of patients. In some embodiments, the biological sample is a cell or tissue (e.g., biopsy material, including cancerous or potentially cancerous tissue).
[0245] In a further embodiment, an antibody disclosed herein is used in vivo to detect, e.g., by in vivo imaging, mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages in a subject, e.g., for the purposes of diagnosing, prognosing, or staging a disease, determining the appropriate course of therapy, or monitoring response to therapy. One method known in the art for in vivo detection is immuno-positron emission tomography
(immuno-PET), as described, e.g., in van Dongen et al., The Oncologist 12: 1379-1389 (2007) and Verel et al., J. Nucl. Med. 44: 1271-1281 (2003). In such embodiments, a method is provided for detecting a mixed-topology polyubiquitin in a subject, the method comprising administering a labeled antibody to a subject, and detecting the labeled anti-mixed-topology polyubiquitin antibody in the subject. In certain of such embodiments, the labeled antibody comprises (e.g., is conjugated to) a positron emitter, such as 68Ga, 18F, 64Cu, 86Y, 76Br, 89Zr, and 124I. In a particular embodiment, the positron emitter is 89Zr. Nonlimiting exemplary methods of making and using 89Zr-labeled antibodies are described, e.g., in PCT Publication No. WO 2011/056983. In some embodiments, the labeled antibody is a cysteine engineered antibody conjugated to one or more zirconium complexes. See, e.g., WO 2011/056983.
[0246] In further embodiments, a method of diagnosis or detection comprises contacting a first antibody disclosed herein which is immobilized to a substrate with a biological sample to be tested for the presence of mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages, exposing the substrate to a second antibody that binds mixed-topology polyubiquitin or the polyubiquitinated protein, and detecting whether the second antibody is bound to a complex between the first antibody and mixed-topology polyubiquitin or the polyubiquitinated protein in the biological sample (sometimes referred to as a sandwich assay). A substrate may be any supportive medium, e.g., glass, metal, ceramic, polymeric beads, slides, chips, and other substrates. In certain embodiments, a biological sample comprises a cell or tissue {e.g., biopsy material, including cancerous or potentially cancerous colon, colorectal, small intestine, endometrial, pancreatic or ovarian tissue). In certain embodiments, the first or second antibody is any of the antibodies described herein.
[0247] In certain embodiments, the antibodies disclosed herein are labeled. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes 32P, 14C, 1251, 3H, and 131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Patent No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, β-galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uncase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP,
lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like. In another embodiment, a label is a positron emitter. Positron emitters include but are not limited to 68Ga, 18F, 64Cu, 86Y, 76Br, 89Zr, and 124I. In a particular
embodiment, a positron emitter is 89Zr.
[0248] Presence of mixed-topology polyubiquitin or a polyubiquitinated protein polyubiquitinated at two or more positions with at least first and second polyubiquitins having different linkages in a sample can be analyzed by a number of methodologies using an antibody disclosed herein, many of which are known in the art and understood by the skilled artisan, including, but not limited to, immunohistochemistry ("IHC"), Western blot analysis, immunoprecipitation, molecular binding assays, ELISA, ELIFA, fluorescence activated cell sorting ("FACS"), quantitative blood based assays (as for example Serum ELISA),. Typical protocols for evaluating the status of proteins are found, for example in Ausubel et al, eds., 1995, Current Protocols In Molecular Biology, Unit 15 (Immunoblotting). Multiplexed immunoassays such as those available from Rules Based Medicine or Meso Scale Discovery ("MSD") may also be used.
[0249] In some embodiments, a composition is provided that is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies. Monospecific antibodies are antibodies that do not comprise more than one type of antigen recognition site, e.g., antibodies with only one set of six CDRs or antibodies in which each set of six CDRs is identical. Antibodies in which a first set of CDRs varies only slightly from any other sets of CDRs, e.g., with respect to a small number of amino acid residues, wherein the differences do not result in preferential binding to a different antigen, are also considered monospecific. An unassembled half antibody is not stably associated (covalently or noncovalently) with another half antibody, e.g., appears as a single heavy /light chain unit when analyzed by an appropriate technique, such as size exclusion chromatography, mass spectrometry, or electrophoresis.
F. Pharmaceutical Formulations
[0250] Pharmaceutical formulations of an antibody or immunoconjugate as described herein are prepared by mixing such antibody or immunoconjugate having the desired degree of purity with one or more optional pharmaceutically acceptable carriers {Remington's
Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride;
hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol;
cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn- protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLE EX®, Baxter
International, Inc.). Certain exemplary sHASEGPs and methods of use, including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In some aspects, a sHASEGP is combined with one or more additional glycosaminoglycanases such as
chondroitinases.
[0251] Exemplary lyophilized antibody or immunoconjugate formulations are described in US Patent No. 6,267,958. Aqueous antibody or immunoconjugate formulations include those described in US Patent No. 6,171,586 and WO2006/044908, the latter formulations including a histidine-acetate buffer.
[0252] The formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
[0253] Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
[0254] Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody or immunoconjugate, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
[0255] The formulations to be used for in vivo administration are generally sterile.
Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
G. Therapeutic Methods and Compositions
[0256] Any of the antibodies or immunoconjugates provided herein may be used in methods, e.g., therapeutic methods.
[0257] In another aspect, an antibody or immunoconjugate disclosed herein for use as a medicament is provided. In further aspects, an antibody or immunoconjugate disclosed herein for use in a method of treatment is provided. In certain embodiments, an antibody or immunoconjugate disclosed herein for use in treating mixed-topology polyubiquitin-positive cancer is provided.
[0258] In a further aspect, the use of an antibody or immunoconjugate disclosed herein in the manufacture or preparation of a medicament is provided.
[0259] An "individual" according to any of the above embodiments may be a human.
[0260] In a further aspect, pharmaceutical formulations are provided, comprising any of the antibodies or immunoconjugate provided herein, e.g., for use in any of the above therapeutic methods. In some embodiments, a pharmaceutical formulation comprises any of the antibodies or immunoconjugates provided herein and a pharmaceutically acceptable carrier.
[0261] Antibodies or immunoconjugates provided herein can be used either alone or in combination with other agents in a therapy. For instance, an antibody or immunoconjugate provided herein may be co-administered with at least one additional therapeutic agent.
[0262] Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody or immunoconjugate provided herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
[0263] An antibody or immunoconjugate (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include
intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
[0264] Antibodies or immunoconjugates would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The antibody or immunoconjugate need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody or immunoconjugate present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
[0265] For the prevention or treatment of disease, the appropriate dosage of an antibody or immunoconjugate (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of antibody or immunoconjugate, the severity and course of the disease, whether the antibody or
immunoconjugate is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody or immunoconjugate, and the discretion of the attending physician. The antibody or immunoconjugate is suitably administered to the patient at one time or over a series of treatments.
[0266] It is understood that any of the above formulations or therapeutic methods may be carried out using both an immunoconjugate and an antibody.
H. Articles of Manufacture
[0267] In another aspect, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the disorder and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an antibody or immunoconjugate disclosed herein. The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the
composition comprises an antibody or immunoconjugate; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this embodiment may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as
bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution or dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
III. EXAMPLES
[0268] The following are examples of methods and compositions provided herein. It is understood that various other embodiments may be practiced, given the general description provided above.
A. Analytical Methods
[0269] Size Exclusion Chromatography - Multi-Angle Light Scattering. 50 μg of antibody was injected onto a 3.5 μπι, 7.8 mm x 300 mm XBridge Protein BEH analytical SEC 200 A column (Waters) at 1 mL/min using an Agilent 1260 Infinity HPLC with 20 mM histidine acetate, 300 mM NaCl, pH 5.5 as the mobile phase. Proteins eluted from the analytical SEC column were directly injected onto a Wyatt DAWN HELEOS Il/Optilab T-rEX multi-angle light scattering detector to measure molar mass and polydispersity.
[0270] Mass Spectrometry. 30 μg of antibody was deglycosylated with 2 units of PNGaseF (NEB) in the presence or absence of 2 units of carboxypeptidase B (Roche) at 37 °C overnight prior to mass spectrometry analysis. 2 μg of antibody was then injected onto a 3 μπι, 4.6 x 50 mm reverse-phase chromatography PLRP-S column (Agilent) at 1 mL/min using an Agilent 1290 Infinity UHPLC. A 0-100 % buffer B gradient over 3 minutes was performed with 0.05 % trifluoroacetic acid (TFA) in water (buffer A) and 0.05 % TFA in acetonitrile (buffer B), followed by a 100 % buffer B wash for 1 minute. Proteins eluted from the reverse-phase column were directly injected onto an Agilent 6230 electrospray ionization time-of-flight mass spectrometer (ESI-TOF) for intact mass measurement. B. Antibody Cloning, Expression, and Annealing
[0271] Bispecific antibodies were generated using a knobs-into-holes heterodimerization approach. For a general discussion of this approach, see Merchant, A. M. et al. An efficient route to human bispecific IgG. Nat Biotechnol 16, 677-681, doi: 10.1038/nbt0798-677 (1998).
[0272] T366W (knob) or T366S, L368A, and Y407V (hole) mutations were introduced into the CH3 domains of anti-Kl 1 and anti-K48 polyubiquitin linkage-specific antibodies. As a control an anti-gD antibody recognizing an irrelevant protein was used. The knob and hole mutations were chosen to allow preferential heterodimerization of the respective heavy chains of the antibodies.
[0273] The heavy chain variable domains were those of SEQ ID NO: 8 (for anti-Kl 1 polyubiquitin linkage-specificity), SEQ ID NO: 22 (for anti-K48 polyubiquitin linkage- specificity), and a non-specific anti-gD control antibody. These variable domains were subcloned into a modified pRK vector (Genentech) containing the human IgGl heavy chain constant domains with either the knob (T366W) or hole (T366S, L368A, and Y407V) mutations in the CH3 domain.
[0274] Due to the lengths of variable regions, the actual positions of the knob and hole mutations can vary slightly, e.g., by 1 to 10 positions. For example, in SEQ ID NOs: 4 and 6, the T to W and T to S substitutions, respectively, are reflected at the 369th rather than the 366th amino acid residue. It is understood that references to knob and hole mutations at positions such as 366, 368, and 407 of a heavy chain are to be interpreted with adjustments, if appropriate, in light of the length of the variable region.
[0275] The light chain variable domains were similarly subcloned into a modified pRK vector (Genentech) containing the human kappa light chain constant domain. The pRK vector carries a constitutive strong signal peptide for extracellular expression in mammalian cells. The anti-Kl 1 antibody was cloned as both knob and hole mutants (encoding heavy chains comprising SEQ ID NOs: 4 and 6, respectively), the anti-K48 was cloned as a hole mutant (encoding a heavy chain comprising SEQ ID NO: 20), and the anti-gD was cloned as a knob mutant.
[0276] The sequence table also provides a knob mutant of the anti-Kl 1 antibody (SEQ ID NO: 18); knob and hole mutants of an anti-K63 heavy chain (SEQ ID NOs: 32 and 34, respectively); and knob and hole mutants of an anti-linear polyubiquitin heavy chain (SEQ ID NOs: 46 and 48, respectively).
[0277] To preserve the pairing of the cognate light and heavy chains we expressed either the knob or hole heavy chain mutants with their respective light chains separately in CHO cells and affinity purified them individually (Fig. la). Light chain and heavy chain plasmids for a given knob or hole half antibody were transiently co-transfected into CHO cells using PEI as previously described (see Wong, A. W., Baginski, T. K. & Reilly, D. E. Enhancement of DNA uptake in FUT8-deleted CHO cells for transient production of afucosylated antibodies.
Biotechnol Bioeng 106, 751-763, doi: 10.1002/bit.22749 (2010)). Half antibodies were purified over MabSelect SuRe resin (GE Healthcare), eluted with 50 mM sodium citrate, 150 mM NaCl, pH 3.0, followed by pH adjustment to 5.0 with 10% (v/v) of 200 mM arginine, 137 mM succinate, pH 9.0.
[0278] The affinity -purified knob and hole antibodies are a mixture of monomers (half antibodies) and homodimers as seen by SDS-PAGE, analytical size-exclusion chromatography (SEC), multi-angle light scattering (MALS), and liquid chromatography-mass spectrometry (LC-MS) (Fig. lb, lc, 2a, 2b, Tables 2, 3), consistent with previously described knob and hole antibodies. See, e.g., Shatz, W. et al. Knobs-into-holes antibody production in mammalian cell lines reveals that asymmetric afucosylation is sufficient for full antibody-dependent cellular cytotoxicity. MAbs 5, 872-881, doi: 10.4161/mabs.26307 (2013); Elliott, J. M. et al. Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2- CH3 hydrophobic interaction. JMol Biol 426, 1947-1957, doi: 10.1016/j .jmb.2014.02.015 (2014); Spiess, C. et al. Bispecific antibodies with natural architecture produced by co-culture of bacteria expressing two distinct half-antibodies. Nat Biotechnol 31, 753-758,
doi: 10.1038/nbt.2621 (2013). Monomer, homodimer, and heterodimer peaks are indicated in Figs, lc and 2a, and molecular weights were verified with light scattering (see Table 1).
[0279] The theoretical mass of the anti-K48 hole/anti-Kl 1 knob bispecific is 144,613.19 Da, corresponding to the major peak in Fig. Id. The predicted peak positions for the anti-K48 hole and anti-Kl 1 knob homodimers are indicated based on their theoretical masses of
