WO2017004167A1 - Methods and compositions for treating cancer - Google Patents
Methods and compositions for treating cancer Download PDFInfo
- Publication number
- WO2017004167A1 WO2017004167A1 PCT/US2016/040039 US2016040039W WO2017004167A1 WO 2017004167 A1 WO2017004167 A1 WO 2017004167A1 US 2016040039 W US2016040039 W US 2016040039W WO 2017004167 A1 WO2017004167 A1 WO 2017004167A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- subject
- tumor
- chemotherapeutic agent
- administered
- pten
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 267
- 238000000034 method Methods 0.000 title claims abstract description 120
- 201000011510 cancer Diseases 0.000 title claims abstract description 94
- 239000000203 mixture Substances 0.000 title abstract description 32
- 229940123940 PTEN inhibitor Drugs 0.000 claims abstract description 182
- 239000002246 antineoplastic agent Substances 0.000 claims abstract description 144
- 229940127089 cytotoxic agent Drugs 0.000 claims abstract description 144
- 229960005486 vaccine Drugs 0.000 claims abstract description 113
- 239000000427 antigen Substances 0.000 claims abstract description 63
- 108091007433 antigens Proteins 0.000 claims abstract description 63
- 102000036639 antigens Human genes 0.000 claims abstract description 63
- 230000002829 reductive effect Effects 0.000 claims description 28
- 150000007523 nucleic acids Chemical class 0.000 claims description 26
- 230000000118 anti-neoplastic effect Effects 0.000 claims description 25
- 239000003112 inhibitor Substances 0.000 claims description 25
- 102000039446 nucleic acids Human genes 0.000 claims description 18
- 108020004707 nucleic acids Proteins 0.000 claims description 18
- -1 ethyl- Chemical group 0.000 claims description 17
- 201000001441 melanoma Diseases 0.000 claims description 11
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 8
- 150000003384 small molecules Chemical group 0.000 claims description 8
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 7
- 206010006187 Breast cancer Diseases 0.000 claims description 7
- 208000026310 Breast neoplasm Diseases 0.000 claims description 7
- 208000020816 lung neoplasm Diseases 0.000 claims description 7
- 108090000623 proteins and genes Proteins 0.000 claims description 7
- 101710117072 Dual specificity protein phosphatase Proteins 0.000 claims description 6
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 6
- RQQIRMLGKSPXSE-WIPMOJCBSA-N [1-acetyloxy-2-[[(2s,3r,5s,6s)-2,6-dihydroxy-3,4,5-triphosphonooxycyclohexyl]oxy-hydroxyphosphoryl]oxyethyl] acetate Chemical compound CC(=O)OC(OC(C)=O)COP(O)(=O)OC1[C@H](O)[C@H](OP(O)(O)=O)C(OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H]1O RQQIRMLGKSPXSE-WIPMOJCBSA-N 0.000 claims description 6
- 208000029742 colonic neoplasm Diseases 0.000 claims description 6
- 201000002528 pancreatic cancer Diseases 0.000 claims description 6
- 102000004169 proteins and genes Human genes 0.000 claims description 6
- 208000037841 lung tumor Diseases 0.000 claims description 5
- 229910052720 vanadium Inorganic materials 0.000 claims description 5
- LEONUFNNVUYDNQ-UHFFFAOYSA-N vanadium atom Chemical group [V] LEONUFNNVUYDNQ-UHFFFAOYSA-N 0.000 claims description 5
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 3
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- XAKAQCMEMMZUEO-UHFFFAOYSA-N chembl1256623 Chemical compound O=NN(C)C1=CC=C(O)C(O)=C1 XAKAQCMEMMZUEO-UHFFFAOYSA-N 0.000 claims description 3
- VZQDDSYKVYARDW-UHFFFAOYSA-N n-(9,10-dioxophenanthren-2-yl)-2,2-dimethylpropanamide Chemical group C1=CC=C2C3=CC=C(NC(=O)C(C)(C)C)C=C3C(=O)C(=O)C2=C1 VZQDDSYKVYARDW-UHFFFAOYSA-N 0.000 claims description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 2
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 claims 4
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 claims 4
- 230000000973 chemotherapeutic effect Effects 0.000 abstract description 22
- 230000028993 immune response Effects 0.000 abstract description 14
- 230000001225 therapeutic effect Effects 0.000 abstract description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 53
- 238000002512 chemotherapy Methods 0.000 description 48
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 46
- 102000014160 PTEN Phosphohydrolase Human genes 0.000 description 46
- 108010011536 PTEN Phosphohydrolase Proteins 0.000 description 46
- 238000011282 treatment Methods 0.000 description 42
- 210000004027 cell Anatomy 0.000 description 41
- 102000004196 processed proteins & peptides Human genes 0.000 description 40
- 229920001184 polypeptide Polymers 0.000 description 37
- 210000001744 T-lymphocyte Anatomy 0.000 description 35
- 239000003795 chemical substances by application Substances 0.000 description 33
- 230000000694 effects Effects 0.000 description 32
- 208000001088 cerebrotendinous xanthomatosis Diseases 0.000 description 31
- 210000004443 dendritic cell Anatomy 0.000 description 29
- 235000001014 amino acid Nutrition 0.000 description 27
- 241000699670 Mus sp. Species 0.000 description 26
- 150000001413 amino acids Chemical class 0.000 description 26
- 229940024606 amino acid Drugs 0.000 description 25
- 239000003446 ligand Substances 0.000 description 24
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 23
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 21
- 229960004397 cyclophosphamide Drugs 0.000 description 19
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 17
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 17
- 238000002474 experimental method Methods 0.000 description 17
- 230000009467 reduction Effects 0.000 description 16
- 210000003289 regulatory T cell Anatomy 0.000 description 16
- 208000024891 symptom Diseases 0.000 description 16
- 230000014509 gene expression Effects 0.000 description 15
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 14
- 239000005557 antagonist Substances 0.000 description 14
- 239000003814 drug Substances 0.000 description 14
- 230000004044 response Effects 0.000 description 14
- 108010074708 B7-H1 Antigen Proteins 0.000 description 13
- 239000002671 adjuvant Substances 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 108010058846 Ovalbumin Proteins 0.000 description 12
- 230000002401 inhibitory effect Effects 0.000 description 12
- 230000019491 signal transduction Effects 0.000 description 12
- 239000013543 active substance Substances 0.000 description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 10
- 101100182715 Mus musculus Ly6c2 gene Proteins 0.000 description 10
- 230000000259 anti-tumor effect Effects 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 239000012634 fragment Substances 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 229940092253 ovalbumin Drugs 0.000 description 10
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 9
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 9
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 9
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 9
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- VDABVNMGKGUPEY-UHFFFAOYSA-N 6-carboxyfluorescein succinimidyl ester Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O VDABVNMGKGUPEY-UHFFFAOYSA-N 0.000 description 8
- 206010025323 Lymphomas Diseases 0.000 description 8
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 8
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 8
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 230000004913 activation Effects 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- 229960001101 ifosfamide Drugs 0.000 description 7
- 231100000682 maximum tolerated dose Toxicity 0.000 description 7
- 239000008194 pharmaceutical composition Substances 0.000 description 7
- 230000009038 pharmacological inhibition Effects 0.000 description 7
- 229960004964 temozolomide Drugs 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- 231100000419 toxicity Toxicity 0.000 description 7
- 230000001988 toxicity Effects 0.000 description 7
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 6
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 6
- DGEZNRSVGBDHLK-UHFFFAOYSA-N [1,10]phenanthroline Chemical compound C1=CN=C2C3=NC=CC=C3C=CC2=C1 DGEZNRSVGBDHLK-UHFFFAOYSA-N 0.000 description 6
- 125000000217 alkyl group Chemical group 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 6
- 229960005420 etoposide Drugs 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 229960005277 gemcitabine Drugs 0.000 description 6
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 5
- ROFVEXUMMXZLPA-UHFFFAOYSA-N Bipyridyl Chemical compound N1=CC=CC=C1C1=CC=CC=N1 ROFVEXUMMXZLPA-UHFFFAOYSA-N 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 102000001398 Granzyme Human genes 0.000 description 5
- 108060005986 Granzyme Proteins 0.000 description 5
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 5
- 208000006552 Lewis Lung Carcinoma Diseases 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 5
- 229960004562 carboplatin Drugs 0.000 description 5
- 229960003668 docetaxel Drugs 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 108010002350 Interleukin-2 Proteins 0.000 description 4
