WO2017068183A1 - Single-chain cd137-receptor agonist proteins - Google Patents
Single-chain cd137-receptor agonist proteins Download PDFInfo
- Publication number
- WO2017068183A1 WO2017068183A1 PCT/EP2016/075543 EP2016075543W WO2017068183A1 WO 2017068183 A1 WO2017068183 A1 WO 2017068183A1 EP 2016075543 W EP2016075543 W EP 2016075543W WO 2017068183 A1 WO2017068183 A1 WO 2017068183A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- receptor agonist
- cd137l
- domain
- soluble
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/191—Tumor necrosis factors [TNF], e.g. lymphotoxin [LT], i.e. TNF-beta
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/034—Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the periplasmic space of Gram negative bacteria as a soluble protein, i.e. signal sequence should be cleaved
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- the present invention provides specific CD137 receptor agonist proteins comprising three soluble CD137L domains and an Fc fragment, nucleic acid molecules encoding the CD137 receptor agonist proteins, and uses thereof.
- the CD137 receptor agonist proteins are substantially non-aggregating and suitable for therapeutic, diagnostic and/or research applications.
- TNF superfamily cytokines trimerization of TNF superfamily (TNFSF) cytokines is required for efficient receptor binding and activation. Trimeric complexes of TNF superfamily cytokines, however, are difficult to prepare from recombinant monomeric units.
- WO 01/49866 and WO 02/09055 disclose recombinant fusion proteins comprising a TNF cytokine and a multimerization component, particularly a protein from the C1q protein family or a collectin.
- a disadvantage of these fusion proteins is, however, that the trimerization domain usually has a large molecular weight and/or that the
- trimerization is rather inefficient.
- WO 01/25277 relates to single-chain oligomeric polypeptides which bind to an extracellular ligand binding domain of a cellular receptor, wherein the polypeptide comprises at least three receptor binding sites of which at least one is capable of binding to a ligand binding domain of the cellular receptor and at least one is incapable of effectively binding to a ligand binding domain of the cellular receptor, whereby the single-chain oligomeric polypeptides are capable of binding to the receptor, but incapable of activating the receptor.
- the monomers are derived from cytokine ligands of the TNF family, particularly from TNF-a.
- WO 2005/103077 discloses single-chain fusion polypeptides comprising at least three monomers of a TNF family ligand member and at least two peptide linkers that link the monomers of the TNF ligand family members to one another. Recent experiments, however, have shown that these single-chain fusion polypeptides show undesired aggregation.
- WO 2010/010051 discloses single-chain fusion polypeptides comprising three soluble TNF family cytokine domains and at least two peptide linkers.
- the described fusion polypeptides are substantially non-aggregating.
- the present invention provides specific CD137 receptor agonist proteins that mimic the CD137:CD137L interaction in vivo, exhibit low proteolytic degradation and a shorter in vivo half-life as compared to agonistic monoclonal antibodies.
- the CD137 receptor agonist proteins of the instant invention generally comprise:(i) a first soluble CD137L cytokine domain; (ii) a first peptide linker; (iii) a second soluble CD137L domain; (iv) a second peptide linker; (v) a third soluble CD137L domain; (vi) a third peptide linker (e.g., a hinge-linker) and (vii) an antibody Fc fragment.
- the antibody Fc fragment (vii) is located N terminal to the first CD137L domain (i) and/or C-terminal to the third CD137L domain (v). In another embodiment the antibody Fc fragment is located C-terminally to the third CD137L domain (v).
- the polypeptide is substantially non-aggregating.
- the second and/or third soluble CD137L domain is an N-terminally shortened domain which optionally comprises amino acid sequence mutations.
- the soluble CD137L domains (i), (ii) and (iii) are an C-terminally shortened domain which optionally comprises amino acid sequence mutations.
- At least one of the soluble CD137L domains is a soluble CD137L domain with an N- terminal sequence which starts at amino acid D86 or R88 or Q89 or G90 of human CD137L and wherein D86 or R88 or Q89 may be replaced by a neutral amino acid, e.g., Ser or Gly.
- at least one of the soluble CD137L domains is a soluble CD137L domain with an N-terminal sequences selected from (a) D86- G90 and (b) (Gly/Ser)89 - G90.
- the soluble CD137L domain ends with amino acid E254 of human CD137L and/or optionally comprises one or more mutation at positions D86, L87, R88, Q89, D112, V118, A154, A174, A176, A188, T241.
- the soluble CD137L domains (i), (iii) and (v) comprise amino acids D86 - E254 of human CD137L according to SEQ ID NO: 1.
- At least one of the soluble CD137L domains, particularly at least the soluble CD137L domains (i), is a soluble CD137L domain with an N-terminal sequence which starts at amino acid R88 and wherein R88 may be replaced by Ser or Gly.
- at least one of the soluble CD137L domains, particularly at least the soluble CD137L domain (iii) is a soluble C-terminal shortened CD137L domain ending with V240.
- at least one of the soluble CD137L domains, particularly at least the soluble CD137L domains (iii) is a soluble C-terminal shortened CD137L domain ending with T241.
- at least one of the soluble CD137L domains, particularly at least the soluble CD137L domains (iii) is a soluble C-terminal shortened CD137L domain ending with E243.
- the first and second peptide linkers (ii) and (iv) independently have a length of 3-8 amino acids, particularly a length of 3, 4, 5, 6, 7, or 8 amino acids, and preferably are glycine/serine linkers, optionally comprising an asparagine residue which may be glycosylated.
- the first and the second peptide linkers (ii) and (iv) consist of the amino acid sequence according to SEQ ID NO: 2.
- the polypeptide additionally comprises an N-terminal signal peptide domain, e.g.
- SEQ ID NO: 17 which may comprise a protease cleavage site, and/or which additionally comprises a C-terminal element which may comprise and/or connect to a recognition/purification domain, e.g., a Strep-tag attached to a serine linker according to SEQ ID NO: 18.
- the antibody Fc fragment (vii) is fused to the soluble CD 37L domain (i) and/or (v) via a hinge-linker, preferably of SEQ ID NO: 16.
- the antibody Fc fragment (vii) consists of the amino acid sequence as shown in SEQ ID NO: 13 or 14.
- the single-chain fusion polypeptide of the present invention comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 15, and 25-35.
- the present invention provides a CD137 receptor agonist protein comprising a dimer of two single-chain fusion polypeptides each having the amino acid sequence set forth in SEQ ID NO: 27.
- the two polypeptides are covalently linked through three interchain disulfide bonds formed between cysteine residues 484, 490, and 493 of each polypeptide. Similar cysteine residues are positions 484, 490 and 493 of SEQ ID NO: 28, 29 or 32, positions 489, 495 and 498 of SEQ ID NO: 30, positions 493, 499 and 502 of SEQ ID NO: 31 , and positions 487, 493 and 496 of SEQ ID NO: 33 or 34
- one or more of the asparagine residues at positions 158 and 318 of the mature polypeptide(s) SEQ ID NO: 27, 28 or 29 are N-glycosylated. In another embodiment, the asparagine residues at positions 158 and 318 of the polypeptide(s) are both N-glycosylated. Similar asparagine residues are positions 161 and 324 of SEQ ID NO: 30 or 31 , and positions 159 and 320 of SEQ ID NO: 33 or 34
- the polypeptide(s) are further post-translationally modified.
- the post-translational modification comprises the N-terminal glutamine of the D86Q mutein of the first soluble domain (i) modified to pyroglutamate.
- the post-translational modification comprises the N-terminal glutamine of the first soluble domain (i) starting with Q89 modified to pyroglutamate.
- CD137L domains I., II., III. Soluble CD137L domains.
- FIG. 1 Schematic picture representing the general structure of CD137L.
- Single-chain fusion polypeptide comprising an additional Fab antibody fragment.
- the present invention provides a single-chain fusion polypeptide comprising at least three soluble CD137L domains connected by two peptide linkers and N -terminally and/or C-terminally an antibody-derived dimerization domain.
- the inventors have discovered that dimerization of the two single-chain fusion polypeptides through the dimerization domain results in a hexavalent CD137 receptor agonist, which provides high biological activity and good stability.
- the single-chain fusion polypeptide is non-aggregating.
- non- aggregating refers to a monomer content of the preparation of > 50%, preferably > 70% and more preferably > 90%.
- the ratio of monomer content to aggregate content may be determined by examining the amount of aggregate formation using size-exclusion chromatography (SEC).
- SEC size-exclusion chromatography
- the stability concerning aggregation may be determined by SEC after defined time periods, e.g. from a few to several days, to weeks and months under different storage conditions, e.g. at 4°C or 25°C.
- the "monomer" content is as defined above after a time period of several days, e.g. 10 days, more preferably after several weeks, e.g. 2, 3 or 4 weeks, and most preferably after several months, e.g. 2 or 3 months of storage at 4°C, or 25°C.
- the single-chain fusion polypeptide may comprise additional domains which may be located at the N- and/or C-termini thereof.
- additional fusion domains are e.g. an N-terminal signal peptide domain which may comprise a protease cleave site or a C-terminal element which may comprise and/or connect to a recognition/purification domain.