144,485.90 Da and 144,740.48 Da, respectively. Treatment with CPB results in the loss of the 144,745.26 Da peak indicating that it is not anti-Kl 1 knob homodimer, but rather a portion of the bispecific with the carboxy-terminal lysine residue still attached. The theoretical mass of the anti-Kl l/gD bispecific is 145,623.14 Da and the anti-K48/gD bispecific is 145,701.11 Da, corresponding to the major peaks in the respective panels of Fig. 2c. The predicted peak positions for the anti-Kl 1 hole homodimers, anti-K48 hole homodimers, and anti-gD knob homodimers are indicated based on their theoretical masses of 144,329.96 Da, 144,485.90, and 146,916.32 Da, respectively.
[0280] Table 2. Molar masses of purified half antibodies and assembled bispecifics.
Figure imgf000073_0001
Anti-Kll knob 7.741 1.472 x 105 (± 14.413 %) 1.041 (± 18.109%)
7.314 1.889 x 105 (± 13.846%) 1.103 (± 11.301 %)
Anti-Kll hole
8.390 7.751 x 104 (± 1.102%) 1.050 (± 1.011 %)
7.241 1.799 x 105 (± 10.213 %) 1.064 (±6.204%)
Anti-K48 hole
8.308 7.747 x 104(± 1.102%) 1.004 (± 1.007%)
Anti-gD knob 7.283 1.677 x 105 (± 3.568 %) 1.052 (±7.137%)
Anti-Kl 1/K48 bispecific 7.835 1.795 x 105 (± 1.512%) 1.008 (±0.877%)
Anti-Kl 1/gD bispecific 7.637 1.810 x 105(± 0.988%) 1.010 (± 1.201%)
Anti-K48/gD bispecific 7.575 1.646 x 105 (± 1.242%) 1.003 (±0.546%)
Antibodies were injected over an XB ridge Protein BEH analytical SEC column coupled to a DAWN HELEOS II Multi-Angle Light Scatter detector for molar mass and polydispersity measurement. The elution time of individual peaks off the SEC column is given in minutes.
[0281] Table 3. Mass spectrometry analysis of half antibodies and assembled bispecifics.
Figure imgf000074_0001
Figure imgf000075_0001
Antibodies were deglycosylated with PNGaseF and analyzed by liquid chromatography-mass spectrometry (LC-MS). The theoretical masses are for the non-reduced, deglycosylated antibodies and assume complete removal of the carboxy-terminal lysine residue during mammalian cell expression. The mass difference is reported as the difference between the experimental mass and the theoretical mass. N/Oa, not observed.
[0282] By SEC-MALS the anti-K48 hole antibody shows approximately 20%
homodimer and 80% monomer (Fig. lc, Table 2). The proportions are less clear for the anti-Kl 1 knob antibody as the homodimer and monomer co-elute on SEC, evidenced by a broad elution peak containing a lagging-edge shoulder that shows high polydispersity by MALS (Fig. lc, Table 2). Both knob and hole homodimers are non-covalent in nature (i.e. the hinge disulfides are not formed) as they are disrupted in the reverse-phase chromatography step of LC-MS leading to detection of only monomers by MS (Fig. 2b, Table 3). This is consistent with the anti- parallel orientation of the knob/knob or hole/hole Fc domains seen in X-ray crystal structures of homodimers. See Elliott, J. M. et al. Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction. JMol Biol 426, 1947-1957, doi: 10.1016/j .jmb.2014.02.015 (2014).
[0283] Bispecific antibodies were assembled from half antibodies in vitro using annealing, reduction, and oxidation. The anti-Kl 1/K48 bispecific antibody was assembled in vitro from the affinity purified anti-Kl 1 knob and anti-K48 hole antibodies using a modified version of the previously described method of annealing, reduction, and oxidation (Shatz, W. et al. Knobs-into-holes antibody production in mammalian cell lines reveals that asymmetric afucosylation is sufficient for full antibody-dependent cellular cytotoxicity. MAbs 5, 872-881, doi: 10.4161/mabs.26307 (2013).) (Fig. la). Briefly, the desired knob and hole half antibodies were mixed at a 1 : 1 mass ratio and the pH of the mixture was adjusted to 8.5 with 15% (v/v) of 800 mM arginine, pH 10.0. A 200-fold molar excess of reduced glutathione (Sigma Aldrich) in 800 mM arginine, pH 10.0 was added and the assembly reaction was incubated at room temperature for 72 hours with exposure to air to allow annealing of the knob and hole half antibodies and formation of the hinge disulfides. Anti-Kl 1/gD and anti-K48/gD control bispecific antibodies were similarly assembled.
[0284] The resulting heterodimers were further purified using hydrophopbic interaction (HIC) and cation-exchange (CEX) chromatography to remove any excess half antibodies and homodimers. The bispecific antibodies migrate as a -150 kDa band on SDS-PAGE, elute as a sharp peak on analytical SEC, and are monodisperse with a molar mass consistent with that of a full antibody (Fig. lb, lc, 2a, Table 2).
C. Antibody Purification and Characterization
[0285] Assembled bispecific antibodies were purified by hydrophobic interaction chromatography (HIC). Briefly, the assembly reaction was conditioned with 3 volumes of buffer A (25 mM sodium phosphate, 1 M ammonium sulfate, pH 6.5) to a final concentration of 0.75 M ammonium sulfate. The assembly reaction was filtered, loaded onto a 5 μπι, 7.8 x 75 mm ProPac HIC- 10 column (Dionex), followed by washing with buffer A. A 0-100% buffer B (25 mM sodium phosphate, pH 6.5, 25% isopropanol) linear gradient over 40 column volumes (CVs) was performed to separate the bispecific antibody from any unreacted half antibodies or aggregated protein. Identity of the eluting peaks was monitored by SDS-PAGE and mass spectrometry (see below for method details).
[0286] The bispecific antibodies were further purified by cation-exchange
chromatography (CEX). Briefly, the HIC pooled material was dialyzed into 20 mM sodium acetate, pH 5.0, loaded onto a 10 μπι Mono S 5/50 GL column (GE Healthcare), and washed with buffer A (20 mM sodium acetate, pH 5.0). A 0-100% buffer B (20 mM sodium acetate, pH 5.0, 1 M NaCl) linear gradient over 40 CVs was performed and the desired fractions pooled. The purified bispecific antibodies were formulated in 20 mM histidine acetate, 240 mM sucrose, 0.02% Tween-20, pH 5.5.
[0287] LC-MS was used to confirm the identity of the purified, annealed species (Fig. Id, 2c, Table 3). To reduce heterogeneity the antibodies were deglycosylated with PNGaseF before analysis. The major species in the anti-Kl 1/K48 assembly is indeed the bispecific with an observed mass of 144,617.30 Da that is within 4.11 Da of the theoretical mass (144,613.19 Da).
[0288] No anti-K48 hole homodimers with a theoretical mass of 144,485.90 Da were observed. An additional peak of 144,745.26 Da was seen which is close the theoretical mass of the anti-Kl 1 knob homodimer (144,740.48 Da). This additional peak is 128 Da larger than the experimental mass of 144,617.30 Da observed for the anti-Kl 1/K48 heterodimer. Recombinant antibodies purified from mammalian cells typically have the carboxy-terminal lysine residue on the heavy chain removed due to the activity of carboxypeptidases during expression. See Harris, R. J. Processing of C-terminal lysine and arginine residues of proteins isolated from mammalian cell culture. J Chromatogr A 705, 129-134 (1995); Harris, R. J., Wagner, K. L. & Spellman, M. W. Structural characterization of a recombinant CD4-IgG hybrid molecule. Eur J Biochem 194, 611-620 (1990). [0289] The theoretical masses of the recombinant antibodies calculated here assume complete removal of the carboxy-terminal lysine. If removal of this lysine were incomplete resulting in a fraction of the bispecific with one heavy chain containing the additional residue we would also expect to see a peak at +128 Da, corresponding to the mass of a lysine residue.
Further analysis of the half antibodies reveals that the anti-Kl 1 knob, anti-Kl 1 hole, and anti-gD knob all contain a minor fraction of antibody with the carboxy-terminal lysine still attached (Fig. 2b).
[0290] To demonstrate that the peak at 144,745.26 Da observed in the purified anti- Kl 1/K48 bispecific is not due to contaminating anti-Kl 1 knob homodimer, but rather a portion of the bispecific with one heavy chain carboxy-terminal lysine residue still attached, we treated the antibody with carboxypeptidase B (CPB). This results in the loss of the 144,745.26 Da peak, confirming that it is due to the presence of the carboxy-terminal lysine residue. Thus, the anti- Kl 1/K48 bispecific antibody is highly pure and free of any homodimers.
D. Fluorescent Labeling of Antibodies
[0291] The anti-Kl 1 monospecific antibody and the anti-Kl 1/K48 bispecific antibody were labeled with Alexa Fluor® 488 and Alexa Fluor® 546, respectively, according to the manufacturer's instructions using Alexa Fluor® Protein Labeling Kits (ThermoFisher).