- 102000000588 Interleukin-2 Human genes 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- 229930012538 Paclitaxel Natural products 0.000 description 4
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 4
- 102000002689 Toll-like receptor Human genes 0.000 description 4
- 108020000411 Toll-like receptor Proteins 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 230000000692 anti-sense effect Effects 0.000 description 4
- 229940044683 chemotherapy drug Drugs 0.000 description 4
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 4
- 229960004316 cisplatin Drugs 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 4
- 229960004679 doxorubicin Drugs 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 208000032839 leukemia Diseases 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 210000001165 lymph node Anatomy 0.000 description 4
- 229960001756 oxaliplatin Drugs 0.000 description 4
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 4
- 229960001592 paclitaxel Drugs 0.000 description 4
- 230000000144 pharmacologic effect Effects 0.000 description 4
- 239000011591 potassium Substances 0.000 description 4
- 229910052700 potassium Inorganic materials 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 229960003787 sorafenib Drugs 0.000 description 4
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 4
- XETCRXVKJHBPMK-MJSODCSWSA-N trehalose 6,6'-dimycolate Chemical compound C([C@@H]1[C@H]([C@H](O)[C@@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](COC(=O)C(CCCCCCCCCCC3C(C3)CCCCCCCCCCCCCCCCCC)C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)O2)O)O1)O)OC(=O)C(C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)CCCCCCCCCCC1CC1CCCCCCCCCCCCCCCCCC XETCRXVKJHBPMK-MJSODCSWSA-N 0.000 description 4
- 229960000875 trofosfamide Drugs 0.000 description 4
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 108090001005 Interleukin-6 Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 229940124060 PD-1 antagonist Drugs 0.000 description 3
- YNPNZTXNASCQKK-UHFFFAOYSA-N Phenanthrene Natural products C1=CC=C2C3=CC=CC=C3C=CC2=C1 YNPNZTXNASCQKK-UHFFFAOYSA-N 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 108020004459 Small interfering RNA Proteins 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 210000005006 adaptive immune system Anatomy 0.000 description 3
- 229940009456 adriamycin Drugs 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 239000002168 alkylating agent Substances 0.000 description 3
- 230000001093 anti-cancer Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 229950011595 glufosfamide Drugs 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 230000002452 interceptive effect Effects 0.000 description 3
- 230000002601 intratumoral effect Effects 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229950009351 perfosfamide Drugs 0.000 description 3
- VPAWVRUHMJVRHU-VGDKGRGNSA-N perfosfamide Chemical compound OO[C@@H]1CCO[P@@](=O)(N(CCCl)CCCl)N1 VPAWVRUHMJVRHU-VGDKGRGNSA-N 0.000 description 3
- CUQCMXFWIMOWRP-UHFFFAOYSA-N phenyl biguanide Chemical compound NC(N)=NC(N)=NC1=CC=CC=C1 CUQCMXFWIMOWRP-UHFFFAOYSA-N 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 229940044551 receptor antagonist Drugs 0.000 description 3
- 239000002464 receptor antagonist Substances 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000011269 treatment regimen Methods 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 229960003048 vinblastine Drugs 0.000 description 3
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 3
- 229960004528 vincristine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 3
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- JVJGCCBAOOWGEO-RUTPOYCXSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-4-amino-2-[[(2s,3s)-2-[[(2s,3s)-2-[[(2s)-2-azaniumyl-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxylatobutanoyl]amino]-6-azaniumy Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 JVJGCCBAOOWGEO-RUTPOYCXSA-N 0.000 description 2
- PSVUJBVBCOISSP-SPFKKGSWSA-N (2s,3r,4s,5s,6r)-2-bis(2-chloroethylamino)phosphoryloxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@@H](OP(=O)(NCCCl)NCCCl)[C@H](O)[C@@H](O)[C@@H]1O PSVUJBVBCOISSP-SPFKKGSWSA-N 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- 0 *c1ccnc(-c2cc(*)ccn2)c1 Chemical compound *c1ccnc(-c2cc(*)ccn2)c1 0.000 description 2
- PBUUPFTVAPUWDE-UGZDLDLSSA-N 2-[[(2S,4S)-2-[bis(2-chloroethyl)amino]-2-oxo-1,3,2lambda5-oxazaphosphinan-4-yl]sulfanyl]ethanesulfonic acid Chemical compound OS(=O)(=O)CCS[C@H]1CCO[P@](=O)(N(CCCl)CCCl)N1 PBUUPFTVAPUWDE-UGZDLDLSSA-N 0.000 description 2
- ZZVDXRCAGGQFAK-UHFFFAOYSA-N 2h-oxazaphosphinine Chemical class N1OC=CC=P1 ZZVDXRCAGGQFAK-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- QMGUSPDJTPDFSF-UHFFFAOYSA-N Aldophosphamide Chemical compound ClCCN(CCCl)P(=O)(N)OCCC=O QMGUSPDJTPDFSF-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 108010040721 Flagellin Proteins 0.000 description 2
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 2
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 108090000171 Interleukin-18 Proteins 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 101150073900 PTEN gene Proteins 0.000 description 2
- 102100032543 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Human genes 0.000 description 2
- 101710132081 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Proteins 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 230000017274 T cell anergy Effects 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000033289 adaptive immune response Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 2
- 229940037003 alum Drugs 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 210000002469 basement membrane Anatomy 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229960005243 carmustine Drugs 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 229940030156 cell vaccine Drugs 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000012829 chemotherapy agent Substances 0.000 description 2
- 238000011260 co-administration Methods 0.000 description 2
- 210000002808 connective tissue Anatomy 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- KCIDZIIHRGYJAE-YGFYJFDDSA-L dipotassium;[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] phosphate Chemical compound [K+].[K+].OC[C@H]1O[C@H](OP([O-])([O-])=O)[C@H](O)[C@@H](O)[C@H]1O KCIDZIIHRGYJAE-YGFYJFDDSA-L 0.000 description 2
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229960000908 idarubicin Drugs 0.000 description 2
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 2
- 229960002411 imatinib Drugs 0.000 description 2
- 230000037451 immune surveillance Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 229960003881 letrozole Drugs 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 229950000547 mafosfamide Drugs 0.000 description 2
- 229940107698 malachite green Drugs 0.000 description 2
- FDZZZRQASAIRJF-UHFFFAOYSA-M malachite green Chemical compound [Cl-].C1=CC(N(C)C)=CC=C1C(C=1C=CC=CC=1)=C1C=CC(=[N+](C)C)C=C1 FDZZZRQASAIRJF-UHFFFAOYSA-M 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 229960002340 pentostatin Drugs 0.000 description 2
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 108700002563 poly ICLC Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 229940068968 polysorbate 80 Drugs 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000009021 pre-vaccination Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 2
- 229960000624 procarbazine Drugs 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000000284 resting effect Effects 0.000 description 2
- 229930182490 saponin Natural products 0.000 description 2
- 150000007949 saponins Chemical class 0.000 description 2
- 235000017709 saponins Nutrition 0.000 description 2
- 229960000714 sipuleucel-t Drugs 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 2
- 229960001796 sunitinib Drugs 0.000 description 2
- 229960001278 teniposide Drugs 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- LSGOVYNHVSXFFJ-UHFFFAOYSA-N vanadate(3-) Chemical compound [O-][V]([O-])([O-])=O LSGOVYNHVSXFFJ-UHFFFAOYSA-N 0.000 description 2
- CQEQYBJQFPXKPE-AWEZNQCLSA-N (2s)-3-(2-bromoethyl)-n-(2-chloroethyl)-2-oxo-1,3,2$l^{5}-oxazaphosphinan-2-amine Chemical compound ClCCN[P@]1(=O)OCCCN1CCBr CQEQYBJQFPXKPE-AWEZNQCLSA-N 0.000 description 1
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 1
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- OGYGFUAIIOPWQD-UHFFFAOYSA-N 1,3-thiazolidine Chemical compound C1CSCN1 OGYGFUAIIOPWQD-UHFFFAOYSA-N 0.000 description 1
- HJTAZXHBEBIQQX-UHFFFAOYSA-N 1,5-bis(chloromethyl)naphthalene Chemical compound C1=CC=C2C(CCl)=CC=CC2=C1CCl HJTAZXHBEBIQQX-UHFFFAOYSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- BFPYWIDHMRZLRN-UHFFFAOYSA-N 17alpha-ethynyl estradiol Natural products OC1=CC=C2C3CCC(C)(C(CC4)(O)C#C)C4C3CCC2=C1 BFPYWIDHMRZLRN-UHFFFAOYSA-N 0.000 description 1
- GCKMFJBGXUYNAG-UHFFFAOYSA-N 17alpha-methyltestosterone Natural products C1CC2=CC(=O)CCC2(C)C2C1C1CCC(C)(O)C1(C)CC2 GCKMFJBGXUYNAG-UHFFFAOYSA-N 0.000 description 1
- JTTIOYHBNXDJOD-UHFFFAOYSA-N 2,4,6-triaminopyrimidine Chemical compound NC1=CC(N)=NC(N)=N1 JTTIOYHBNXDJOD-UHFFFAOYSA-N 0.000 description 1