- the fusion polypeptide comprises a
- Strep-tag at its C-terminus that is fused via a linker.
- An exemplary Strep-tag including a short serine linker is shown in SEQ ID NO: 18.
- the CD137 receptor agonist protein of the present invention comprises three soluble domains derived from CD137L.
- those soluble domains are derived from a mammalian, particularly human CD137L including allelic variants and/or derivatives thereof.
- the soluble domains comprise the extracellular portion of CD137L including the receptor binding domain without membrane located domains.
- CD137L is anchored to the membrane via an N -terminal portion of 5-30 amino acids, the so-called stalk-region. The stalk region contributes to
- the stalk region is not part of the trimeric receptor binding domain (RBD) with the receptor binding sites located at the protomer interfaces.
- the RBD of the Tumor Necrosis Factor Superfamily is characterized by a particular localization of its N- and C-terminal amino acids. Said amino acids are immediately adjacent and are located in close proximity to the axis of the trimer.
- the first N-terminal amino acids of the RBD form an anti-parallel beta-strand with a C- terminal region of the RBD.
- the aforementioned anti-parallel beta-strand of the RBD forms an interface with the cell membrane, which is connected to and anchored within the cell membrane via the amino acids of the stalk region.
- Human CD137L contains a stalk region as well as most likely a C-terminal extension (V240-E254).
- the soluble CD137L domains of the CD137 receptor agonist protein comprise a receptor binding domain of the CD137L lacking any amino acids from the stalk region. Otherwise, a long linker connecting the C-terminus of one of the soluble domains with the N -terminus of the next soluble domain would be required to compensate for the N-terminal stalk-region of the next soluble domain, which might result in instability and/or formation of aggregates. For the same reason, it is also highly preferred that the soluble CD137L domains of the CD137 receptor agonist protein comprise a receptor binding domain of the CD137L lacking any amino acids from the C- terminal extension.
- the single-chain fusion polypeptide consisting of (i) a first soluble CD137L domain; (ii) a first peptide linker; (iii) a second soluble CD137L domain; (iv) a second peptide linker; (v) a third soluble CD137L domain is capable of forming an ordered structure mimicking the trimeric organization of its natural counterpart thereby comprising at least one functional binding site for the respective CD137L receptor.
- the single-chain fusion polypeptide comprising components (i)-(v) is therefore also termed single-chain-CD137L-receptor-binding- domain (scCD137L-RBD).
- scCD137L-RBD single-chain-CD137L-receptor-binding- domain
- the scCD137L-RBD comprises an enhanced stability as the soluble CD137L domains (i), (iii) and (v) are enforced to trimerize by the covalent linkage to each other provided by the linkers (ii) and (iv).
- the CD137 receptor agonist protein comprises three functional CD137 receptor binding sites, i.e. amino acid sequences capable of forming a complex with a CD137 receptor .
- the soluble domains are capable of binding to the corresponding CD137 receptor.
- at least one of the soluble domains is capable of receptor activation, whereby apoptotic and/or proliferative activity may be affected.
- one or more of the soluble domains are selected as not being capable of receptor activation.
- the soluble CD137L domain may be derived from human CD137L as shown in SEQ ID NO: 1.
- the soluble CD137L domains are derived from human CD137L , particularly starting from amino acids 86, 88, 89 or 90 and comprise particularly amino acids 86-254 or 88-254 or 89-254 of SEQ ID NO: 1.
- amino acid R88 of SEQ ID NO: 1 may be replaced by a non-charged amino acid, e.g. Ser or Gly or is replaced by Glutamine.
- Table 1 Sequence of Wild-Type Human CD137L Protein
- the soluble CD137L domains may comprise the wild-type sequences as indicated in SEQ ID NO: 1. It should be noted, however, that it is possible to introduce mutations in one or more of these soluble domains, e.g. mutations which alter (e.g. increase or decrease) the binding properties of the soluble domains. In one embodiment, soluble domains that cannot bind to the corresponding cytokine receptor can be selected. In a further embodiment of the invention, the soluble CD137L domain (i) comprises a mutant of CD137L or a receptor binding domain thereof resulting in reduced affinity and/or reduced activation of CD137 receptor. CD137L-Muteins affecting receptor binding and/or activity
- the mutant may be generated by any technique known by a skilled person.
- the substitution may affect at least one amino acid of CD137L, e.g., human CD137L (e.g. , SEQ ID NO: 1) or a receptor binding domain thereof as described herein.
- Preferred substitutions in this regard affect at least one of the following amino acids of human CD137L of SEQ ID NO: 1 : L115, K127, R150, R193 and Q227.
- the C-terminal region I243-E254 is deleted from at least one of the soluble domains (i), (III) or (v).
- the amino acid substitution(s) may affect the binding and/or activity of CD137L , e.g. , human CD137L , to or on either the CD137 binding or the CD137 induced signaling.
- the binding and/or activity of the CD137 may be affected positively, i.e., stronger, more selective or more specific binding and/or more activation of the receptor.
- the binding and/or activity of the CD137 may be affected negatively, i.e., weaker, less selective or less specific binding and/or less or no activation of the receptor.
- one embodiment is a CD137 receptor agonist protein as described herein wherein at least one of the soluble domains comprises a mutant of CD137L or a receptor binding domain thereof which binds and/or activates CD137 to a lesser extent than the wildtype- CD137L.
- CD137L-Muteins with enhanced stability/solubility
- one or more of the soluble CD137L domains (i), (iii), and (v) may comprise a mutant of CD137L or a receptor binding domain thereof resulting in reduced self-aggregation and/or prolonged in vivo stability.
- A174, A176. Preferred substitutions in this regard are A174[D, N] and A176[S, T].
- the mutation(s) of each CD137L domain may be the same or different.
- the single-chain fusion molecule of the present invention comprises three soluble CD137L domains, namely components (i), (iii) and (v).
- the stability of a single-chain CD137L fusion polypeptide against aggregation is enhanced, if the second and/or third soluble CD137L domain is an N-terminally shortened domain which optionally comprises amino acid sequence mutations.
- both the second and the third soluble CD137L domain are N-terminally shortened domains which optionally comprise amino acid sequence mutations in the N-terminal regions, preferably within the first five amino acids of the N-terminus of the soluble CD137L domain.
- These mutations may comprise replacement of basic amino acids, by neutral amino acids, particularly serine or glycine.
- the selection of the first soluble CD137L domain is not as critical.
- a soluble domain having a full-length N-terminal sequence may be used. It should be noted, however, that also the first soluble CD137L domain may have an N-terminally shortened and optionally mutated sequence.
- the soluble CD137L domains (i), (iii) and (v) are soluble human CD137L domains.
- the first soluble CD137L domain (i) may be selected from native, shortened and/or mutated sequences.
- the first soluble CD137L domain (i) has an N-terminal sequence which may start at amino acid D86 or R88 of human CD137L, and wherein R88 may be replaced by a neutral amino acid, e.g. by Ser or Gly or by Gin to enable pyroglutamate formation during expression.
- the second and third soluble CD137L domains (iii) and (v) have a shortened N-terminal sequence which preferably starts with amino acid Q89 or G90 of human CD137L (SEQ ID NO:1) and wherein Q89 may be replaced by another amino acid, e.g. Ser or Gly.
- the N-terminal sequence of the soluble CD137L domains (iii) and (v) is selected from:
- the soluble CD137L domain preferably ends with amino acid E254 of human CD137L.
- the CD137L domain may comprise internal mutations as described above.
- the soluble CD137L domain preferably ends with amino acid V240 of human CD137L.
- the CD137L domain may comprise internal mutations as described above.
- Components (ii) and (iv) of the CD137 receptor agonist protein are peptide linker elements located between components (i) and (iii) or (iii) and (v), respectively.
- the flexible linker elements have a length of 3-8 amino acids, particularly a length of 3, 4, 5, 6, 7, or 8 amino acids.
- the linker elements are preferably glycine/serine linkers, i.e. peptide linkers substantially consisting of the amino acids glycine and serine. In cases in in which the soluble cytokine domain starts with S or G (N-terminus), the linker ends before this S or G.
- linker (ii) and linker (iv) do not need to be of the same length. In order to decrease potential immunogenicity, it may be preferred to use shorter linkers. In addition it turned out that shorter linkers lead to single chain molecules with reduced tendency to form aggregates. Whereas linkers that are substantially longer than the ones disclosed here may exhibit unfavorable aggregations properties.
- the linker may comprise an asparagine residue which may form a glycosylate site Asn-Xaa-Ser.
- one of the linkers e.g. linker (ii) or linker (iv) comprises a glycosylation site.
- both linkers (iv) comprise glycosylation sites.
- linker (ii) or linker (iv) or both comprise a glycosylation site.
- a preferred linker is GSGSGNGS (SEQ ID NO: 2).
- the CD137 receptor agonist protein additionally comprises an antibody Fc fragment domain which may be located N-terminal to the first CD137L domain (i) and/or C- terminal to the third CD 37L domain (v).