Unreacted free dye was removed through extensive dialysis. Six and 8 moles of Alexa Fluor® 488 and Alexa Fluor® 546, respectively, per mole of antibody was conjugated.
* * *
[0292] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the invention.
TABLE OF SEQUENCES
Figure imgf000078_0001
DIQMTQSPSSLSASVGDRVTITCRASQIVGTFVAWYQQKPGKAPKLL anti-Kl l LCVR (HVRs IYSASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTT underlined) PPTFGQGTKVEIK
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSYISWVRQAPGKGLEW
anti-Kl l HCVR (HVRs VAAINPAGGYTYYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY underlined) YCAREWYFGGYVMDYWGQGTLVTVSS
anti-Kl l HVR-L1 RASQIVGTFVA
anti-Kl l HVR-L2 SASFLYS
anti-Kl l HVR-L3 QQSYTTPPT
anti-Kl l HVR-H1 GFTFSNSYIS
anti-Kl l HVR-H2 AINPAGGYTYYADSVKG
anti-Kl l HVR-H3 AREWYFGGYVMDY
MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCRASQS VSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQSSYSSLITFGQGTKVEIKRTVAAPSVFIFPPS
anti-K48 LC (with signal DEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS sequence underlined) KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLL IYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYS SLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNFY PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE
anti-K48 mature LC KHKVYACEVTHQGLSSPVTKSFNRGEC
MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFN ISYSSMHWVRQAPGKGLEWVASIYSYYSYTSYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCARSYSYHLGMDYWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICN HKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTV
anti-K48 knob HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG underlined) SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
EVQLVESGGGLVQPGGSLRLSCAASGFNISYSSMHWVRQAPGKGLEW VASIYSYYSYTSYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY YCARSYSYHLGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
anti-K48 mature knob HC VFSCSVMHEALHNHYTQKSLSLSPGK
MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFN I SYSSMHWVRQAPGKGLEWVASIYSYYSYTSYADSVKGRFTI SADTS KNTAYLQMNSLRAEDTAVYYCARSYSYHLGMDYWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTV
anti-K48 hole HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG underlined) SFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK EVQLVESGGGLVQPGGSLRLSCAASGFNISYSSMHWVRQAPGKGLEW VASIYSYYSYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVY YCARSYSYHLGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYICN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGN
anti-K48 mature hole HC VFSCSVMHEALHNHYTQKSLSLSPGK
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLL
anti-K48 LCVR (HVRs IYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYS underlined) SLITFGQGTKVEIK
EVQLVESGGGLVQPGGSLRLSCAASGFNISYSSMHWVRQAPGKGLEW
anti-K48 HCVR (HVRs VASIYSYYSYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVY underlined) YCARSYSYHLGMDYWGQGTLVTVSS
anti-K48 HVR-L1 RASQSVSSAVA
anti-K48 HVR-L2 SASSLYS
anti-K48 HVR-L3 QQSSYSSLIT
anti-K48 HVR-H1 GFNISYSSMH
anti-K48 HVR-H2 SIYSYYSYTSYADSVKG
anti-K48 HVR-H3 ARSYSYHLGMDY
MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCRASQS VSSAVAWYQQKPGEAPKLLIYSARSLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQYSSYSSLFTFGQGTKVEIKRTVAAPSVFIFPP
anti-K63 LC (with signal SDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD sequence underlined) SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGEAPKLL IYSARSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYSSY SSLFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNF YPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY
anti-K63 mature LC EKHKVYACEVTHQGLSSPVTKSFNRGEC
MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFN VKTGLIHWVRQAPGKGLEWVAYITPYYGSTSYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICN HKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLT
anti-K63 knob HC (with VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS signal sequence REEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD underlined) GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEW VAYITPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVY YCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICN HKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
anti-K63 mature knob HC NVFSCSVMHEALHNHYTQKSLSLSPGK MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFN VKTGLIHWVRQAPGKGLEWVAYITPYYGSTSYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICN HKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLT
anti-K63 hole HC (with VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS signal sequence REEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD underlined) GSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEW VAYITPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVY YCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICN HKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQG
anti-K63 mature hole HC NVFSCSVMHEALHNHYTQKSLSLSPGK
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGEAPKLL
anti-K63 LCVR (HVRs IYSARSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYSSY underlined) SSLFTFGQGTKVEIK
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEW
anti-K63 HCVR (HVRs VAYITPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVY underlined) YCAREYYRWYTAIDYWGQGTLVTVSS
anti-K63 HVR-L1 RASQSVSSAVA
anti-K63 HVR-L2 SARSLYS
anti-K63 HVR-L3 QQYSSYSSLFT
anti-K63 HVR-H1 GFNVKTGLIH
anti-K63 HVR-H2 YITPYYGSTSYADSVKG
anti-K63 HVR-H3 AREYYRWYTAIDY
MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCRASQD VSTAVAWYQQKPGKAPKLLIYSAKFLYSGVPSRFSGSGSGTDFTLTI SSLQPEDFATYYCQQSYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSD
anti-linear LC (with signal EQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK sequence underlined) DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLL IYSAKFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTT PPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
anti-linear mature LC HKVYACEVTHQGLSSPVTKSFNRGEC
MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFT FSNTYISWVRQAPGKGLEWVASITPSSGQTDYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCARTWLLRWVMDLWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTV
anti-linear knob HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG underlined) SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK EVQLVESGGGLVQPGGSLRLSCAASGFTFSNTYISWVRQAPGKGLEW
VASITPSSGQTDYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY YCARTWLLRWVMDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYP
anti-linear mature knob SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
46 HC VFSCSVMHEALHNHYTQKSLSLSPGK
MGWSC11LFLVATATGAYAEVQLVESGGGLVQPGGSLRLSCAASGFT FSNTYISWVRQAPGKGLEWVASITPSSGQTDYADSVKGRFTISADTS KNTAYLQMNSLRAEDTAVYYCARTWLLRWVMDLWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTV
anti-linear hole HC (with LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR signal sequence EEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
47 underlined) SFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNTYISWVRQAPGKGLEW VASITPSSGQTDYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY YCARTWLLRWVMDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYP
anti-linear mature hole SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGN
48 HC VFSCSVMHEALHNHYTQKSLSLSPGK
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLL
anti-linear LCVR (HVRs IYSAKFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTT
49 underlined) PPTFGQGTKVEIK
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNTYISWVRQAPGKGLEW
anti-linear HCVR (HVRs VASITPSSGQTDYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVY
50 underlined) YCARTWLLRWVMDLWGQGTLVTVSS
51 anti-linear HVR-L1 RASQDVSTAVA
52 anti-linear HVR-L2 SAKFLYS
53 anti-linear HVR-L3 QQSYTTPPT
54 anti-linear HVR-H1 GFTFSNTYIS
55 anti-linear HVR-H2 SITPSSGQTDYADSVKG
56 anti-linear HVR-H3 ARTWLLRWVMDL
HC = heavy chain; LC = light chain; HCVR = heavy chain variable region; LCVR
variable region; HVR = hypervariable region.