- HGLRIYIVJRXBQM-UHFFFAOYSA-N 2-[2-[amino-[bis(2-chloroethyl)amino]phosphoryl]oxyethyl]-1,3-thiazinane-4-carboxylic acid Chemical compound ClCCN(CCCl)P(=O)(N)OCCC1NC(C(O)=O)CCS1 HGLRIYIVJRXBQM-UHFFFAOYSA-N 0.000 description 1
- KEPIZHRUELMLLO-UHFFFAOYSA-N 2-[2-[amino-[bis(2-chloroethyl)amino]phosphoryl]oxyethyl]-1,3-thiazolidine-4-carboxylic acid Chemical compound ClCCN(CCCl)P(=O)(N)OCCC1NC(C(O)=O)CS1 KEPIZHRUELMLLO-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- RHKWIGHJGOEUSM-UHFFFAOYSA-N 3h-imidazo[4,5-h]quinoline Chemical class C1=CN=C2C(N=CN3)=C3C=CC2=C1 RHKWIGHJGOEUSM-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- WVKOPZMDOFGFAK-UHFFFAOYSA-N 4-hydroperoxycyclophosphamide Chemical compound OOC1=NP(O)(N(CCCl)CCCl)OCC1 WVKOPZMDOFGFAK-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- 229940080778 Adenosine deaminase inhibitor Drugs 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 244000118350 Andrographis paniculata Species 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 229940122815 Aromatase inhibitor Drugs 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 108010035053 B7-1 Antigen Proteins 0.000 description 1
- 102000038504 B7-1 Antigen Human genes 0.000 description 1
- 241000219198 Brassica Species 0.000 description 1
- 235000003351 Brassica cretica Nutrition 0.000 description 1
- 235000003343 Brassica rupestris Nutrition 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- LTKHPMDRMUCUEB-IBGZPJMESA-N CB3717 Chemical compound C=1C=C2NC(N)=NC(=O)C2=CC=1CN(CC#C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 LTKHPMDRMUCUEB-IBGZPJMESA-N 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 101100327537 Caenorhabditis elegans cgp-1 gene Proteins 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 101150073133 Cpt1a gene Proteins 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- BFPYWIDHMRZLRN-SLHNCBLASA-N Ethinyl estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 229940123414 Folate antagonist Drugs 0.000 description 1
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 1
- 101000609762 Gallus gallus Ovalbumin Proteins 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000724418 Homo sapiens Neutral amino acid transporter B(0) Proteins 0.000 description 1
- 101001117312 Homo sapiens Programmed cell death 1 ligand 2 Proteins 0.000 description 1
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000926525 Homo sapiens eIF-2-alpha kinase GCN2 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000001974 Hyaluronidases Human genes 0.000 description 1
- DOMWKUIIPQCAJU-LJHIYBGHSA-N Hydroxyprogesterone caproate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)CCCCC)[C@@]1(C)CC2 DOMWKUIIPQCAJU-LJHIYBGHSA-N 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- FRWYFWZENXDZMU-UHFFFAOYSA-N Ic1nc2ccccc2cc1 Chemical compound Ic1nc2ccccc2cc1 FRWYFWZENXDZMU-UHFFFAOYSA-N 0.000 description 1
- CCZWSTFVHJPCEM-UHFFFAOYSA-N Ic1ncccc1 Chemical compound Ic1ncccc1 CCZWSTFVHJPCEM-UHFFFAOYSA-N 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000005755 Intercellular Signaling Peptides and Proteins Human genes 0.000 description 1
- 108010070716 Intercellular Signaling Peptides and Proteins Proteins 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 108050009288 Interleukin-19 Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- BKCJZNIZRWYHBN-UHFFFAOYSA-N Isophosphamide mustard Chemical compound ClCCNP(=O)(O)NCCCl BKCJZNIZRWYHBN-UHFFFAOYSA-N 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical class CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- GCKMFJBGXUYNAG-HLXURNFRSA-N Methyltestosterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)CC2 GCKMFJBGXUYNAG-HLXURNFRSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 1
- 108700020354 N-acetylmuramyl-threonyl-isoglutamine Proteins 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 102100028267 Neutral amino acid transporter B(0) Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- UBXIJOJXUFYNRG-RJKBCLGNSA-N PIP[3'](17:0/20:4(5Z,8Z,11Z,14Z)) Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)O[C@H](COC(=O)CCCCCCCCCCCCCCCC)COP(O)(=O)O[C@H]1C(O)C(O)C(O)[C@@H](OP(O)(O)=O)C1O UBXIJOJXUFYNRG-RJKBCLGNSA-N 0.000 description 1
- 239000012648 POLY-ICLC Substances 0.000 description 1
- 239000005662 Paraffin oil Substances 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 230000006819 RNA synthesis Effects 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 229940123934 Reductase inhibitor Drugs 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 102000000505 Ribonucleotide Reductases Human genes 0.000 description 1
- 108010041388 Ribonucleotide Reductases Proteins 0.000 description 1
- 101000718529 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) Alpha-galactosidase Proteins 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 239000004147 Sorbitan trioleate Substances 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 208000033133 Testicular seminomatous germ cell tumor Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- PDMMFKSKQVNJMI-BLQWBTBKSA-N Testosterone propionate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](OC(=O)CC)[C@@]1(C)CC2 PDMMFKSKQVNJMI-BLQWBTBKSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 1
- ZSZXYWFCIKKZBT-ZVDPZPSOSA-N [(2r)-3-[[(2s,3s,5r,6s)-2,6-dihydroxy-3,4,5-triphosphonooxycyclohexyl]oxy-hydroxyphosphoryl]oxy-2-hexadecanoyloxypropyl] hexadecanoate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OC1[C@H](O)[C@H](OP(O)(O)=O)C(OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H]1O ZSZXYWFCIKKZBT-ZVDPZPSOSA-N 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000002487 adenosine deaminase inhibitor Substances 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 108010081667 aflibercept Proteins 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000013059 antihormonal agent Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 238000011398 antitumor immunotherapy Methods 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- GOLCXWYRSKYTSP-UHFFFAOYSA-N arsenic trioxide Inorganic materials O1[As]2O[As]1O2 GOLCXWYRSKYTSP-UHFFFAOYSA-N 0.000 description 1
- 229960002594 arsenic trioxide Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- QKSKPIVNLNLAAV-UHFFFAOYSA-N bis(2-chloroethyl) sulfide Chemical compound ClCCSCCCl QKSKPIVNLNLAAV-UHFFFAOYSA-N 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 125000001314 canonical amino-acid group Chemical group 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 108010021331 carfilzomib Proteins 0.000 description 1
- 229960002438 carfilzomib Drugs 0.000 description 1
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 229940035811 conjugated estrogen Drugs 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 238000011393 cytotoxic chemotherapy Methods 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 238000006209 dephosphorylation reaction Methods 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 102100034175 eIF-2-alpha kinase GCN2 Human genes 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- QTTMOCOWZLSYSV-QWAPEVOJSA-M equilin sodium sulfate Chemical compound [Na+].[O-]S(=O)(=O)OC1=CC=C2[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4C3=CCC2=C1 QTTMOCOWZLSYSV-QWAPEVOJSA-M 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229960002568 ethinylestradiol Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 108700014844 flt3 ligand Proteins 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- YLRFCQOZQXIBAB-RBZZARIASA-N fluoxymesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)C[C@@H]2O YLRFCQOZQXIBAB-RBZZARIASA-N 0.000 description 1
- 229960001751 fluoxymesterone Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 208000010749 gastric carcinoma Diseases 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- PSVUJBVBCOISSP-UHFFFAOYSA-N glufosfamide Chemical compound OCC1OC(OP(=O)(NCCCl)NCCCl)C(O)C(O)C1O PSVUJBVBCOISSP-UHFFFAOYSA-N 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000002474 gonadorelin antagonist Substances 0.000 description 1
- 229960003690 goserelin acetate Drugs 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000003966 growth inhibitor Substances 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 244000000013 helminth Species 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000002607 hemopoietic effect Effects 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229940125697 hormonal agent Drugs 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 239000003667 hormone antagonist Substances 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 229950000801 hydroxyprogesterone caproate Drugs 0.000 description 1
- 229940090411 ifex Drugs 0.000 description 1
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 230000002434 immunopotentiative effect Effects 0.000 description 1