- the antibody Fc fragment domain comprises a reduced capability to interact with Fc-gamma-R receptors in vivo.
- the antibody Fc fragment domain comprises or consists of an amino acid sequence as shown in SEQ ID NO: 13 or 14 (see Table 3).
- Sequence ID NO: 13 has N297S mutation compared to wildtype human IGG1 -Fc.
- Sequence ID NO: 14 is a glycosylated (N297 wildtype) human IGG1 Fc mutein with reduced Fc-gamma-R binding capability.
- the total number of glycosylation sites and the individual position of the carbohydrates in three dimensions impacts the in-vivo stability of CD137 receptor agonist proteins. Further, carbohydrate recognition depends on local density of the terminal saccharides, the branching of the carbohydrate tree and the relative position of the carbohydrates to each other matter.
- partially degraded carbohydrates reduce the in vivo half-life of CD137 receptor agonist proteins through lectin-driven mechanisms. By reducing the total number of glycosylation sites on the molecule, the resulting compound is less accessible to these mechanisms, increasing half-life.
- the overall number of the CH2-domain carbohydrates of the Fc-domain is necessary in order to avoid Fc-gamma-Receptor based binding.
- FcR-gamma-Receptors on cells could lead to hyper-crosslinking of the fusion-protein in vivo potential leading to CD137-receptor superclustering-based toxicity.
- unwanted Fc-driven mechanisms like ADCC could lead to toxic events. Accordingly, in one embodiment, the overall number of
- glycosylation sites on the CD137 receptor agonist proteins of the instant invention is reduced through the depletion of CH2 glycosylation sites, particularly the N- glycosylation site, resulting in CD137 receptor agonist proteins comprising N297S equivalent mutations of SEQ ID NO: 15 (PROTEIN A) (according to the EU numbering system) creating aglycosl-CH2 domains.
- CH2-glycosylation present on the inner surface areas normally shields the subdomain from proteases during "open Fc-conformation transits" wherein hinge-interchain disulfide bonds are reduced and the covalent interchain linkage is disrupted. This enables CH2-dissociation and exposure of the inner surface area towards proteases.
- CD137 receptor agonist proteins comprising an Fc-domain with a N297S equivalent mutation of SEQ ID NO: 15 (PROTEIN A) (according to the EU numbering system) creates an aglycosylated-CH2 and are therefore likely to be subject to protease digestion and less stable than equivalent structures with wild-type CH2 glycosylation.
- the CD 137 receptor agonist lacks CH2 glycosylation sites, but comprises glycosylation sites in the linker sequences of each polypeptide chain (e.g., GSGSGNGS, SEQ ID NO: 2).
- the antibody Fc fragment domain is fused via a hinge- linker element.
- the hinge-linker element has a length of 10-30 amino acids, particularly a length of 15-25 amino acids, e.g. 22 amino acids.
- the term "hinge-linker” includes any linker long enough to allow the domains attached by the hinge- linker element to attain a biologically active confirmation.
- the hinge-linker element preferably comprises the hinge-region sequence of an immunoglobulin, herein referred to as "lg hinge-region".
- Ig hinge- region means any polypeptide comprising an amino acid sequence that shares sequence identity or similarity with a portion of a naturally occurring Ig hinge-region sequence which includes one or more cysteine residues, e.g., two cysteine residues, at which the disulfide bonds link the two heavy chains of the immunoglobulin.
- a derivative or analogue as referred to herein is a polypeptide comprising an amino acid sequence that shares sequence identity or similarity with the full length sequence of the wild type (or naturally occurring protein) except that it has one or more amino acid sequence differences attributable to a deletion, insertion and/or substitution.
- the number of molecules with open Fc-conformation in an individual CD137 receptor agonist protein depends on the number of interchain-disulfide bonds present in the hinge region. Accordingly, in one embodiment a third cysteine (C225 according to the EU numbering system) was introduced into the hinge region of the CD137 receptor agonist proteins of the instant invention in order to ameliorate the effect of depleting the CH2-glycosites.
- C225 according to the EU numbering system
- the CD137 receptor agonist proteins of the invention additionally comprise a mutation of the upper-hinge lysine (K223, according to the EU numbering system) to a glycine to reduce proteolytic processing at this site, thereby enhancing the overall stability of the fusion protein.
- a mutation of the upper-hinge lysine K223, according to the EU numbering system
- a glycine to reduce proteolytic processing at this site, thereby enhancing the overall stability of the fusion protein.
- a particularly preferred hinge-linker element including the aforementioned cysteine (C225) and the lysine to glycine mutation (K223G) comprises or consists of the amino acid sequence as shown in SEQ ID NO: 16 (Table 4).
- the CD137 receptor agonist protein may additionally comprise an N-terminal signal peptide domain, which allows processing, e.g. extracellular secretion, in a suitable host cell.
- the N-terminal signal peptide domain comprises a protease cleavage site, e.g. a signal peptidase cleavage site and thus may be removed after or during expression to obtain the mature protein.
- a particularly preferred N-terminal signal peptide domain comprises the amino acid sequence as shown in SEQ ID NO: 17 (Table 4).
- the CD137 receptor agonist protein may additionally comprise a C-terminal element, having a length of e.g. 1-50, preferably 10-30 amino acids which may include or connect to a recognition/purification domain, e.g.
- the fusion polypeptide comprises a Strep-tag fused to the C-terminus via a short serine linker as shown in SEQ ID NO: 18 (Table 4).
- Preferred hinge-linker elements SEQ ID NO: 16, 19-24
- SEQ ID NO: 7 a preferred N-terminal signal peptide domain
- SEQ ID NO: 18 a preferred serine linker-strep tag
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2. All three soluble CD137L domain (i), (iii), (v) consists of amino acids 89-240 of human CD137L according to SEQ ID NO: 1.
- the resulting scCD137L-RBD sequence module is shown in table 5b SEQ ID NO: 36.
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2. All three soluble CD137L domain (i), (iii), (v) consists of amino acids 86-240 of human CD137L according to SEQ ID NO: 1 with D86Q mutation in the first domain (i).
- the resulting scCD137L-RBD sequence module is shown in table 5b SEQ ID NO: 39.
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2.
- All three soluble CD137L domain (i), (iii), (v) consists of amino acids 88-240 of human CD137L according to SEQ ID NO: 1.
- the resulting scCD137L-RBD sequence module is shown in table 5b SEQ ID NO: 40.
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2. All three soluble CD137L domain (i), (iii), (v) consists of amino acids 88-240 of human CD137L according to SEQ ID NO: 1 with R88Q mutation in the first domain (i) and
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2. All three soluble CD137L domain (i), (iii), (v) consists of amino acids 88-240 of human CD137L according to SEQ ID NO: 1 with R88S mutation in the first domain (i) and R88G mutation in domains (iii) and (v).
- the resulting scCD137L-RBD sequence module is shown in table 5b SEQ ID NO: 42.
- the fusion polypeptide comprises three soluble CD137L domains fused by peptide linker elements of SEQ ID NO: 2. All three soluble CD137L domain (i), (iii), (v) consists of amino acids 89-240 of human CD137L according to SEQ ID NO: 1 and comprise the A174N and A176S mutations.
- the resulting scCD137L-RBD sequence module is shown in table 5b SEQ ID NO: 43.
- the fusion polypeptide comprises an antibody Fc fragment domain according to SEQ ID NO: 13 that is fused C-terminally to the soluble CD137L domain (v) via a hinge- linker according to SEQ ID NO: 16.
- This particular fusion polypeptide provides improved biological activity as compared to bivalent agonistic anti-CD137-mAB and has a prolonged stability as compared to fusion proteins comprising a lysine in position 223 and a N297S mutation in the CH2 domain (according to the EU numbering).
- amino acid sequence of an exemplary embodiment of a CD137 receptor agonist protein of the invention is set forth in SEQ ID NO: 27.
- the fusion polypeptide may comprise an N-terminal signal peptide domain e.g. according to SEQ ID NO: 17.
- SEQ ID NO: 25 A specific example of a CD137 receptor agonist protein of the invention is shown in SEQ ID NO: 25.
- the fusion polypeptide may additionally comprise a C-terminal Strep-tag that is fused to the polypeptide of the invention via a short serine linker as shown in SEQ ID NO: 18.
- the Fc fragment preferably consists of the amino acid sequence as shown in SEQ ID NO: 13 or 14. Further, the Fc fragment may consist of a shorter Fc fragment, for example including amino acids 1 -217 of SEQ ID NO: 13. Particularly preferred examples of fusion polypeptides comprising a C-terminal Strep-tag are shown in SEQ ID NO: 15 (PROTEIN A).
- exemplary CD137 receptor agonist proteins (without a signal peptide) of the instant invention are set forth in SEQ ID NO: 27-35.
- Exemplary CD137 receptor agonist proteins described above are shown in Table 5.