Claims

WHAT IS CLAIMED IS:
1. An antibody with a greater avidity for a mixed-topology polyubiquitin than a single-topology polyubiquitin, wherein the mixed-topology polyubiquitin comprises a first linkage and a second linkage, wherein the first linkage and the second linkage differ from one another.
2. A multispecific antibody that binds a mixed-topology polyubiquitin comprising a first linkage and a second linkage, the antibody comprising a first antigen recognition site specific for the first linkage, and a second antigen recognition site specific for the second linkage, wherein the first linkage and the second linkage differ from one another.
3. The antibody of any one of the preceding claims, comprising a first VH/VL unit specific for the first linkage, and a second VH/VL unit specific for the second linkage.
4. The antibody of any one of the preceding claims, which is a knob-in-hole bispecific antibody; a bispecific antibody comprising a leucine zipper; a cross-linked pair of antibodies; an antibody Fc-heterodimeric molecule; a diabody; a triabody; a tetrabody; a single- chain Fv dimer; a trispecific antibody; an octopus antibody; or a dual acting FAb.
5. The antibody of any one of the preceding claims, wherein the first linkage or the second linkage is a Kl 1 linkage.
6. The antibody of any one of the preceding claims, wherein the first linkage or the second linkage is a K48 linkage.
7. The antibody of any one of the preceding claims, wherein the first linkage or the second linkage is a K63-linkage.
8. The antibody of any one of the preceding claims, wherein the first linkage or the second linkage is a C-terminal to N-terminal-linkage.
9. The antibody of any one of the preceding claims, wherein the first linkage and the second linkage are:
a) a Kl 1 linkage and a K48 linkage;
b) a Kl 1 linkage and a K63 linkage;
c) a Kl 1 linkage and a C- to N-terminal linkage;
d) a K48 linkage and a K63 linkage;
e) a K48 linkage and a C- to N-terminal linkage; or
f) a K63 linkage and a C- to N-terminal linkage.
10. The antibody of any one of the preceding claims, comprising a first half antibody that comprises:
a) (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14;
b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28;
c) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42; or
d) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
11. The antibody of any one of the preceding claims, comprising a second half antibody that comprises:
a) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14;
b) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26, (v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28;
c) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42; or
d) (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56,
wherein the HVRs of the second half antibody are not identical to the HVRs of the first half antibody.
12. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein:
a) one of the first and second half antibodies comprises
(i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28;
b) one of the first and second half antibodies comprises
(i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42;
c) one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 9,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 11,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 12,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 14, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56;
d) one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38, (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42;
e) one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 23,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 24,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 25,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 26,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 28, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56; or
f) one of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 38,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 39,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 40,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 41, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, and the other of the first and second half antibodies comprises
(i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 51,
(ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 52,
(iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 53,
(iv) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 54,
(v) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 55, and
(vi) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 56.
13. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8;
b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22;
c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; or
d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50.
14. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the second half antibody comprises
a) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8;
b) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22;
c) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; or
d) a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50;
wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
15. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein:
a) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22;
b) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36; c) one of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 7 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95% sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50;
d) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36;
e) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 21 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50; or
f) one of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 35 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 36,
and the other of the first and second half antibodies comprises a VL sequence with at least about 95%) sequence identity to SEQ ID NO: 49 and a VH sequence with at least about 95% sequence identity to SEQ ID NO: 50.
16. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises
a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8;
b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22;
c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
17. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the second half antibody comprises
a) a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8;
b) a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22;
c) a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36; or d) a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50;
wherein the VL and VH sequences of the second half antibody are not identical to the VL and VH sequences of the first half antibody.
18. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein:
a) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22;
b) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
c) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 7 and a VH sequence of SEQ ID NO: 8,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50;
d) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36;
e) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 22,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50; or
f) one of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 35 and a VH sequence of SEQ ID NO: 36,
and the other of the first and second half antibodies comprises a VL sequence of SEQ ID NO: 49 and a VH sequence of SEQ ID NO: 50.
19. The antibody of any one of the preceding claims, which is a monoclonal antibody.
20. The antibody of any one of the preceding claims, which is a mouse, rabbit, human, humanized, or chimeric antibody.
21. The antibody of any one of the preceding claims, wherein the antibody is an IgG antibody.
22. The antibody of any one of the preceding claims, wherein the antibody is an IgGl, IgG2a, IgG2b, IgG3, or IgG4 antibody.
23. The antibody of any one of the preceding claims, wherein the antibody is an IgGl or IgG4 antibody.
24. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises a first heavy chain constant region comprising a knob mutation and the second half antibody comprises a second heavy chain constant region comprising a hole mutation; or wherein the first half antibody comprises a first heavy chain constant region comprising a hole mutation and the second half antibody comprises a second heavy chain constant region comprising a knob mutation.
25. The antibody of claim 24, wherein the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation.
26. The antibody of claim 24 or claim 25, wherein the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V.
27. The antibody of claim 24, wherein the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation.
28. The antibody of claim 24 or claim 27, wherein the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
29. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or
d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44.
30. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises
a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
18;
c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
32; or d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
46,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
31. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
32. The antibody of any one of claims 1 to 30, comprising first and second half antibodies, wherein the first half antibody comprises
a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
20;
c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
34; or
d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
48,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
33. The antibody of any one of claims 1 to 29, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
34. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30; or
d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
35. The antibody of any one of claims 1 to 29 or 32 to 34, comprising first and second half antibodies, wherein the second half antibody comprises
a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
18;
c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
32; or
d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
46;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
36. The antibody of any one of claims 1 to 29 or 32 to 34, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
37. The antibody of any one of claims 1 to 31 or 34, comprising first and second half antibodies, wherein the second half antibody comprises
a) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
20;
c) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
34; or
d) a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO:
48;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
38. The antibody of any one of claims 1 to 31 or 34, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6; b) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20; c) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; or d) a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48; wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
39. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein:
a) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20;
b) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34;
c) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 4,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48;
d) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18;
e) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32;
f) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 2 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 6,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46;
g) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34; h) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 18,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48;
i) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 48;
j) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 32;
k) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 16 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 20,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46; or
1) one of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 30 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 34,
and the other of the first and second half antibodies comprises a light chain sequence having at least about 95% sequence identity to SEQ ID NO: 44 and a heavy chain sequence having at least about 95% sequence identity to SEQ ID NO: 46,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
40. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence of SEQ ID NO: 2;
b) a light chain sequence of SEQ ID NO: 16; c) a light chain sequence of SEQ ID NO: 30; or
d) a light chain sequence of SEQ ID NO: 44.
41. The antibody of any one of claims 1 to 31, 34, or 37 to 40, comprising first and second half antibodies, wherein the first half antibody comprises
a) a heavy chain sequence of SEQ ID NO: 4;
b) a heavy chain sequence of SEQ ID NO: 18;
c) a heavy chain sequence of SEQ ID NO: 32; or
d) a heavy chain sequence of SEQ ID NO: 46,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
42. The antibody of any one of claims 1 to 31, 34, or 37 to 40, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO:
4;
b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO:
18;
c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO:
32; or
d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO:
46,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
43. The antibody of any one of claims 1 to 29, 32 to 36, or 39 to 40, comprising first and second half antibodies, wherein the first half antibody comprises
a) a heavy chain sequence of SEQ ID NO: 6;
b) a heavy chain sequence of SEQ ID NO: 20;
c) a heavy chain sequence of SEQ ID NO: 34; or
d) a heavy chain sequence of SEQ ID NO: 48,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
44. The antibody of any one of claims 1 to 29, 32 to 36, or 39 to 40, comprising first and second half antibodies, wherein the first half antibody comprises
a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO:
6;
b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO:
20;
c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO:
34; or d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO:
48,
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
45. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence of SEQ ID NO: 2;
b) a light chain sequence of SEQ ID NO: 16;
c) a light chain sequence of SEQ ID NO: 30; or
d) a light chain sequence of SEQ ID NO: 44;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
46. The antibody of any one of claims 1 to 31, 34, 37 to 40, or 43 to 45, comprising first and second half antibodies, wherein the second half antibody comprises
a) a heavy chain sequence of SEQ ID NO: 4;
b) a heavy chain sequence of SEQ ID NO: 18;
c) a heavy chain sequence of SEQ ID NO: 32; or
d) a heavy chain sequence of SEQ ID NO: 46;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
47. The antibody of any one of claims 1 to 31, 34, 37 to 40, or 43 to 45, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO:
4;
b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO:
18;
c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO:
32; or
d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO:
46;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
48. The antibody of any one of claims 1 to 31, 34, 37 to 42, or 45, comprising first and second half antibodies, wherein the second half antibody comprises
a) a heavy chain sequence of SEQ ID NO: 6;
b) a heavy chain sequence of SEQ ID NO: 20;
c) a heavy chain sequence of SEQ ID NO: 34; or
d) a heavy chain sequence of SEQ ID NO: 48;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody, optionally wherein a C-terminal lysine is missing from one or more heavy chains.
49. The antibody of any one of claims 1 to 31, 34, 37 to 42, or 45, comprising first and second half antibodies, wherein the second half antibody comprises
a) a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO:
6;
b) a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO:
20;
c) a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO:
34; or
d) a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO:
48;
wherein the light chain and heavy chain sequences of the second half antibody are not identical to the light chain and heavy chain sequences of the first half antibody.
50. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein:
a) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20;
b) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34;
c) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48; d) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18;
e) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32;
f) the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46;
g) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34;
h) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48;
i) the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48;
j) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32;
k) the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20,
and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46; or
1) the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46;
optionally wherein a C-terminal lysine is missing from one or more heavy chains.
51. The antibody of any one of the preceding claims, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
52. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
53. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 4, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
54. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
55. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
56. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 2 and a heavy chain sequence of SEQ ID NO: 6, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C- terminal lysine is missing from one or more heavy chains.
57. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
58. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 18, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
59. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 48, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
60. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 32, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
61. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 16 and a heavy chain sequence of SEQ ID NO: 20, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
62. The antibody of one of claims 1-50, comprising first and second half antibodies, wherein the first half antibody comprises a light chain sequence of SEQ ID NO: 30 and a heavy chain sequence of SEQ ID NO: 34, and the second half antibody comprises a light chain sequence of SEQ ID NO: 44 and a heavy chain sequence of SEQ ID NO: 46, and optionally wherein a C-terminal lysine is missing from one or more heavy chains.
63. An antibody that competes with the antibody of any one of the preceding claims for binding to a mixed-topology polyubiquitin.
64. An antibody that binds the same epitopes of a mixed-topology polyubiquitin as the antibody of any one of the preceding claims.
65. The antibody of any one of the preceding claims, which is a bispecific antibody.
66. The antibody of any one of the preceding claims, which is a diabody, triabody, or tetrabody.
67. The antibody of any one of the preceding claims, conjugated to a label.
68. The antibody of claim 67, wherein the label is a fluorescent, enzymatic, or chromogenic label.
69. The antibody of claim 67, wherein the label is a radioisotope, which is optionally a positron emitter, which is optionally 89Zr.
70. A composition comprising the antibody of any one of claims 1 to 69, wherein the composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
71. An immunoconjugate comprising the antibody of any one of claims 1 to 69 and a cytotoxic agent.
72. A pharmaceutical formulation comprising a pharmaceutically acceptable carrier and at least one of:
a) the antibody of any one of claims 1 to 69; or
b) the immunoconjugate of claim 71;
optionally wherein the composition is substantially free of monospecific antibodies, unassembled half antibodies, or both monospecific antibodies and unassembled half antibodies.
73. Isolated nucleic acid encoding:
a) the antibody of any one of claims 1 to 66;
b) a first half antibody of the antibody of any one of claims 40 to 66; or
c) a second half antibody of the antibody of any one of claims 46 to 66.
74. A host cell comprising the nucleic acid of claim 73.
75. A method of producing an antibody or half-antibody comprising culturing the host cell of claim 73 so that the antibody or half antibody is produced.
76. A method of making the antibody of any one of claims 1 to 66, comprising forming the antibody from a first half antibody and a second half antibody.
77. A method of detecting a mixed-topology polyubiquitin in a biological sample comprising contacting the biological sample with the antibody of any one of claims 1 to 69 under conditions permissive for binding of the antibody to the mixed-topology polyubiquitin, and detecting whether a complex is formed between the antibody and mixed-topology polyubiquitin in the biological sample.
78. The method of claim 77, wherein the mixed-topology polyubiquitin is covalently attached to a non-ubiquitin polypeptide.
79. The method of claim 77 or claim 78, wherein the mixed-topology polyubiquitin is branched.
80. The method of claim 77 or claim 78, wherein the mixed-topology polyubiquitin is unbranched.
81. The method of any one of claims 77 to 80, wherein the mixed-topology polyubiquitin comprises a first linkage and a second linkage different from the first linkage, and the first and second linkages are each independently a Kl 1, K48, K63, or C-terminal to N- terminal linkage.
82. The method of any one of claims 77 to 81, wherein the mixed-topology polyubiquitin comprises a Kl 1 linkage and a second linkage different from the Kl 1 linkage.
83. The method of any one of claims 77 to 81, wherein the mixed-topology polyubiquitin comprises a K48 linkage and a second linkage different from the K48 linkage.
84. The method of any one of claims 77 to 81, wherein the mixed-topology polyubiquitin comprises a K63 linkage and a second linkage different from the K63 linkage.
85. The method of any one of claims 77 to 81, wherein the mixed-topology polyubiquitin comprises a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage.
86. The method of any one of claims 77 to 81, wherein the mixed-topology polyubiquitin comprises:
a) a Kl 1 linkage and a K48 linkage;
b) a Kl 1 linkage and a K63 linkage;
c) a Kl 1 linkage and a C- to N-terminal linkage;
d) a K48 linkage and a K63 linkage;
e) a K48 linkage and a C- to N-terminal linkage; or
f) a K63 linkage and a C- to N-terminal linkage.
87. A method of detecting a polyubiquitinated protein in a biological sample, the polyubiquitinated protein being polyubiquitinated at two or more positions with at least first and second polyubiquitins, with the first and second polyubiquitins having different linkages, comprising contacting the biological sample with the antibody of any one of claims 1 to 69 under conditions permissive for binding of the antibody to the polyubiquitinated protein, and detecting whether a complex is formed between the antibody and polyubiquitinated protein in the biological sample.
88. The method of claim 87, wherein the first and second polyubiquitins respectively comprise:
a) a Kl 1 linkage and a second linkage different from the Kl 1 linkage;
b) a K48 linkage and a second linkage different from the K48 linkage;
c) a K63 linkage and a second linkage different from the K63 linkage; d) a C- to N-terminal linkage and a second linkage different from the C- to N-terminal linkage;
e) a Kl 1 linkage and a K48 linkage;
f) a Kl 1 linkage and a K63 linkage;
g) a Kl 1 linkage and a C- to N-terminal linkage;
h) a K48 linkage and a K63 linkage;
i) a K48 linkage and a C- to N-terminal linkage; or
j) a K63 linkage and a C- to N-terminal linkage.
PCT/US2017/038940 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibodies WO2017223405A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP17735332.3A EP3475298A1 (en) 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibodies
JP2018566289A JP7133477B2 (en) 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibody
CN201780050175.5A CN109563160B (en) 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibodies
CN202310104155.9A CN116143918A (en) 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibodies
US16/211,669 US11274145B2 (en) 2016-06-24 2018-12-06 Anti-polyubiquitin multispecific antibodies
US17/576,344 US20220242938A1 (en) 2016-06-24 2022-01-14 Anti-Polyubiquitin Multispecific Antibodies
JP2022089497A JP2022130392A (en) 2016-06-24 2022-06-01 Anti-polyubiquitin multispecific antibodies
JP2024083732A JP2024122991A (en) 2016-06-24 2024-05-23 Anti-polyubiquitin multispecific antibody