- 239000003547 immunosorbent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical group O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- CIPFCGZLFXVXBG-ZIQZFLOESA-N inositol 1,3,4,5-tetrakisphosphate Chemical compound O[C@H]1[C@H](OP(O)(O)=O)[C@@H](O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@@H]1OP(O)(O)=O CIPFCGZLFXVXBG-ZIQZFLOESA-N 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 108090000681 interleukin 20 Proteins 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 231100001231 less toxic Toxicity 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000008263 liquid aerosol Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 210000003141 lower extremity Anatomy 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000003810 lymphokine-activated killer cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004616 medroxyprogesterone Drugs 0.000 description 1
- FRQMUZJSZHZSGN-HBNHAYAOSA-N medroxyprogesterone Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FRQMUZJSZHZSGN-HBNHAYAOSA-N 0.000 description 1
- 229960001786 megestrol Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960001566 methyltestosterone Drugs 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 229960005225 mifamurtide Drugs 0.000 description 1
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 1
- 108700007621 mifamurtide Proteins 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- QUSNBJAOOMFDIB-UHFFFAOYSA-N monoethyl amine Natural products CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 235000010460 mustard Nutrition 0.000 description 1
- BLCLNMBMMGCOAS-UHFFFAOYSA-N n-[1-[[1-[[1-[[1-[[1-[[1-[[1-[2-[(carbamoylamino)carbamoyl]pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-[(2-methylpropan-2-yl)oxy]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amin Chemical compound C1CCC(C(=O)NNC(N)=O)N1C(=O)C(CCCN=C(N)N)NC(=O)C(CC(C)C)NC(=O)C(COC(C)(C)C)NC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 BLCLNMBMMGCOAS-UHFFFAOYSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 239000013110 organic ligand Substances 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003913 phosphatidylinositol 3,4-bisphosphates Chemical class 0.000 description 1
- 108091005981 phosphorylated proteins Proteins 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229940115270 poly iclc Drugs 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 229940021993 prophylactic vaccine Drugs 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 239000000649 purine antagonist Substances 0.000 description 1
- 239000003790 pyrimidine antagonist Substances 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 201000010174 renal carcinoma Diseases 0.000 description 1
- 230000008672 reprogramming Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000002924 silencing RNA Substances 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 235000019337 sorbitan trioleate Nutrition 0.000 description 1
- 229960000391 sorbitan trioleate Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229940061353 temodar Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 208000024662 testicular seminoma Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229960001712 testosterone propionate Drugs 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- AJZGFFKDLABHDD-UHFFFAOYSA-N thiazinane Chemical compound C1CCSNC1 AJZGFFKDLABHDD-UHFFFAOYSA-N 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- 150000004654 triazenes Chemical class 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 1
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 231100000402 unacceptable toxicity Toxicity 0.000 description 1
- 230000004222 uncontrolled growth Effects 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 239000002525 vasculotropin inhibitor Substances 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 210000001835 viscera Anatomy 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940055760 yervoy Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
- A61K31/167—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/555—Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/655—Azo (—N=N—), diazo (=N2), azoxy (>N—O—N< or N(=O)—N<), azido (—N3) or diazoamino (—N=N—N<) compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/66—Phosphorus compounds
- A61K31/675—Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
Definitions
- the field of the invention generally relates to methods and compositions for treating cancers and tumors.
- chemotherapeutic agents have adverse side effects associated with the toxicity of the chemotherapeutic dose required to achieve efficacy. Furthermore, the efficacy is limited by the toxicity of the drug because tumors often regrow before the patient can tolerate another dose of the chemotherapeutic agent. Thus, there is a need for treatments that would allow reducing the chemotherapeutic dose and, optionally, increasing the frequency of the chemotherapeutic dose while maintaining or improving the efficacy of the chemotherapeutic agent.
- T-cell anergy and the existence of regulatory T- cells contribute to tumor evasion of immune surveillance.
- compositions and methods for treating a cancer or a tumor in a subject in need thereof When combined with a chemotherapeutic agent, a PTEN inhibitor allows a reduction in dose of the chemotherapeutic agent, thus decreasing adverse side effects associated with toxicity. A reduced dose of the chemotherapeutic agent
- chemotherapeutic agent may be adminstered more frequently.
- the invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to reduce the volume of that tumor, wherein the reduction in tumor volume by the combination is greater than the reduction in tumor volume produced by the chemotherapeutic agent administered without any PTEN inhibitor.
- the efficacy of the combination (e.g., as measured by reduction in tumor volume) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose.
- the invention further encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering a PTEN inhibitor and a
- chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
- the chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles.
- the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
- the invention also encompasses a method of treating cancer in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to treat that cancer, wherein the efficacy in treating cancer by the combination is greater than the efficacy in treating cancer produced by the chemotherapeutic agent administered without any PTEN inhibitor.
- the efficacy of the combination may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose.
- the invention further encompasses a method of treating cancer in a subject in need thereof, the method comprising administering a PTEN inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
- chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
- a vaccine that targets or comprises a tumor antigen is administered to a subject in combination with at least one PTEN inhibitor and a
- the chemotherapeutic agent is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminotherapeutic agent.
- the chemotherapeutic agent is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- a PTEN inhibitor may be administered concurrently with the vaccine or concurrently with the chemotherapeutic agent. In certain embodiments, a PTEN inhibitor is administered both concurrently with the vaccine and, later, concurrently with the chemotherapeutic agent. Administration of the vaccine and the chemotherapeutic agent may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about two weeks, at least about three weeks or at least about four weeks.
- the invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising: (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and an antineoplastic chemotherapeutic agent to the subject.
- the invention relates to a method of treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and an antineoplastic chemotherapeutic agent to the subject.
- step (ii) may be performed at least about one week, at least about two weeks, at least about three weeks or at least about every four weeks after step (i).
- step (ii) is performed 24 hrs to 72 hrs after step (i), 48 hrs to 96 hrs after step (i) or 72 hrs to 120 hrs after step (i).
- the PTEN inhibitor, the vaccine and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
- step (i) may further comprise administering a PTEN inhibitor to the subject.
- the same PTEN inhibitor may be administered to the subject in steps (i) and (ii).
- the vaccine of any of the disclosed methods may target or comprise a tumor antigen from a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor.
- the vaccine targets or comprises human gp100, NY-ESO-1 , Mud or EGFR-vlll.
- the PTEN inhibitor of any of the disclosed methods may be a small molecule, a nucleic acid or a protein.
- the PTEN inhibitor may be N-(9, 10- Dioxo-9, 10-dihydrophenanthren-2-yl)-2,2-dimethylpropionamide; or 3,4-Dephostatin, ethyl-.
- the disclosed methods may be used to treat a refractory tumor or a tumor with particularly low immunogenicity.
- the tumor treated by the disclosed methods is a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor.
- the cancer treated by the disclosed methods is lung cancer, breast cancer, ovarian cancer, brain cancer, pancreatic cancer, colon cancer or melanoma.