- the CD137 receptor agonist as set forth in SEQ ID NO: 27 has a reduced total number of glycosylation sites (the N297S mutation in the CH2 region providing an aglycosylated CH2 domain, according to the EU numbering system), an increased number of inter- chain disulfide bonds in the hinge region, and the mutation of an upper-hinge lysine to a glycine (K223G, according to the EU numbering system). These alterations provide a decrease in potential degradation and CD137 receptor superclustering (along with concomitant toxicity).
- the CD 37 receptor agonist as set forth in SEQ ID NO: 30 comprises a scCD137L- RBD module with SEQ ID NO: 36, a third peptide linker with SEQ ID NO: 21 and (vii) an antibody Fc fragment with SEQ ID NO: 13.
- the CD137 receptor agonist as set forth in SEQ ID NO: 31 comprises a scCD137L- RBD module with SEQ ID NO: 39, a third peptide linker with SEQ ID NO: 16 and (vii) an antibody Fc fragment with SEQ ID NO: 13.
- the CD137 receptor agonist as set forth in SEQ ID NO: 32 comprises a scCD137L- RBD module with SEQ ID NO: 40, a third peptide linker with SEQ ID NO: 6 and (vii) an antibody Fc fragment with SEQ ID NO: 13.
- the CD137 receptor agonist as set forth in SEQ ID NO: 33 comprises a scCD 37L- RBD module with SEQ ID NO: 41 , a third peptide linker with SEQ ID NO: 16 and (vii) an antibody Fc fragment with SEQ ID NO: 13.
- the CD137 receptor agonist as set forth in SEQ ID NO: 34 comprises a scCD137L-
- RBD module with SEQ ID NO: 42, a third peptide linker with SEQ ID NO: 16 and (vii) an antibody Fc fragment with SEQ ID NO: 13.
- PROTEIN A YKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALT VDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
- a further aspect of the present invention relates to a nucleic acid molecule encoding a CD137 receptor agonist protein as described herein.
- the nucleic acid molecule may be a DNA molecule, e.g. a double-stranded or single- stranded DNA molecule, or an RNA molecule.
- the nucleic acid molecule may encode the CD137 receptor agonist protein or a precursor thereof, e.g. a pro- or pre-proform of the CD137 receptor agonist protein which may comprise a signal sequence or other heterologous amino acid portions for secretion or purification which are preferably located at the N- and/or C-terminus of the CD137 receptor agonist protein.
- the heterologous amino acid portions may be linked to the first and/or second domain via a protease cleavage site, e.g. a Factor X3, thrombin or IgA protease cleavage site.
- a protease cleavage site e.g. a Factor X3, thrombin or IgA protease cleavage site.
- SEQ ID NO: 37 A specific example of a nucleic acid sequence of the invention is shown in Table 6 as SEQ ID NO: 37. This nucleic acid molecule comprises the open reading frame encoding the fusion polypeptide of SEQ ID NO: 25.
- the nucleic acid molecule may be operatively linked to an expression control sequence, e.g. an expression control sequence which allows expression of the nucleic acid molecule in a desired host cell.
- the nucleic acid molecule may be located on a vector, e.g. a plasmid, a bacteriophage, a viral vector, a chromosomal integration vector, etc. Examples of suitable expression control sequences and vectors are described for example by Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, and Ausubel et al. (1989), Current Protocols in Molecular Biology, John Wiley & Sons or more recent editions thereof.
- Suitable host cells include, but are not limited to, prokaryotic cells such as bacteria, e.g. E.coli, eukaryotic host cells such as yeast cells, insect cells, plant cells or animal cells, preferably mammalian cells and, more preferably, human cells.
- prokaryotic cells such as bacteria, e.g. E.coli
- eukaryotic host cells such as yeast cells, insect cells, plant cells or animal cells, preferably mammalian cells and, more preferably, human cells.
- the invention relates to a non-human organism transformed or transfected with a nucleic acid molecule as described above. Such transgenic organisms may be generated by known methods of genetic transfer including homologous recombination.
- a further aspect of the present invention relates to a pharmaceutical or diagnostic composition
- a pharmaceutical or diagnostic composition comprising as the active agent at least one CD137 receptor agonist protein, a respective nucleic acid encoding therefore, or a transformed or transfected cell, all as described herein.
- the present invention provides a pharmaceutical composition comprising an CD137 receptor agonist protein disclosed herein and one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
- the present invention provides a nucleic acid molecule encoding the CD137 receptor agonist protein.
- the present invention provides an expression vector comprising the nucleic acid molecule.
- the present invention provides a cell comprising the nucleic acid molecule.
- the cell is a eukaryotic cell.
- the cell is a cell comprising the nucleic acid molecule.
- the cell is a Chinese Hamster Ovary (CHO) cell.
- the cell is selected from the group consisting of CHO- DBX11 , CHO-DG44, CHO-S, and CHO-K1 cells.
- the cell is selected from the group consisting of Vero, BHK, HeLa, COS, MDCK, HEK-293, NIH- 3T3, W138, BT483, Hs578T, HTB2, BT20, T47D, NSO, CRL7030, HsS78Bst, PER.C6, SP2/0-Agl4, and hybridoma cells.
- the present invention provides a method of treating a subject having anCD137L-associated disease or disorder, the method comprising administering to the subject an effective amount of the CD137 receptor agonist protein.
- the CD137 receptor agonist protein is administered alone.
- the CD137 receptor agonist protein is administered before, concurrently, or after the administration of a second agent.
- the disease or disorder is selected from the group consisting of: tumors, infectious diseases, inflammatory diseases, metabolic diseases, autoimmune disorders, degenerative diseases, apoptosis-associated diseases, and transplant rejections.
- the tumors are solid tumors.
- the tumors arise from the group of cancers consisting of sarcoma, esophageal cancer, and gastric cancer.
- the tumors arise from Ewing's sarcoma or fibrosarcoma
- the tumors arise from the group of cancers consisting of Non-Small Cell Lung Carcinoma (NSCLC), pancreatic cancer, colorectal cancer, breast cancer, ovarian cancer, head and neck cancers, and Small Cell Lung Cancer (SCLC).
- NSCLC Non-Small Cell Lung Carcinoma
- SCLC Small Cell Lung Cancer
- the tumors are lymphatic tumors.
- the tumors are hematologic tumors.
- the tumors arise from non-Hodgkin's lymphoma, leukemia, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), B cell lymphoma, Burkitt's lymphoma, chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), or hairy cell leukemia.
- the autoimmune disorders are rheumatoid diseases, arthritic diseases, or rheumatoid and arthritic diseases.
- the disease or disorder is rheumatoid arthritis.
- the degenerative disease is a neurodegenerative disease.
- the neurodegenerative disease is multiple sclerosis.
- the second agent is a chemotherapeutic, radiotherapeutic, or biological agent.
- the second agent is selected from the group consisting of Duvelisib, Ibrutinib, Navitoclax, and Venetoclax,
- the second agent is an apoptotic agent.
- the apoptotic second agent is selected from the group consisting of Bortezomib, Azacitidine, Dasatinib, and
- the pharmaceutical compositions disclosed herein are administered to a patient by intravenous or subcutaneous administration.
- the disclosed pharmaceutical compositions are administered to a patient byoral, parenteral, intramuscular, intrarticular, intrabronchial, intraabdominal,
- intracapsular intracartilaginous, intracavitary, intracelial, intracerebellar
- the CD137 receptor agonist protein is administered as a single bolus. In another embodiment, CD137 receptor agonist protein may be administered over several divided doses.
- the CD137 receptor agonist protein can be administered at about 0.1 -100 mg/kg. In one embodiment, the CD137 receptor agonist protein can be administered at a dosage selected from the group consisting of: about 0.1 -0.5, 0.1-1 , 0.1-10, 0.1-20, 0.1 -50, 0.1-75, 1-10, 1 -15, 1 -7.5, 1.25-15, 1.25-7.5, 2.5-7.5, 2.5-15, 5- 15, 5-7.5,1-20, 1-50, 7-75, 1 -100, 5-10, 5-15, 5-20, 5-25, 5-50, 5-75, 10-20, 10-50, 10- 75, and 10-100 mg/kg.
- the CD137 receptor agonist protein is present in pharmaceutical compositions at about 0.1-100 mg/ml. In one embodiment, the CD137 receptor agonist protein is present in pharmaceutical compositions at an amount selected from the group consisting of: about 0.1-0.5, 0.1 -1 , 0.1-10, 0.1-20, 0.1- 50, 0.1-75, 1-10, 1-20, 1-50, 1 -75, 1-100, 5-10, 5-15, 5-20, 5-25, 5-50, 5-75, 10-20, 10- 50, 10-75, or 10-100 mg/ml. In other embodiments, a therapeutically effective amount of CD137 receptor agonist protein is administered to a subject. In another embodiment, a prophylactically effective amount of CD137 receptor agonist protein is administered to a subject.
- CD137L-associated disease or disorder is any disease or disorder which may be ameliorated by administering an effective amount of a CD137 receptor agonist to a subject in need thereof.