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662354305P 2016-06-24 2016-06-24
US62/354,305 2016-06-24

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/211,669 Continuation US11274145B2 (en) 2016-06-24 2018-12-06 Anti-polyubiquitin multispecific antibodies

Publications (1)

Publication Number Publication Date
WO2017223405A1 true WO2017223405A1 (en) 2017-12-28

Family

ID=59276894

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/038940 WO2017223405A1 (en) 2016-06-24 2017-06-23 Anti-polyubiquitin multispecific antibodies

Country Status (5)

Country Link
US (2) US11274145B2 (en)
EP (1) EP3475298A1 (en)
JP (3) JP7133477B2 (en)
CN (2) CN109563160B (en)
WO (1) WO2017223405A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023034750A1 (en) * 2021-08-30 2023-03-09 Genentech, Inc. Anti-polyubiquitin multispecific antibodies

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11187700B1 (en) * 2021-01-28 2021-11-30 Eckhard Kemmann Closed system for enlarging viral and bacterial particles for identification by diffraction scanning

Citations (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2000061739A1 (en) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Method for controlling the activity of immunologically functional molecule
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001029246A1 (en) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (en) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. Fused protein composition
WO2005035778A1 (en) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY USING RNA INHIBITING THE FUNCTION OF α1,6-FUCOSYLTRANSFERASE
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (en) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. Medicine containing antibody composition
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070218069A1 (en) * 2005-12-15 2007-09-20 Gordon Nathaniel C Methods and compositions for targeting polyubiquitin
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130499A1 (en) * 2010-04-15 2011-10-20 Genentech, Inc. Anti-polyubiquitin antibodies and methods of use
US8133488B2 (en) 2008-01-18 2012-03-13 Genentech, Inc. Methods and compositions for targeting polyubiquitin
WO2013022848A1 (en) * 2011-08-05 2013-02-14 Genentech, Inc. Anti-polyubiquitin antibodies and methods of use
WO2015187428A1 (en) * 2014-06-06 2015-12-10 Redwood Bioscience, Inc. Anti-her2 antibody-maytansine conjugates and methods of use thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA200804680B (en) * 2005-12-15 2009-10-28 Genentech Inc Methods and compositions for targeting polyubiquitin
EP3448874A4 (en) * 2016-04-29 2020-04-22 Voyager Therapeutics, Inc. Compositions for the treatment of disease

Patent Citations (94)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (en) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Method for controlling the activity of immunologically functional molecule
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2001029246A1 (en) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
WO2005035586A1 (en) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. Fused protein composition
WO2005035778A1 (en) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY USING RNA INHIBITING THE FUNCTION OF α1,6-FUCOSYLTRANSFERASE
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (en) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. Medicine containing antibody composition
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070218069A1 (en) * 2005-12-15 2007-09-20 Gordon Nathaniel C Methods and compositions for targeting polyubiquitin
US7763245B2 (en) 2005-12-15 2010-07-27 Genentech, Inc. Methods and compositions for targeting polyubiquitin
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US8133488B2 (en) 2008-01-18 2012-03-13 Genentech, Inc. Methods and compositions for targeting polyubiquitin
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130499A1 (en) * 2010-04-15 2011-10-20 Genentech, Inc. Anti-polyubiquitin antibodies and methods of use
US8992919B2 (en) 2010-04-15 2015-03-31 Genentech, Inc. Anti-polyubiquitin antibodies and methods of use
WO2013022848A1 (en) * 2011-08-05 2013-02-14 Genentech, Inc. Anti-polyubiquitin antibodies and methods of use
US9321844B2 (en) 2011-08-05 2016-04-26 Genentech, Inc. Anti-polyubiquitin antibodies
WO2015187428A1 (en) * 2014-06-06 2015-12-10 Redwood Bioscience, Inc. Anti-her2 antibody-maytansine conjugates and methods of use thereof

Non-Patent Citations (114)