- the disclosed method further comprises (iii) at least about two weeks after step (ii), administering the vaccine that targets or comprises a tumor antigen to the subject; and (iv) after step (iii), administering a PTEN inhibitor and the chemotherapeutic agent to the subject.
- Step (iv) may be performed at least about one week or at least about two weeks after step (iii).
- the PTEN inhibitor and the chemotherapeutic agent of step (iv) may be administered to the subject concurrently or sequentially.
- Step (iii) may further comprise administering a PTEN inhibitor to the subject. In such embodiments, the same PTEN inhibitor may be administered to the subject in steps (iii) and (iv).
- a PTEN inhibitor may be administered to a subject in multiple cycles (e.g., steps (iii) and (iv) may be repeated).
- the number of cycles may be at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10.
- a subject may be treated with such cycles indefinitely, as long as the treatment remains effective.
- Figure 1A shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on B16F10 tumor volume in wild-type mouse hosts.
- the upper part of the figure shows the sequence of treatment with pmel-1 T- cells, hgp100 vaccine and the VO-OHpic PTEN inhibitor (also known as
- Figure 1 B shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on E.G7 tumor volume in wild-type mouse hosts.
- the upper part of the figure shows the sequence of treatment with OT-I T-cells, OVA vaccine and the VO-OHpic PTEN inhibitor.
- the lower part of the figure is a graph showing the changes in tumor volume (mm 3 ) in groups that were treated with (1) OT-l/vaccine; (2) OT-l/vaccine and VO-OHpic; or (3) nothing.
- Figure 1C shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on the intratumoral milieu in a B16F10 mouse tumor model.
- the figure includes FACS analysis scatter plots showing loss of Fox03a expression in regulatory T-cells (Tregs) (top panel); proliferation of
- Figure 1 D shows the results of an experiment comparing endogenous tumor antigen presentation by DCs (dendritic cells) in B16-OVA mouse tumor models treated with (1) pmel- 1 T-cells, hgp100 vaccine and VO-OHpic or (2) pmel-1 T-cells and hgp100 vaccine.
- Ly6c + and Ly6c NEG cells were sorted and the SIINFEKL (SEQ ID NO: 1) peptide was added as shown.
- the DCs were tested for ability to present endogenous OVA antigen to OT-I responder cells in vitro.
- DCs from mice treated with pmel-1 T-cells, hgp100 vaccine and VO- OHpic were able to robustly cross-present endogenous tumor antigen acquired in vivo.
- DCs from mice treated with pmel-1 T-cells and hgp100 vaccine without VO-OHpic were suppressive and did not cross-present endogenous tumor antigens effectively.
- Figure 2A shows the results of experiments studying the effects of pharmacologic inhibition of PTEN and chemotherapy on B16F10 tumor volume in wild-type mouse hosts.
- the upper part of the figure shows the sequence of treatment with CTX (cyclophosphamide) and the VO-OHpic PTEN inhibitor.
- the lower part of the figure is a graph showing the changes in tumor volume (mm 3 ) in groups that were treated with (1) CTX; (2) VO-OHpic; or (3) CTX and VO-OHpic.
- Figure 2B shows the results of a FACS analysis of cells in B16F10 tumors treated with (1) CTX (cyclophosphamide); (2) CTX and VO-OHpic; or (3) nothing, analyzed four days after treatment with CTX.
- CTX cyclophosphamide
- CTX and VO-OHpic or (3) nothing, analyzed four days after treatment with CTX.
- Addition of VO-OHpic to CTX treatment abrogated Fox03a expression in Tregs, down-regulated PD-L1 , and increased the number of inflammatory Ly6c + CD11 b + CD1 1c + DCs.
- Call-out shows gated CD11 c + DCs from the CTX+ VO-OHpic group showing co-expression of CD103.
- FIG. 2C shows the results of an experiment studying the contribution of the adaptive immune response to B16F10 tumor regression in mice.
- Rag1-KO hosts lacking an adaptive immune system
- WT wild-type
- FIG. 3 shows the results of an experiment studying the effects of vaccine treatment, pharmacologic inhibition of PTEN and chemotherapy on Lewis Lung Carcinoma tumor cells stably transfected with the gp100 nominal tumor antigen (LLC-gp100).
- Tumor volume is shown in wild-type mouse hosts.
- the upper part of the figure shows the sequence of treatment with hgp100 vaccine, the VO-OHpic PTEN inhibitor and CTX (cyclophosphamide).
- the lower part of the figure is a graph showing the changes in tumor volume (mm 3 ) in groups that were treated with (1) vaccine and CTX; (2) vaccine and VO- OHpic; (3) vaccine, VO-OHpic and CTX; or (4) VO-OHpic and CTX.
- CpG-1826 CpG-1826
- Figure 4A is a graph showing a hypothetical model of increased chemotherapy efficacy at a lower dose when combined with a PTEN inhibitor.
- the combination of both drugs creates a greater anti-tumor effect than could be achieved even by a maximum tolerated dose (MTD) of chemotherapy; and this increased efficacy occurs at a low dose of chemotherapy, which by itself would have minimal effect.
- MTD maximum tolerated dose
- Figure 4B shows the results of an experiment studying the effects of pharmacologic inhibition of PTEN and chemotherapy on B16F10 tumor volume in wild-type mouse hosts.
- Mice with B16F10 tumors were treated with 0 or 10 mg/kg VO-OHpic (PTEN inhib.) at days 9, 10, 1 1 , 12, and 13 and with 0, 25, 50, or 150 mg/kg cyclophosphamide (CTX;
- chemotherapeutic agent at day 10, as shown in the table in Fig. 4B.
- a PTEN inhibitor VO-OHpic
- a chemotherapeutic agent cyclophosphamide (CTX)
- CTX cyclophosphamide
- Figures 5B, 5C, and 5D show the results of experiments analyzing tumor-infiltrating immune cells in B16F10 tumors after 10 days of tumor growth in either PTEN Tre9 -KO or parental Foxp3-GFP-Cre hosts.
- Figure 5B Tregs
- Figure 5C CD8 + T cells
- Figure 5D CD1 1c + DCs. Representative of a total of 9 experiments on days 10, 15 and 22. Intracellular cytokines were measured after 4 hr activation with PMA/ionomycin.
- Figures 6A, 6B, and 6C show the results of experiments analyzing the inflammatory intra-tumoral milieu in E.G7 lymphoma tumors grown in PTEN Tre9 -KO hosts.
- the changes in Tregs (Figure 6A), CD8 + cells (Figure 6B) and DCs (Figure 6C) in these tumors were similar to those seen in B16F10 tumors (see Figures 5B, 5C, and 5D).
- the disclosure provides methods for treating a subject in need thereof with a combination of a PTEN inhibitor and a chemotherapeutic agent.
- a PTEN inhibitor increases the efficacy of a chemotherapeutic agent and surprisingly allows a reduction in the dose of the chemotherapeutic agent.
- the reduced dose provides the advantage of decreased side effects associated with toxicity of a chemotherapeutic agent and may be administered more frequently. In the case of tumors and cancers, more frequent doses are advantageous because they may be given before the tumor or cancer regrows.
- a PTEN inhibitor may also be administered in combination with a chemotherapeutic agent and a vaccine directed to or comprising a tumor or a cancer antigen.
- a PTEN inhibitor surprisingly improves the efficacy of the chemotherapeutic agent and the vaccine.
- any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
- “about” means ⁇ 20% of the indicated range, value, or structure, unless otherwise indicated.
- the terms “a” and “an” as used herein refer to “one or more” of the enumerated components unless otherwise indicated.
- the use of the alternative should be understood to mean either one, both, or any combination thereof of the alternatives.
- the terms “include” and “comprise” are used synonymously.
- a “therapeutically effective amount” refers to that amount of a therapeutic agent sufficient to mediate a clinically relevant elimination, reduction or amelioration of such symptoms. An effect is clinically relevant if its magnitude is sufficient to impact the health or prognosis of a recipient subject.
- a therapeutically effective amount may refer to the amount of therapeutic agent sufficient to delay or minimize the onset of disease, e.g. , delay or minimize the spread of cancer.
- a therapeutically effective amount may also refer to the amount of the therapeutic agent that provides a therapeutic benefit in the treatment or management of a disease.