- At least one CD137 receptor agonist protein, respective nucleic acid encoding therefore, or transformed or transfected cell, all as described herein may be used in therapy, e.g., in the prophylaxis and/or treatment of disorders caused by, associated with and/or accompanied by dysfunction of CD137L, particularly proliferative disorders, such as tumors, e.g. solid or lymphatic tumors;
- infectious diseases e.g. pulmonary disease 2019
- metabolic diseases e.g. pulmonary disease 2019
- autoimmune disorders e.g. rheumatoid and/or arthritic diseases
- degenerative diseases e.g.
- neurodegenerative diseases such as multiple sclerosis; apoptosis-associated diseases or transplant rejections.
- CD137L function of CD137L
- overexpression of the CD137L gene or protein reduced or abolished expression of the CD137L gene or protein compared to the normal physiological expression level of CD137L, increased activity of CD137L, reduced or abolished activity of CD137L, increased binding of CD137L to any binding partners, e.g. , to a receptor, particularly a CD137L receptor or another cytokine molecule, reduced or abolished binding to any binding partner, e.g. to a receptor, particularly a CD137L receptor or another cytokine molecule, compared to the normal physiological activity or binding of CD 37L.
- a method for diagnosing and/or treating a human subject suffering from a disorder which can be diagnosed and/or treated by targeting CD137L receptors comprising administering to the human subject a CD137 receptor agonist protein disclosed herein such that the effect on the activity of the target, or targets, in the human subject is agonistic, one or more symptoms is alleviated, and/or treatment is achieved.
- the CD137 receptor agonist proteins provided herein can be used to diagnose and/ or treat humans suffering from primary and metastatic cancers, including carcinomas of breast, colon, rectum, lung (e.g.
- small cell lung cancer “SCLC” and non- small cell lung cancer “NSCLC”) small cell lung cancer “SCLC” and non- small cell lung cancer “NSCLC”
- oropharynx hypopharynx
- esophagus stomach, pancreas, liver, gallbladder and bile ducts, small intestine, urinary tract (including kidney, bladder and urothelium)
- female genital tract including cervix, uterus, and ovaries as well as choriocarcinoma and gestational trophoblastic disease
- male genital tract including prostate, seminal vesicles, testes and germ cell tumors
- endocrine glands including the thyroid, adrenal, and pituitary glands
- skin as well as hemangiomas, melanomas, sarcomas (including those arising from bone and soft tissues as well as Kaposi's sarcoma), tumors of the brain, nerves, eyes, and meninges (
- a pharmaceutical composition comprising a CD137 receptor agonist protein disclosed herein and a pharmaceutically acceptable carrier is provided.
- the pharmaceutical composition comprises at least one additional therapeutic agent for treating a disorder.
- the additional agent may be a therapeutic agent, a chemotherapeutic agent; an imaging agent, a cytotoxic agent, an angiogenesis inhibitor, a kinase inhibitor (including but not limited to a KDR and a TIE-2 inhibitor), a co- stimulation molecule modulator or an immune checkpoint inhibitor (including but not limited to anti-B7.1 , anti-B7.2, anti-B7.3, anti-B7.4, anti-CD28, anti-B7RP1 , CTLA4-lg, anti-CTLA-4, anti-PD-1 , anti-PD-L1 , anti-PD-L2, anti-ICOS, anti-LAG-3, anti-Tim3, anti- VISTA, anti-HVEM, anti-BTLA, LIGHT fusion protein, anti-CD137, anti-CD137L, anti- OX
- an antidepressant an antipsychotic, a stimulant, an asthma medication, a beta agonist, an inhaled steroid, an epinephrine or analog, a cytokine, or a cytokine antagonist.
- the CD137 receptor agonist protein(s) can be used alone or in combination with one or more additional agents, e.g., a chemotherapeutic, radiotherapy, or biological agent.
- the agent can include the following:! 3-cis-Retinoic Acid; 2-CdA; 2-Chlorodeoxyadenosine; 5- Azacitidine; 5-Fluorouracil; 5-FU; 6-Mercaptopurine; 6-MP; 6-TG; 6-Thioguanine;
- Cort® Aldesleukin; Alemtuzumab; ALIMTA; Alitretinoin; Alkaban-AQ®; Alkeran®; All- transretinoic Acid; Alpha Interferon; Altretamine; Amethopterin; Amifostine;
- Bevacizumab Bexarotene; BEXXAR®; Bicalutamide; BiCNU; Blenoxane®; Bleomycin;
- Busulfan Busulfex®; C225; Calcium Leucovorin; Campath®; Camptosar®; Camptothecin-1 ; Capecitabine CaracTM; Carboplatin; Carmustine; Carmustine Wafer;
- Casodex® CC-5013; CCI-779; CCNU; CDDP; CeeNU; Cerubidine®; Cetuximab;
- Chlorambucil Cisplatin; Citrovorum Factor; Cladribine; Cortisone; Cosmegen®; CPT-
- Cyclophosphamide Cytadren®; Cytarabine; Cytarabine Liposomal; Cytosar-U®;
- Cytoxan® dacarbazine; Dacogen; Dactinomycin; Darbepoetin Alfa; Dasatinib;
- Daunomycin Daunorubicin; Daunorubicin Hydrochloride; Daunorubicin Liposomal;
- DaunoXome® Decadron; Decitabine; Delta-Cortef®; Deltasone®; Denileukin; Diftitox;
- DepoCytTM Dexamethasone
- Dexamethasone Acetate Dexamethasone Sodium
- Doxorubicin Doxorubicin Liposomal; DroxiaTM; DTIC; DTIC-Dome®; Duralone®;
- Epoetin Alfa Erbitux; Erlotinib; Erwinia L-asparaginase; Estramustine; Ethyol
- Etopophos® Etoposide; Etoposide Phosphate; Eulexin®; Everolimus; Evista®;
- Fludarabine Fluoroplex®; Fluorouracil; Fluorouracil (cream); Fluoxymesterone;
- G-CSF Colony Stimulating Factor
- G-MCSF Halotestin®; Herceptin®; Hexadrol; Hexalen®;
- Hexamethylmelamine HMM; Hycamtin®; Hydrea®; Hydrocort Acetate®;
- Hydrocortone Phosphate Hydroxyurea; Ibrutinib; Ibritumomab; Ibritumomab Tiuxetan; Idamycin®; Idarubicin Ifex®; Interferon-alpha; lnterferon-alpha-2b (PEG Conjugate);
- IxempraTM KADCYCLA®; Kidrolase (t) Lanacort®; Lapatinib; L-asparaginase; LCR; Lenalidomide; Letrozole; Leucovorin; Leukeran; LeukineTM; Leuprolide; Leurocristine;
- LeustatinTM Lirilumab; Liposomal Ara-C; Liquid Pred®; Lomustine; L-PAM; L-
- Megestrol Acetate MEK inhibitors; Melphalan; Mercaptopurine; Mesna; MesnexTM; Methotrexate; Methotrexate Sodium; Methylprednisolone; Meticorten®; Mitomycin;
- Mitomycin-C Mitoxantrone M-Prednisol®; MTC; MTX; Mustargen®; Mustine;
- Neosar® NeulastaTM; Neumega®; Neupogen®; Nexavar®; Nilandron®; Nilotinib;
- Nilutamide Nipent®; Nitrogen Mustard Novaldex®; Nivolumab; Novantrone®; Nplate; Octreotide; Octreotide acetate; Ofatumumab; Oncospar®; Oncovin®; Ontak®; OnxalTM;
- PEMETREXED Pembrolizumab; Pentostatin; Pertuzumab; Phenylalanine Mustard; Pidilizumab; Platinol®; Platinol-AQ®; Prednisolone; Prednisone; Prelone®;
- Procarbazine PROCRIT®; Proleukin®; Prolifeprospan 20 with Carmustine Implant;
- Sandostatin® Sandostatin LAR®; Sargramostim; Solu-Cortef®; Solu-Medrol®;
- Sorafenib Sorafenib; SPRYCELTM; STI-571 ; STIVAGRATM, Streptozocin; SU 1 1248; Sunitinib;
- Temozolomide Temsirolimus; Teniposide; TESPA; Thalidomide; Thalomid®;
- TICE® Thiotepa
- ToICE® Toposar®; Topotecan; Toremifene; Torisel®; Tositumomab;
- TYKERB® Urelumab; VCR; VectibixTM; Velban®; Velcade®; Venetoclax; VePesid®; Vesanoid®; ViadurTM; Vidaza®; Vinblastine; Vinblastine Sulfate; Vincasar Pfs®;
- Zolinza or Zometa®, and/or any other agent not specifically listed here that target similar pathways.
- two or more substances or principles When two or more substances or principles are to be used as part of a combined treatment regimen, they can be administered via the same route of administration or via different routes of administration, at essentially the same time or at different times (e.g. essentially simultaneously, consecutively, or according to an alternating regime).
- the substances or principles When the substances or principles are to be administered simultaneously via the same route of administration, they may be administered as different pharmaceutical formulations or compositions or part of a combined pharmaceutical formulation or composition, as will be clear to the skilled person.
- each of the substances or principles may be administered in the same amount and according to the same regimen as used when the compound or principle is used on its own, and such combined use may or may not lead to a synergistic effect.