* Cited by examiner, † Cited by third party
Title
ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
AUSUBEL ET AL.: "Current Protocols In Molecular Biology", 1995, article "Unit 15 (Immunoblotting)"
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BEHRENDS CHRISTIAN ET AL: "Constructing and decoding unconventional ubiquitin chains", NAT. STRUCT. MOL. BIOL,, vol. 18, no. 5, 1 May 2011 (2011-05-01), pages 520 - 528, XP002689013, ISSN: 1545-9993, [retrieved on 20110504], DOI: 10.1038/NSMB.2066 *
BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., NEW YORK, pages: 51 - 63
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CARTER, P.J.; SENTER P.D., THE CANCER JOUR., vol. 14, no. 3, 2008, pages 154 - 169
CHARI, R.V., ACC. CHEM. RES., vol. 41, 2008, pages 98 - 107
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, TOTOWA, NJ, pages: 245 - 254
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
CRAGG, M.S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052
CRAGG, M.S.; M.J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60
DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40
ELLIOTT, J. M ET AL.: "Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction", J MOL BIOL, vol. 426, 2014, pages 1947 - 1957, XP028844614, DOI: doi:10.1016/j.jmb.2014.02.015
ELLIOTT, J. M. ET AL.: "Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction", J MOL BIOL, vol. 426, 2004, pages 1947 - 1957, XP028844614, DOI: doi:10.1016/j.jmb.2014.02.015
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368
GUTERMAN; GLICKMAN, CURR. PROT. PEP. SCI., vol. 5, 2004, pages 201 - 210
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY, COLD SPRING HARBOR, NY, article "ch. 14"
HARRIS, R. J.: "Processing of C-terminal lysine and arginine residues of proteins isolated from mammalian cell culture", JCHROMATOGR A, vol. 705, 1995, pages 129 - 134, XP004038942, DOI: doi:10.1016/0021-9673(94)01255-D
HARRIS, R. J.; WAGNER, K. L.; SPELLMAN, M. W.: "Structural characterization of a recombinant CD4-IgG hybrid molecule", EUR JBIOCHEM, vol. 194, 1990, pages 611 - 620, XP009026001, DOI: doi:10.1111/j.1432-1033.1990.tb15660.x
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, TOTOWA, NJ, pages: 1 - 37
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
IWAI; TOKUNAGA, EMBO REPORTS, vol. 10, 2009, pages 706 - 713
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH, BETHESDA, MD
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NIH PUBLICATION 91-3242, BETHESDA MD, pages: 1 - 3
KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605
KANDA, Y. ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KIM NEWTON ET AL: "Ubiquitin Chain Editing Revealed by Polyubiquitin Linkage-Specific Antibodies", CELL, vol. 134, no. 4, 1 August 2008 (2008-08-01), pages 668 - 678, XP055160654, ISSN: 0092-8674, DOI: 10.1016/j.cell.2008.07.039 *
KINDT ET AL.: "Kuby Immunology, 6th ed.", 2007, W.H. FREEMAN AND CO., pages: 91
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KOMANDER; RAPE, ANNU. REV. BIOCHEM., vol. 81, 2012, pages 203 - 29
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., PROC. NATL. ACAD. SET. USA, vol. 103, 2006, pages 3557 - 3562
LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459
LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MARKS; BRADBURY: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, TOTOWA, NJ, pages: 161 - 175
MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, - 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554
MERCHANT, A. M. ET AL.: "An efficient route to human bispecific IgG", NAT BIOTECHNOL, vol. 16, 1998, pages 677 - 681, XP002141015, DOI: doi:10.1038/nbt0798-677
MEYER, H. J.; RAPE, M., CELL, vol. 157, 2014, pages 910 - 921
MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537
MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, TOTOWA, NJ, article "pitope Mapping Protocols"
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249
OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68
OSOL, A.: "Remington's Pharmaceutical Sciences, 16th ed.", 1980
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PENG ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 921 - 926
PETKOVA, S.B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PICKART, ANNU. REV. BIOCHEM., vol. 70, 2001, pages 503 - 533
PICKART; FUSHMAN, CURR. OPIN. CHEM. BIOL., vol. 8, 2004, pages 610 - 616
PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, NEW YORK, pages: 269 - 315
POLAKIS P., CURRENT OPINION IN PHARMACOLOGY, vol. 5, 2005, pages 382 - 387
PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
SHATZ, W. ET AL.: "Knobs-into-holes antibody production in mammalian cell lines reveals that asymmetric afucosylation is sufficient for full antibody-dependent cellular cytotoxicity", MABS, vol. 5, 2013, pages 872 - 881, XP055282425, DOI: doi:10.4161/mabs.26307
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SPIESS, C. ET AL.: "Bispecific antibodies with natural architecture produced by co-culture of bacteria expressing two distinct half-antibodies", NAT BIOTECHNOL, vol. 31, 2013, pages 753 - 758, XP055127867, DOI: doi:10.1038/nbt.2621
T. IWAI; TOKUNAGA, EMBO REPORTS, vol. 10, 2009, pages 706 - 713
TEICHER, B.A., CURRENT CANCER DRUG TARGETS, vol. 9, 2009, pages 982 - 1004
TOKUNAGA ET AL., NAT. CELL BIOL., vol. 11, 2009, pages 123 - 132
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DIJK; VAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VAN DONGEN ET AL., THE ONCOLOGIST, vol. 12, 2007, pages 1379 - 1389
VEREL ET AL., J. NUCL. MED., vol. 44, 2003, pages 1271 - 1281
VOLLMERS; BRANDLEIN, HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERS; BRANDLEIN, METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91
WILKINSON, SEMIN. CELL DEVEL. BIOL., vol. 11, no. 3, 2000, pages 141 - 148
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
WONG, A. W.; BAGINSKI, T. K.; REILLY, D. E.: "Enhancement of DNA uptake in FUT8-deleted CHO cells for transient production of afucosylated antibodies", BIOTECHNOL BIOENG, vol. 106, 2010, pages 751 - 763, XP055264614, DOI: doi:10.1002/bit.22749
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, TOTOWA, NJ, pages: 255 - 268

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023034750A1 (en) * 2021-08-30 2023-03-09 Genentech, Inc. Anti-polyubiquitin multispecific antibodies

Also Published As

Publication number Publication date
CN109563160A (en) 2019-04-02
CN109563160B (en) 2023-02-28
EP3475298A1 (en) 2019-05-01
US11274145B2 (en) 2022-03-15
JP2024122991A (en) 2024-09-10
CN116143918A (en) 2023-05-23
US20220242938A1 (en) 2022-08-04
JP2019528040A (en) 2019-10-10
US20190169278A1 (en) 2019-06-06
JP7133477B2 (en) 2022-09-08
JP2022130392A (en) 2022-09-06

Similar Documents

Publication Publication Date Title
US20190085089A1 (en) ANTI-Ly6E ANTIBODIES AND METHODS OF USE
WO2016061389A2 (en) Anti-alpha-synuclein antibodies and methods of use
CA2936565A1 (en) Anti-jagged1 antibodies and methods of use
CA2862422A1 (en) Anti-lrp5 antibodies and methods of use
US8993249B2 (en) Anti-neuropilin antibodies and methods of use
CA2880271C (en) Anti-jagged anitbodies and methods of use
US20220242938A1 (en) Anti-Polyubiquitin Multispecific Antibodies
WO2012010582A1 (en) Anti-cxcr5 antibodies and methods of use
AU2012269075B2 (en) Anti-human EPO receptor antibodies and methods of use
WO2013083497A1 (en) Antibody formulation
TW201326212A (en) Anti-MCSP antibodies
WO2023034750A1 (en) Anti-polyubiquitin multispecific antibodies
WO2022255440A1 (en) Anti-ddr2 antibodies and uses thereof
CN117957249A (en) Anti-polyubiquitin multispecific antibodies

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17735332

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2018566289

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017735332

Country of ref document: EP

Effective date: 20190124