- cancer refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells.
- cancer explicitly includes, leukemias and lymphomas.
- cancer refers to a disease involving cells that have the potential to metastasize to distal sites and exhibit phenotypic traits that differ from those of non-cancer cells, for example, formation of colonies in a three-dimensional substrate such as soft agar or the formation of tubular networks or web-like matrices in a three-dimensional basement membrane or extracellular matrix preparation.
- Non-cancer cells do not form colonies in soft agar and form distinct sphere-like structures in three-dimensional basement membrane or extracellular matrix preparations.
- an “immune cell” refers to any cell from the hemopoietic origin including, but not limited to, T-cells, B cells, monocytes, dendritic cells, and macrophages.
- the terms "immunologic,” “immunological” or “immune” response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T-cells or their secretion products) response directed against a peptide in a recipient patient.
- Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells.
- a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules to activate antigen-specific CD4+ T helper cells and/or CD8+ cytotoxic T-cells.
- the response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity.
- the presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T-cells) or CTL (cytotoxic T lymphocyte) assays.
- CD4+ T-cells proliferation assays
- CTL cytotoxic T lymphocyte
- an “immunogenic agent” or “immunogen” is capable of inducing an immunological response against itself on administration to a mammal, optionally in conjunction with an adjuvant.
- polypeptide refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation).
- the term polypeptide includes proteins and fragments thereof.
- the polypeptides can be "exogenous,” meaning that they are “heterologous,” i.e., foreign to the host cell being utilized, such as human polypeptide produced by a bacterial cell.
- amino acid residue sequences are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus.
- amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gin, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (lie, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M),
- Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).
- variant refers to a polypeptide or polynucleotide that differs from a reference polypeptide or polynucleotide, but retains essential properties.
- a typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical.
- a variant and reference polypeptide may differ in amino acid sequence by one or more modifications (e.g., substitutions, additions, and/or deletions).
- a substituted or inserted amino acid residue may or may not be one encoded by the genetic code.
- a variant of a polypeptide may be naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally.
- the hydropathic index of amino acids can be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. Those indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8);
- the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and cofactors. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within ⁇ 2 is preferred, those within ⁇ 1 are particularly preferred, and those within ⁇ 0.5 are even more particularly preferred.
- Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly where the biological functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments.
- the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamnine (+0.2); glycine (0); proline (-0.5 ⁇ 1); threonine (-0.4); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent,
- amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take various foregoing characteristics into consideration are well known to those of skill in the art and include (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gin, His), (Asp: Glu, Cys, Ser), (Gin: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gin), (lie: Leu, Val), (Leu: lie, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: lie, Leu).
- Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above.
- embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to the polypeptide of interest.
- the term "percent (%) sequence identity” is defined as the percentage of nucleotides or amino acids in a candidate sequence that are identical with the nucleotides or amino acids in a reference nucleic acid sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
- % sequence identity of a given nucleotides or amino acids sequence C to, with, or against a given nucleic acid sequence D is calculated as follows:
- W is the number of nucleotides or amino acids scored as identical matches by the sequence alignment program in that program's alignment of C and D
- Z is the total number of nucleotides or amino acids in D. It will be appreciated that where the length of sequence C is not equal to the length of sequence D, the % sequence identity of C to D will not equal the % sequence identity of D to C.
- the term "pharmaceutically acceptable carrier” encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water and emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents.
- the disclosed methods of reducing tumor volume or treating cancer include administering to a subject in need thereof an effective amount of a PTEN inhibitor in combination with a chemotherapeutic agent and, optionally, a vaccine (e.g., a vaccine directed to or comprising a tumor antigen or a cancer antigen).
- a vaccine e.g., a vaccine directed to or comprising a tumor antigen or a cancer antigen.
- the disclosed methods may increase the efficacy of a chemotherapeutic (e.g., an antineoplastic) agent.
- the invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to reduce the volume of that tumor, wherein the reduction in tumor volume by the combination is greater than the reduction in tumor volume produced by the chemotherapeutic agent administered without any PTEN inhibitor.
- the efficacy of the combination (e.g., as measured by reduction in tumor volume) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose.
- the invention further encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering a PTEN inhibitor and a
- chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
- the chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles.
- the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
- the invention also encompasses a method of treating cancer in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to treat that cancer, wherein the efficacy in treating cancer by the combination is greater than the efficacy in treating cancer produced by the chemotherapeutic agent administered without any PTEN inhibitor.
- the efficacy of the combination (e.g., as measured by reduction in a symptom of the cancer) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose.
- the invention further encompasses a method of treating cancer in a subject in need thereof, the method comprising administering a PTEN inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
- chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles. In such multiple cycles, the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered.
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
- the chemotherapeutic agent is administered to a subject concurrently with a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor.
- the chemotherapeutic agent is administered after the vaccine.
- a PTEN inhibitor may be administered concurrently with the vaccine or concurrently with the chemotherapeutic agent.
- a PTEN inhibitor is administered both concurrently with the vaccine and, later, concurrently with the chemotherapeutic agent.
- the invention encompasses a method of reducing tumor size or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a
- the invention encompasses a method of reducing tumor size or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., an antineoplastic) agent to the subject.
- the methods can be used in vivo or ex vivo in cancer treatment applications.
- the combination of a PTEN inhibitor, a chemotherapeutic agent and a vaccine can be used for treating a subject having or being predisposed to any tumor-related or cancer- related antigen.
- the methods and compositions of the invention allow a reduction in chemotherapeutic agent dose compared to the dose of the same chemotherapeutic agent used as a standard of care without a PTEN inhibitor.
- the reduced dose exhibits decreased adverse side effects and may be administered more frequently.
- the disclosed methods and compositions can be used to treat cancer or reduce tumor volume in a subject in need thereof.
- the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a chemotherapeutic (e.g., an antineoplastic) agent to the subject; and (ii) after step (i), administering a PTEN inhibitor and a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject.
- a chemotherapeutic e.g., an antineoplastic
- the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., an antineoplastic) agent to the subject.
- a vaccine that is directed to or comprises a tumor antigen or a cancer antigen
- a chemotherapeutic e.g., an antineoplastic
- the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a chemotherapeutic (e.g., an antineoplastic) agent and a PTEN inhibitor to the subject; and (ii) after step (i), administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject.
- a chemotherapeutic e.g., an antineoplastic
- PTEN inhibitor e.g., an antineoplastic
- the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method
- a vaccine comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., an antineoplastic) agent to the subject.
- a chemotherapeutic e.g., an antineoplastic
- a PTEN inhibitor is administered in both step (i) and step (ii).
- the disclosed methods are useful for treating refractory tumors or tumors that exhibit particularly low immunogenicity.
- the types of cancer and tumor that may be treated with the provided compositions and methods include, but are not limited to, prostate, colorectum, pancreas, cervix, stomach, endometrium, brain, liver, bladder, ovary, testis, head, neck, skin, melanoma, basal carcinoma, mesothelial lining, white blood cells, lymphoma, leukemia, and other hematological cancers, esophagus, breast, muscle, esophageal, nasopharangeal, uterine, connective tissue, lung, small-cell lung carcinoma, non-small-cell lung carcinoma, adrenal gland, thyroid, kidney, or bone; glioblastoma, mesothelioma, renal cell carcinoma, gastric carcinoma, sarcoma, choriocarcinoma, cutaneous basocellular carcinoma, and testicular seminoma.
- Malignant tumors which may be treated are classified herein according to the embryonic origin of the tissue from which the tumor is derived.
- Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands.
- Sarcomas which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage.
- the leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer.
- cancer is caused by a pathogen, and/or the result of an infection or inflammation.
- the cancer is hepatocellular carcinoma.
- Adoptive T-cell therapy may be used with the methods of the invention.
- the disclosed methods can be used to treat T-cells ex vivo.
- One embodiment provides a method for treating cancer by administering an inhibitor of PTEN in combination with a vaccine and a chemotherapeutic agent to overcome T-cell exhaustion and/or T-cell anergy.
- the adoptive T-cell transfer can be administered to the subject prior to or following administration of the agent.