- the combined use of the two or more active substances or principles leads to a synergistic effect, it may also be possible to reduce the amount of one, more than one, or all of the substances or principles to be
- the effectiveness of the treatment regimen used according to the invention may be determined and/or followed in any manner known per se for the disease or disorder involved, as will be clear to the clinician. The clinician will also be able, where
- the treatment regimen will be followed until the desired therapeutic effect is achieved and/or for as long as the desired therapeutic effect is to be maintained. Again, this can be determined by the clinician.
- compositions comprising one or more CD137 receptor agonist proteins, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided herein.
- nonlimiting examples of the uses of the pharmaceutical compositions disclosed herein include diagnosing, detecting, and/or monitoring a disorder, preventing, treating, managing, and/or ameliorating a disorder or one or more symptoms thereof, and/or in research.
- the formulation of pharmaceutical compositions, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers, are known to one skilled in the art (US Patent Publication No. 2009031 1253 A1).
- the phrase "effective amount” means an amount of CD137L agonist protein that results in a detectable improvement (e.g., at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or more from baseline) in one or more parameters associated with a dysfunction of CD137L or with a CD137L-associated disease or disorder.
- Methods of administering a therapeutic agent include, but are not limited to, oral administration, parenteral administration (e.g. , intradermal, intramuscular, intraperitoneal, intravenous and subcutaneous), epidural administration, intratumoral administration, mucosal administration (e.g. , intranasal and oral routes) and pulmonary administration (e.g. , aerosolized compounds administered with an inhaler or nebulizer).
- parenteral administration e.g. , intradermal, intramuscular, intraperitoneal, intravenous and subcutaneous
- epidural administration e.g. , epidural administration
- mucosal administration e.g. , intranasal and oral routes
- pulmonary administration e.g. , aerosolized compounds administered with an inhaler or nebulizer
- dosage regimens may be adjusted to provide for an optimum desired response (e.g. , a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- parenteral compositions are formulated in dosage unit form for ease of administration and uniformity of dosage.
- dosage unit form refers to physically discrete units suited as unitary dosages for the
- each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of a CD137 receptor agonist protein provided herein is about 0.1 -100 mg/kg, (e.g. , about 0.1 -0.5, 0.1 -1 , 0.1 -10, 0.1 -20, 0.1 -50, 0.1 -75, 1 -10, 1 -15, 1-7.5, 1 .25-15, 1 .25-7.5, 2.5-7.5, 2.5-15, 5-15, 5-7.5,1 -20, 1 -50, 7-75, 1 -100, 5-10, 5-15, 5-20, 5-25, 5- 50, 5-75, 10-20, 10-50, 10-75, or 10-100 mg/kg, or any concentration in between).
- the CD137 receptor agonist protein is present in a pharmaceutical composition at a therapeutically effective concentration, e.g. , a concentration of about 0.1 -100 mg/ml (e.g. , about 0.1 -0.5, 0.1 -1 , 0.1 -10, 0.1 -20, 0.1 -50, 0.1 -75, 1 -10, 1 -20, 1 - 50, 1-75, 1 -100, 5-10, 5-15, 5-20, 5-25, 5-50, 5-75, 10-20, 10-50, 10-75, or 10-100 mg/ml, or any concentration in between).
- dosage values may vary with the type and/or severity of the condition to be alleviated.
- CD137L First soluble cytokine domain of the human CD137L ligand (CD137L, amino acid 89 - 240 of SEQ ID NO: 1).
- Second soluble cytokine domain of the human CD137L ligand (CD137L, amino acid 89 - 240 of SEQ ID NO: 1).
- CD137L Third soluble cytokine domain of the human CD137L ligand (CD137L, amino acid 89 - 240 of SEQ ID NO: 1).
- the above CD137 receptor agonist protein is shown in SEQ ID NO: 25.
- the indicated linkers may be replaced by other preferred linkers, e.g. as shown in SEQ ID NOs: 3-12.
- the indicated Hinge-linker element may be replaced by other preferred Hinge-linkers, e.g. as shown in SEQ ID NOs: 19-24.
- first and second peptide linkers do not need to be identical.
- the signal peptide sequence (A) may be replaced by any other suitable, e.g.
- the synthetic gene may be optimized in view of its codon usage for the expression in suitable host cells, e.g. insect cells or mammalian cells.
- suitable host cells e.g. insect cells or mammalian cells.
- a preferred nucleic acid sequence is shown in SEQ ID NO: 37.
- Hek293 cells are grown in DMEM + GlutaMAX (GibCo) supplemented with 10% FBS, 100 units/ml Penicillin and 100 [mu]g/ml Streptomycin and are transiently transfected with a plasmid containing an expression cassette for a fusion polypeptide and an appropriate selection marker, e.g. a functional expression cassette comprising a blasticidine, puromycin or hygromycin resistence gene.
- the expression cassettes are either combined on one plasmid or positioned on different plasmids during the transfection.
- Cell culture supernatant containing recombinant fusion polypeptide are harvested three days post transfection and clarified by centrifugation at 300 x g followed by filtration through a 0.22 pm sterile filter.
- eukaryotic expression vectors comprising appropriate selection markers (e.g. a functional expression cassette comprising a blasticidin, puromycin or hygromycin resistance gene) and genetic elements suitable to enhance the number of transcriptionally active insertion sites within the host cells genome.
- selection markers e.g. a functional expression cassette comprising a blasticidin, puromycin or hygromycin resistance gene
- the sequence verified expression vectors is introduced by electroporation into suspension adapted Chinese Hamster Ovary cells (CHO-S, Invitrogen). Appropriate selection pressure will be applied three days post-transfection to transfected cells. Surviving cells carrying the vector derived resistance gene(s) are recovered by subsequent cultivation under selection pressure.
- the basal medium is PowerCH02- CD supplemented with 4mM Glutamax.
- Wave culture is started with a viable cell concentration of 0.3 to 0.4 x 10e6 cells/ml and the following settings (for a five- or ten liter bag): shaking frequency 18rpm, shaking ankle 7°, gas current 0.2-0.3 L/min, 7% C02, 36.5°C.
- the cell culture is fed twice with PowerFeed A (Lonza), usually on day 2 (20% feed) and day 5 (30% feed). After the second feed, shaking frequency is increased to 22rpm, as well as the shaking ankle to 8°.
- PowerFeed A Longza
- the bioreactor is usually harvested in between day 7 to day 12 when the cell viability drops below 80%.
- the culture supernatant is clarified using a manual depth filtration system (Millipore Millistak Pod, MC0HC 0.054m 2 ).
- Avidin is added to a final concentration of 0.5mg/L
- the culture supernatant containing the CD137 receptor agonist fusion protein is sterile filtered using a bottle top filter (0.22pm, PES, Corning) and stored at 2-8°C until further processing.
- Streptactin Sepharose is packed to a column (gel bed 2 ml), equilibrated with 15 ml buffer W (100 mM Tris-HCI, 150 mM NaCI, pH 8.0) or PBS pH 7.4 and the cell culture supernatant is applied to the column with a flow rate of approx. 4 ml/min. Subsequently, the column is washed with 15 ml buffer W and bound polypeptide is eluted stepwise by addition of 7 x 1 ml buffer E (100 mM Tris HCI, 150 mM NaCI, 2.5 mM Desthiobiotin, pH 8.0). Alternately, PBS pH 7.4 containing 2.5 mM Desthiobiotin can be used for this step.
- 15 ml buffer W 100 mM Tris-HCI, 150 mM NaCI, pH 8.0
- PBS pH 7.4 containing 2.5 mM Desthiobiotin can be used for this step.
- the affinity purification is performed employing a column with immobilized Protein-A as affinity ligand and an Akta chromatography system (GE-Healthcare).
- the column is washed with ten column-volumes (10CV) of aforementioned equilibration buffer followed by four column-volumes (4CV) of wash-buffer-2 (20mM Pi, 95mM NaCI, pH 8.0) to deplete host-cell protein and host-cell DNA.
- the column is then eluted with elution buffer (20mM Pi, 95mM NaCI, pH 3.5) and the eluate is collected in up to ten fractions with each fraction having a volume equal to column-bed volume (5ml). Each fraction is neutralized with an equal volume of aforementioned wash-buffer-2.
- the linear velocity is set to 150cm/h and kept constant during the aforementioned affinity chromatography method.
- the protein amount of the eluate fractions is quantitated and peak fractions are concentrated by ultrafiltration and further purified by size exclusion chromatography (SEC).
- SEC is performed on Superdex 200 10/300 GL or HiLoad 26/60 columns using an Akta chromatography system (GE-Healthcare).
- the columns are equilibrated with phosphate buffered saline and the concentrated, affinity-purified polypeptide is loaded onto the SEC column with the sample volume not exceeding 2 % (v/v) of the column-volume.
- a flow rate of 0.5ml per minute is applied.
- HiLoad 26/60 Superdex200 columns a flow rate of 2.5 ml per minute is applied.
- the elution profile of the polypeptide is monitored by absorbance at 280 nm.
- a Superdex 200 column is loaded with standard proteins of known molecular weight. Based on the elution volume of the standard proteins a calibration curve is plotted and the molecular weight of purified fusion polypeptide is determined.
- the FC-domain comprising CD137 receptor agonist fusion proteins elutes from the Superdex200 columns with an apparent molecular weight of approx. 140-180 kDa, which would confirm the homodimerization of the mature CD137 receptor agonist fusion polypeptide by the Fc domain.
- homo-trimeric trivalent CD137 receptor agonist fusion proteins stabilized with bacteriophage RB69-FOLDON is expressed in CHO-S cells and purified as described in the former section. The sequence is shown in the table below:
- Example 4 Determination of the in vitro stability of CD137 receptor agonist proteins by limited protease digestion
- CD137 receptor agonist proteins to be investigated will be expressed and purified as hexavalent Fc-Fusion protein as described in Example 1.
- the set will include CD137 receptor agonist proteins comprising the N297S mutation [according to the EU numbering system] in the CH2-domain and a hinge region that enables the formation of three disulfide bridges and additionally lack the upper hinge lysine [K223, according to the EU numbering system] which is mutated to glycine [K223G].
- CD137 receptor agonist proteins comprising the N297S mutation and the K223G mutation simultaneously in context of a three disulfide enabling hinge will be compared to CD137 receptor agonist proteins comprising the N297S mutation but have the K223 wildtype present either in the context of a two disulfide or three disulfide enabling hinge region.
- CD137 receptor agonist proteins with the second linker element (iv) reduced to 4 amino-acids and the shortened hinge element (vi) will be investigated (e.g. SEQ ID NO: 32 and 34).
- Both engineering strategies (N297S combined with K223G mutation in context of a three disulfide enabling hinge region) and shortage of linker elements (iv and vi) have a potential impact on the stability of the respective molecules.
- CD137 agonistic proteins of the present invention can be addressed by limited protease digestion in vitro.
- the aforementioned CD137 receptor agonist proteins are incubated with low concentrations of proteases (e.g. Trypsin, V8 protease) at different temperatures (e.g. 4°C, 25°C, 37°C) for different amounts of time.
- proteases e.g. Trypsin, V8 protease
- temperatures e.g. 4°C, 25°C, 37°C
- Quantification of specific proteolytic fragments and their appearance over time can be subsequently measured by different methods, like SDS-PAGE, analytical SEC or analytical Mass-Spectrometry methods known in the art (e.g Nano- RP-HPLC-ESI-MSMS).
- proteolytic stability As the investigated proteins have most of their sequences in common, the faster appearance and enlarged quantities of specific proteolytic fragments from individual proteins over time can then be used to judge their relative stability and rank them to each other. With regard to protease based decoy kinetics of the aforementioned CD137 receptor agonist proteins investigated, the following order regarding their proteolytic stability is to be expected:
- the CD137 receptor agonist proteins comprising the N297S and the K223G and the three disulfide enabling hinge region simultaneously have a prolonged stability as compared to the CD137 receptor agonist proteins comprising the N297S and wildtype K223 in the hinge region.
- the CD137 receptor agonist proteins comprising the SEQ ID NO: 21 as hinge linker have a prolonged stability as compared to CD137 receptor agonist proteins comprising the SEQ ID NO: 16 as hinge linker element.
- the contents of monomers and aggregates are determined by analytical SEC as described in Example 2.
- the analysis is performed in buffers containing physiological salt concentrations at physiological pH (e.g. 0.9% NaCI, pH 7.4; PBS pH 7.4).
- physiological salt concentrations e.g. 0.9% NaCI, pH 7.4; PBS pH 7.4
- a typical aggregation analysis is done on a Superdex200 column (GE Healthcare). This column separates proteins in the range between 10 to 800 kDa.
- a Superdex 200 column is loaded with standard proteins of known molecular weight. Based on the elution volume of the standard proteins a calibration curve is plotted and the apparent molecular weight of purified fusion proteins of unknown molecular weight is calculated based on the elution volume.
- SEC analysis of soluble, non-aggregated protein typically shows a distinct single protein peak at a defined elution volume (measured at OD at 280nm or at OD 214nm ). This elution volume corresponds to the apparent native molecular weight of the particular protein.
- CD137 receptor agonist fusion proteins should preferably contain only defined monomeric protein and only a very low amount of oligomeric protein.
- the degree of aggregation/oligomerization of a particular CD137 receptor agonist fusion protein preparation is determined on basis of the SEC analysis by calculating the peak areas of the OD280 diagram for the defined monomer and the oligomer/aggregate fraction, respectively.. Based on the total peak area the percentage of defined monomer protein is calculated as follows:
- the equilibrium binding constants (K D ) of trivalent and hexavalent constructs of CD137 receptor ligand are calculated based on kinetic binding data (k on and k 0f r) that are determined with an automated biosensor system (Attana A100).
- the A100 allows to investigate molecular interactions in real-time based on the Quartz Crystal Microbalance (QCM) technique.
- QCM Quartz Crystal Microbalance
- the human CD137 receptor is immobilized to the surface of a carboxyl- activated QCM-chip.
- the tri- or hexavalent CD137 receptor ligand, respectively is used as an analyte at different concentrations (e.g.
- KD k 0 ff/ k on .
- the QCM analysis shows that the trivalent CD137 receptor ligand binds to the respective immobilized CD137 receptor with a KD in the low nM-range with an expected KD of 1 - 500nM.
- hexavalent constructs of CD137 receptor ligand show a higher binding affinity in the pM-range towards the respective immobilized CD 37 receptor with an expected K D of 1pM - 500 nM.
- a common characteristic of the kinetic binding data (k on and k 0 ff) is that the hexavalent constructs show faster k on in
- T cells are purified from human buffy coat preparations by negative selection using magnetic beads.
- Cells are labeled with CFSE and incubated with or without varying amounts of the CD137 receptor agonist and combined with an anti-human CD3 antibody for 2-5 days at 37° C.
- Data on CFSE dilution as a means to measure cell division is acquired on a flow cytometer.
- IFNy production is measured by an ELISA assay using cell culture supernatants and an anti-human IFNy antibody for capture.
- human T cells are isolated from fresh buffy coat preparations using negative selection and magnetic beads. Cells are seeded into 24-well plates at 2x10e6 cells per well. T cells are incubated with an anti-human CD3 antibody (clone HIT3a, 1 pg/ml), anti- human CD28 antibody (clone CD28.2, 5 ⁇ g/ml) and varying amounts of Protein A
- CD137L (CD137L, 10-1000ng/ml) or simply left in medium as control. After 3 days at 37°C cells are fluorescently labeled with anti-human CD137 and anti-human CD4 or anti-human CD8 antibodies. CD137 fluorescence is assessed on a guava easyCyte flow cytometer within CD4+ and CD8+ T cell populations.
- Total T cells (human) purified by negative selection and magnetic beads (pan T cell isolation kit, Miltenyi Biotec) from the peripheral blood of healthy donors and stained with CFSE (CellTraceTM CFSE Cell Proliferation Kit, for flow cytometry, ThermoFisher) and seeded into 24-well plates at 2x10e6 cells per well.
- Cells were incubated at 37°C for 5 days with media alone, soluble anti-CD3 antibody (clone OKT3 at 1 pg/ml) alone, anti-CD3 antibody plus anti-CD28 antibody (clone 28.2 at I pg/rnl) or anti-CD3 antibody plus mature Protein A (SEQ ID NO: 27) at 10, 100 or 1000 ng/ml, respectively.
- CD137 receptor agonist protein of the invention For ELISA assays assessing functional binding of CD137 receptor agonist protein of the invention to its corresponding receptor, coating of microtiter plates was performed with 1 pg/ml CD137-Fc (Bio-Techne GmbH, Wiesbaden-Nordenstadt, Germany). After blocking with StartingBlock (Life Technologies GmbH, Darmstadt, Germany), wells were incubated with indicated concentrations of strep-tagged Protein A (SEQ ID NO: 28).
- Binding to its corresponding receptor was detected via its Strep Tag II employing the anti-StrepTag-peroxidase StrepTactin-HRP (1 :5000, IBA GmbH, Goettingen, Germany) and subsequent detection of the converted Peroxidase-substrate TMB one (Kem-En- Tec Diagnostics, Taastrup, Denmark) at a wavelength of 450 nm in an ELISA reader.