- Antigen-specific T-cell lines can be generated by in vitro stimulation with antigen followed by nonspecific expansion (for example, on CD3/CD28 beads). The ability to expand antigen-specific T-cells can be assessed using IFN-gamma and granzyme B enzyme-linked immunosorbent spot. The phenotype of the resultant T-cell lines can be evaluated by flow cytometry, for example, by monitoring for the presence of FOXP3-expressing CD4(+) T- cells. Amplification of antigen-specific T-cell populations from Peripheral Blood Mononuclear Cells (PBMCs) is usually performed through repeated in vitro stimulation with optimal length antigenic peptides in the presence of a cytokine (e.g., IL-2).
- a cytokine e.g., IL-2
- IL-2 Low doses of IL-2 (between 10 and 50 U/ml) have been used traditionally to avoid the activation/expansion of lymphokine- activated killer cells, as revealed in chromium release assays that were commonly employed to monitor specific T-cell expansion. Concentrations of antigenic peptides can be 0.1-10 ⁇ .
- the active agents are typically administered to a subject in need thereof in an effective amount.
- the active agents can be administered in a dosage sufficient reduce or prevent a least one, two, three, or more symptoms of the cancer, or to otherwise provide a desired pharmacologic and/or physiologic effect.
- the symptom may be physical or biological.
- the symptom may be physical, such as tumor burden, or biological such as proliferation of cancer cells.
- the amount is effective to increase the killing of tumor cells or inhibit proliferation or metastasis of tumor cells.
- the amount is effective to reduce tumor burden.
- the amount is effective to reduce or prevent at least one comorbidity of a cancer.
- the effect of the active agent on a subject is compared to a control.
- the effect of the active agent on a particular symptom, pharmacologic, or physiologic indicator can be compared to an untreated subject, or the condition of the subject prior to treatment.
- the symptom, pharmacologic, or physiologic indicator is measured in a subject prior to treatment, and again one or more times after treatment is initiated.
- the control is a reference level, or average determined based on measuring the symptom, pharmacologic, or physiologic indicator in one or more subjects that do not have the disease or condition to be treated (e.g., healthy subjects).
- the effect of the treatment is compared to a conventional treatment that is known in the art, such as one of those discussed herein.
- Co-administration of a PTEN inhibitor allows a reduction of the dose of the chemotherapeutic agent used as the standard of care (e.g., for human patients) or the maximum tolerated dose (MTD) without a PTEN inhibitor.
- Standard dose ranges for specific chemotherapy drugs are known to those skilled in the art. Doses of different chemotherapeutic agents vary, depending on the tumor type and on concomitant administration of other chemotherapy drugs, but
- the chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume (or to treat cancer) or the MTD when the chemotherapeutic agent is administered without any PTEN inhibitor.
- the reduced dose of the chemotherapeutic agent may maintain the same efficacy (or an improved efficacy) in reducing tumor volume or treating cancer as the standard of care dose.
- a PTEN inhibitor a chemotherapeutic agent and a vaccine
- the doses may range from about 1 ng/kg to 100 mg/kg for a typical subject, with exemplary shorter ranges being 1 to 50 mg/kg and 10 to 20 mg/kg. Such doses may be repeated. The dose will be correlated with the identity of the mammal receiving said dose. Doses in the above-recited mg/kg ranges are convenient for mammals, including rodents, such as mice and rats, and primates, especially humans.
- administration is given as a long-term treatment regimen whereby
- the data obtained from cell culture assays and animal studies can be used to formulate a dosage range for use in humans.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage can vary within this range depending upon the dosage form employed and the route of administration.
- the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture.
- IC50 the concentration of the test compound that achieves a half-maximal inhibition of symptoms
- levels in plasma can be measured, for example, by high performance liquid chromatography (HPLC).
- the invention encompasses a treatment regimen comprising multiple cycles of administering a PTEN inhibitor, a chemotherapeutic agent, and, optionally, a vaccine that targets or comprises a tumor antigen to a subject in need thereof.
- the number of cycles may be at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10.
- a subject may be treated with such cycles indefinitely, as long as the treatment remains effective.
- the cycles may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about ten days, at least about two weeks, at least about three weeks or at least about four weeks.
- the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject.
- the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., antineoplastic) agent to the subject.
- the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject.
- a PTEN inhibitor and a chemotherapeutic agent e.g., antineoplastic
- the same PTEN inhibitor may be administered to the subject in steps (i) and (ii).
- the PTEN inhibitor and the vaccine may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the vaccine are administered sequentially, either the PTEN inhibitor or the vaccine may be administered first.
- Step (ii) may be performed at least about 1 week, at least about 2 weeks, at least about 3 weeks or at least about 4 weeks after step (i).
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the chemotherapeutic agent are administered sequentially, either the PTEN inhibitor or the chemotherapeutic agent may be administered first.
- the PTEN inhibitor, vaccine, and chemotherapeutic agent can be administered as part of a therapeutic regimen.
- a treatment regimen of the combination therapy can include one or multiple administrations of the PTEN inhibitor.
- the vaccine, PTEN inhibitor and chemotherapeutic agent may be administered to the patients in multiple rounds. These rounds (e.g., administration of the vaccine and the chemotherapeutic agent) may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about ten days, at least about two weeks, at least about three weeks or at least about four weeks.
- the disclosed method may comprise (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject; (iii) at least about two weeks after step (ii), administering the vaccine to the subject; and (iv) after step (iii), administering a PTEN inhibitor and the chemotherapeutic (e.g., antineoplastic) agent to the subject.
- a PTEN inhibitor and a chemotherapeutic e.g., antineoplastic
- the disclosed method may comprise (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject; (iii) administering the vaccine and a PTEN inhibitor to the subject; and (iv) after step (iii), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject.
- the same PTEN inhibitor may be administered to the subject in steps (iii) and (iv).
- the PTEN inhibitor and the vaccine may be administered to the subject concurrently or sequentially.
- Step (iv) may be performed at least about 1 week, at least about 10 days, at least about 2 weeks, at least about 3 weeks, or at least about 4 weeks after step (iii).
- the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the chemotherapeutic agent are administered sequentially, either the PTEN inhibitor or the chemotherapeutic agent may be administered first.
- the disclosed methods include administering a subject in need thereof an effective amount of one or more additional active agents, for example, a PD- 1 or CTLA4 antagonist or other immunomodulator in either step (i), (ii), (iii) and/or (iv).
- the PTEN inhibitor and the one or more additional active agents are administered to the subject separately, but simultaneously.
- the PTEN inhibitor and the additional active agent(s) can also be administered as part of the same composition.
- the PTEN inhibitor and the additional active agent(s) are administered separately and at different times, but as part of the same treatment regimen. If the PTEN inhibitor is administered first, the additional active agent(s) can be administered second. Likewise, if the additional active agent(s) is administered first, the PTEN inhibitor can be administered second.
- Dosage regimens or cycles of the agents can be completely, or partially overlapping, or can be sequential. For example, in some embodiments, all such administration(s) of the PTEN inhibitor occur before or after administration of the chemotherapeutic agent.
- administration of one or more doses of the PTEN inhibitor can be temporally staggered with the administration of the chemotherapeutic agent to form a uniform or nonuniform course of treatment whereby one or more doses of PTEN inhibitor are administered, followed by one or more doses of the chemotherapeutic agent, followed by one or more doses of PTEN inhibitor; or one or more doses of the chemotherapeutic agent are administered, followed by one or more doses of PTEN inhibitor, followed by one or more doses of the chemotherapeutic agent; etc., all according to whatever schedule is selected or desired by the researcher or clinician administering the therapy.
- an effective amount of each of the agents can be administered as a single unit dosage (e.g., as dosage unit), or sub-therapeutic doses that are administered over a finite time interval.
- unit doses may be administered on a daily basis for a finite time period, such as up to 3 days, or up to 5 days, or up to 7 days, or up to 10 days, or up to 15 days or up to 20 days or up to 25 days, are all specifically contemplated by the invention.
- the invention relates to methods of treatment that comprise administering to a subject a pharmaceutical composition comprising an effective amount of at least one PTEN inhibitor.