- Fig. 6 clearly depicts concentration dependent binding of Protein A to its receptor.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Oncology (AREA)
- Rheumatology (AREA)
- Hematology (AREA)
- Pain & Pain Management (AREA)
- Peptides Or Proteins (AREA)
- Communicable Diseases (AREA)
- Diabetes (AREA)
- Transplantation (AREA)
- Obesity (AREA)
- Physical Education & Sports Medicine (AREA)
- Neurology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3002588A CA3002588C (en) | 2015-10-23 | 2016-10-24 | Single-chain cd137-receptor agonist proteins |
| AU2016341400A AU2016341400B2 (en) | 2015-10-23 | 2016-10-24 | Single-chain CD137-receptor agonist proteins |
| EP16787795.0A EP3365448A1 (en) | 2015-10-23 | 2016-10-24 | Single-chain cd137-receptor agonist proteins |
| JP2018521279A JP7033062B2 (ja) | 2015-10-23 | 2016-10-24 | 一本鎖cd137受容体アゴニストタンパク質 |
| CN201680073663.3A CN108368511B (zh) | 2015-10-23 | 2016-10-24 | 单链cd137受体激动剂蛋白 |
| US15/955,086 US10870688B2 (en) | 2015-10-23 | 2018-04-17 | Single-chain CD137-receptor agonist proteins |
| US17/128,678 US20210246190A1 (en) | 2015-10-23 | 2020-12-21 | Single-chain cd137-receptor agonist proteins |
| AU2021203792A AU2021203792A1 (en) | 2015-10-23 | 2021-06-09 | Single-chain CD137-receptor agonist proteins |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562245838P | 2015-10-23 | 2015-10-23 | |
| US62/245,838 | 2015-10-23 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/955,086 Continuation US10870688B2 (en) | 2015-10-23 | 2018-04-17 | Single-chain CD137-receptor agonist proteins |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017068183A1 true WO2017068183A1 (en) | 2017-04-27 |
Family
ID=57208274
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/075543 Ceased WO2017068183A1 (en) | 2015-10-23 | 2016-10-24 | Single-chain cd137-receptor agonist proteins |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US10870688B2 (https=) |
| EP (1) | EP3365448A1 (https=) |
| JP (1) | JP7033062B2 (https=) |
| CN (1) | CN108368511B (https=) |
| AU (2) | AU2016341400B2 (https=) |
| CA (1) | CA3002588C (https=) |
| WO (1) | WO2017068183A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021229103A2 (en) | 2020-05-15 | 2021-11-18 | Apogenix Ag | Multi-specific immune modulators |
| WO2023088889A1 (en) | 2021-11-16 | 2023-05-25 | Apogenix Ag | CD137 ligands |
| WO2023088876A1 (en) | 2021-11-16 | 2023-05-25 | Apogenix Ag | Multi-specific immune modulators |
| WO2024088404A1 (en) * | 2022-10-28 | 2024-05-02 | Fbd Biologics Limited | Engineered 4-1bbl variants and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX395639B (es) | 2017-01-20 | 2025-03-25 | Heidelberg Pharma Res Gmbh | Composiciones y métodos para el agotamiento de células cd137+. |
| WO2019109238A1 (en) | 2017-12-05 | 2019-06-13 | Lyvgen Biopharma Co., Ltd. | Anti-cd137 antibodies and uses thereof |
| WO2020069382A1 (en) * | 2018-09-28 | 2020-04-02 | Lyvgen Biopharma Co., Ltd. | Anti-cd137 binding molecules having engineered fc domains and therapeutic uses thereof |
| WO2020231809A1 (en) | 2019-05-10 | 2020-11-19 | Lyvgen Biopharma Co., Ltd. | Humanized anti-cd137 antibodies and uses thereof |
| KR102251580B1 (ko) * | 2020-08-14 | 2021-05-13 | 최상호 | 이중 보온관 접속용 레듀사 및 이를 이용한 시공방법 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030223989A1 (en) * | 2002-04-18 | 2003-12-04 | Pluenneke John D. | CD137 agonists to treat patients with IgE-mediated conditions |
| WO2010010051A1 (en) * | 2008-07-21 | 2010-01-28 | Apogenix Gmbh | Tnfsf single chain molecules |
| WO2012130471A1 (en) * | 2011-04-01 | 2012-10-04 | Universität Stuttgart | Recombinant tnf ligand family member polypeptides with antibody binding domain and uses thereof |
| WO2013092983A2 (en) * | 2011-12-23 | 2013-06-27 | Innate Pharma | Enzymatic conjugation of polypeptides |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1107989B1 (en) * | 1998-08-25 | 2010-03-31 | Merck Patent GmbH | Expression and export of angiostatin and endostatin as immunofusins |
| JP2008537941A (ja) | 2005-03-31 | 2008-10-02 | ゼンコー・インコーポレイテッド | 最適化特性を有するFc変異体 |
| CA2822366A1 (en) | 2010-12-23 | 2012-06-28 | Janssen Biotech, Inc. | Active protease-resistant antibody fc mutants |
| CN108430492B (zh) | 2015-10-23 | 2022-05-03 | 阿珀吉科吉尼科斯股份公司 | 单链cd27受体激动剂蛋白 |
| AU2016342420B2 (en) | 2015-10-23 | 2020-10-01 | Apogenix Ag | Single-chain LIGHT receptor agonist proteins |
-
2016
- 2016-10-24 WO PCT/EP2016/075543 patent/WO2017068183A1/en not_active Ceased
- 2016-10-24 CA CA3002588A patent/CA3002588C/en active Active
- 2016-10-24 CN CN201680073663.3A patent/CN108368511B/zh not_active Expired - Fee Related
- 2016-10-24 AU AU2016341400A patent/AU2016341400B2/en not_active Ceased
- 2016-10-24 EP EP16787795.0A patent/EP3365448A1/en not_active Withdrawn
- 2016-10-24 JP JP2018521279A patent/JP7033062B2/ja not_active Expired - Fee Related
-
2018
- 2018-04-17 US US15/955,086 patent/US10870688B2/en not_active Expired - Fee Related
-
2020
- 2020-12-21 US US17/128,678 patent/US20210246190A1/en not_active Abandoned
-
2021
- 2021-06-09 AU AU2021203792A patent/AU2021203792A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030223989A1 (en) * | 2002-04-18 | 2003-12-04 | Pluenneke John D. | CD137 agonists to treat patients with IgE-mediated conditions |
| WO2010010051A1 (en) * | 2008-07-21 | 2010-01-28 | Apogenix Gmbh | Tnfsf single chain molecules |
| WO2012130471A1 (en) * | 2011-04-01 | 2012-10-04 | Universität Stuttgart | Recombinant tnf ligand family member polypeptides with antibody binding domain and uses thereof |
| WO2013092983A2 (en) * | 2011-12-23 | 2013-06-27 | Innate Pharma | Enzymatic conjugation of polypeptides |
Non-Patent Citations (2)
| Title |
|---|
| RABU CATHERINE ET AL: "Production of recombinant human trimeric CD137L (4-1BBL) - Cross-linking is essential to its T cell co-stimulation activity", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 280, no. 50, 1 December 2005 (2005-12-01), AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, US, pages 41472 - 41481, XP002456297, ISSN: 0021-9258, DOI: 10.1074/JBC.M506881200 * |
| WON EUN-YOUNG ET AL: "The Structure of the Trimer of Human 4-1BB Ligand Is Unique among Members of the Tumor Necrosis Factor Superfamily (includes Supplementary information)", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 285, no. 12, 19 March 2010 (2010-03-19), pages 9202 - 9210+5PP, XP002765867, ISSN: 0021-9258, DOI: 10.1074/jbc.M109.084442 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021229103A2 (en) | 2020-05-15 | 2021-11-18 | Apogenix Ag | Multi-specific immune modulators |
| WO2023088889A1 (en) | 2021-11-16 | 2023-05-25 | Apogenix Ag | CD137 ligands |
| WO2023088876A1 (en) | 2021-11-16 | 2023-05-25 | Apogenix Ag | Multi-specific immune modulators |
| WO2024088404A1 (en) * | 2022-10-28 | 2024-05-02 | Fbd Biologics Limited | Engineered 4-1bbl variants and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210246190A1 (en) | 2021-08-12 |
| JP7033062B2 (ja) | 2022-03-09 |
| AU2016341400A1 (en) | 2018-05-10 |
| CA3002588C (en) | 2021-11-23 |
| AU2021203792A1 (en) | 2021-07-08 |
| JP2019500850A (ja) | 2019-01-17 |
| CA3002588A1 (en) | 2017-04-27 |
| CN108368511B (zh) | 2022-12-06 |
| EP3365448A1 (en) | 2018-08-29 |
| CN108368511A (zh) | 2018-08-03 |
| AU2016341400B2 (en) | 2021-04-08 |
| US10870688B2 (en) | 2020-12-22 |
| US20180237495A1 (en) | 2018-08-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2018271369B2 (en) | Single-chain TRAIL-receptor agonist proteins | |
| US10793616B2 (en) | Single-chain CD40-receptor agonist proteins | |
| US10870688B2 (en) | Single-chain CD137-receptor agonist proteins | |
| US10844108B2 (en) | Single-chain CD27-receptor agonist proteins | |
| US10683332B2 (en) | Single-chain light receptor agonist proteins | |
| US11149075B2 (en) | Single-chain glucocorticoid-induced tumor necrosis factor receptor (GITR) receptor agonist proteins | |
| US10683338B2 (en) | Single-chain TL1A receptor agonist proteins | |
| US20180230196A1 (en) | Single-chain ox40-receptor agonist proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16787795 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3002588 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018521279 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016341400 Country of ref document: AU Date of ref document: 20161024 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016787795 Country of ref document: EP |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2016787795 Country of ref document: EP |