- PTEN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase
- MMAC1 , TEP1 phosphatase and tensin homolog
- PTEN is also a lipid phosphatase that removes the phosphate in the D3 position of the inositol ring from phosphatidylinositol 3,4,5-trisphosphate
- phosphatidylinositol 3,4-diphosphate phosphatidylinositol 3-phosphate and inositol 1 ,3,4,5- tetrakisphosphate.
- amino acid and nucleic acid sequences for PTEN are known in the art. See, for example, UniProt Accession No. P60484, which provides the canonical amino acid sequence including:
- PTEN inhibitor refers to agents that directly reduce, block, inhibit, prevent or suppress expression or activity of PTEN and/or agents that reduce, block, inhibit, prevent or suppress the downstream effects of PTEN activation.
- the agent can be a small molecule, or a biomacromolecule, such as a protein, polypeptide, or nucleic acid.
- at least two PTEN inhibitors are administered to the subject.
- at least one of the agents directly reduces, blocks, inhibits, prevents or suppresses expression or activity of PTEN.
- the composition includes, or the subject is otherwise administered, two PTEN inhibitors in combination, wherein one inhibitor directly inhibits PTEN and the other PTEN inhibitor reduces or prevents the downstream effects of PTEN activation in the subject.
- a PTEN inhibitor may reduce, block, inhibit, prevent, or suppress the activity of PTEN with a particular potency.
- a PTEN inhibitor may have an IC50 of less than about 100 ⁇ , less than about 50 ⁇ , less than about 25 ⁇ , less than about 10 ⁇ , less than about 5 ⁇ , less than about 1 ⁇ , less than about 500 nM, less than about 250 nm, less than about 100 nM, less than about 50 nM, less than about 25 nM, less than about 10 nM, less than about 5 nM, or less than about 1 nM.
- PTEN inhibition assays for general screening (to identify and confirm alternative, suitable inhibitors) and IC50 determinations are described in the working examples provided herein and/or known in the art, e.g. U.S. 2007/0203098 and WO 2005/097119, each of which is specifically incorporated by reference herein in its entirety.
- a PTEN inhibition assay and IC50 determination may be performed as described in Examples 3 and 4 of U.S. 2007/0203098. Briefly, free phosphate, which is a product of the PTEN dephosphorylation reaction, can be detected by a
- test inhibitor candidates can be mixed with PTEN solution and then substrate can be added.
- the reaction mix can be incubated for a suitable time. Subsequently, an aliquot of malachite green buffer can be added to develop the color in the dark.
- spectrophotometer can be used to measure the optical density at, for example, 650 nanometers.
- the activity of PTEN can be measured in vivo by quantifying cellular
- PI(3,4,5)P 3 levels after treatment with a PTEN inhibitor.
- the PTEN is a PTEN inhibitor such as N-(9, 10-Dioxo-9, 10- dihydrophenanthren-2-yl)-2,2-dimethylpropionamide; or 3,4-Dephostatin, ethyl-.
- the PTEN inhibitor is a vanadium complex including, for example, vanadate (VO) or bisperoxovanadate (bpV) complexed to one or more organic ligands.
- ligands include 1-isoquinoline (isoqu), phenanthroline (phen), phenylbiguanide (biguan), 3-hydropicolinate (OH-pic), bipyridine (bipy) and picolinato (pic). See examples of such small molecules disclosed in Rosivatz, et al., ACS Chem. Biol., 1 (12):780-90 (2006); which is herein incorporated by reference.
- PTEN inhibitors including bpV(bipy), bpV(OHpic), bpV(phen), bpV(pic) are available from commercial vendors.
- a PTEN inhibitor is a vanadium-based PTEN inhibitor described in U.S. 2007/0292532 or U.S. 7,692,012, each of which is specifically incorporated by reference herein in its entirety.
- a PTEN inhibitor may be a vanadium- containing compound of the formula:
- L-L' is: and L' is COO, CONR 5 , CONHR 6 , CH 2 NR 5 R'
- L" is O, S or NH
- R 1 , R 2 , R 3 , R 4 , R 5 and R 6 are independently H, hydroxyl, Ci -6 alkyl, optionally substituted by hydroxy or NR 7 R 8 , 0 3 . 6 cycloalkyi, optionally substituted by hydroxy or NR 7 R 8 , phenyl, optionally substituted by Ci -3 alkyl, hydroxy, NR 7 R 8 or S0 3 , (OCHzCHzMNHCHzCI-yn, an amino acid or a peptide consisting of 2 to 5 amino acids; and
- R 7 and R 8 are independently H or Ci -6 alkyl; or a pharmaceutically acceptable salt thereof.
- a PTEN inhibitor may be a vanadium-containing compound of the formula:
- L-L' is:
- L' is COO, CONR 5 , CONHR 6 , CH 2 NR 5 R'
- L" is O, S or NH
- R 1 , R 2 , R 3 , R 4 , R 5 and R 6 are independently H, hydroxyl, Ci -6 alkyl, optionally substituted by hydroxy or NR 7 R 8 , C 3 . 6 cycloalkyl, optionally substituted by hydroxy or NR 7 R 8 , phenyl, optionally substituted by Ci. 3 alkyl, hydroxy, NR 7 R 8 or S0 3 , (OCH 2 CH2)n(NHCH 2 CH2)n, an amino acid or a peptide consisting of 2 to 5 amino acids; and
- R 7 and R 8 are independently H or Ci -6 alkyl; or a pharmaceutically acceptable salt thereof.
- PTEN inhibitors include potassium bisperoxo (bipyridine) oxovanadate (bpV(bipy), potassium bisperoxo(1 ,10-phenanthroline)oxovanadate (pV(phenanthroline)), potassium bisperoxo (piconlinate) oxovanadate (pV(pic)), potassium bisperoxo(phenylbiguanide)oxovanadate (pV(biguan)), pV(phenbig) [dipotassium
- the PTEN inhibitor can be a functional nucleic acid selected from the group consisting of antisense molecules, siRNA, shRNA, miRNA, aptamers, ribozymes, triplex forming molecules, RNAi, or external guide sequences that target SEQ ID NO:5, or gene editing compositions such as CRISPR/Cas, zinc finger nuclease, or TALEN compositions that target the PTEN gene and reduce or otherwise modify its expression.
- the composition includes a functional nucleic acid or polypeptide designed to target and reduce or inhibit expression or translation of PTEN mRNA; or to reduce or inhibit expression, reduce activity, or increase degradation of PTEN protein.
- the composition includes a vector suitable for in vivo expression of the functional nucleic acid.
- a functional nucleic acid or polypeptide is designed to target a segment of the nucleic acid sequence of SEQ ID NO:5, or the complement thereof, or variants thereof having a nucleic acid sequence at least about 65%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to SEQ ID NO:5.
- a functional nucleic acid or polypeptide is designed to target a segment of a the nucleic acid encoding the amino acid sequence of SEQ ID NO:4, or the complement thereof, or variants thereof having a nucleic acid sequence at least about 65%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to a nucleic acid encoding the amino acid sequence of SEQ ID NO:4.
- the functional nucleic acid hybridizes to the nucleic acid of SEQ ID NO:5, or a complement thereof, for example, under stringent conditions. In some embodiments, the functional nucleic acid hybridizes to a nucleic acid sequence that encodes SEQ ID NO:4, or a complement thereof, for example, under stringent conditions.
- a PTEN inhibitor may be administered with one or more additional therapeutic agents.
- Additional therapeutic agents useful for the treatment of cancer are known to the skilled artisan. Additional therapeutic treatments include, but are not limited to, surgical resection, radiation therapy, hormone therapy, antibody-based therapies, whole body irradiation, bone marrow transplantation, peripheral blood stem cell
- chemotherapeutic agents also referred to herein as "antineoplastic chemotherapy agent,” “antineoplastic agents,” or “antineoplastic chemotherapeutic agents”
- cytokines such as for example, bacterial lipopolysaccharides (LPS), ligands that bind to Toll-Like Receptors such as CpG oligonucleotides (ODN), metabolic breakdown products of tryptophan, inhibitors of a GCN2 kinase, adjuvants, radionuclides, enzymes, anti-parasites (helminths, protozoans), growth factors, growth inhibitors, hormones, hormone antagonists, antibodies and bioactive fragments thereof (including humanized, single chain, and chimeric antibodies), antigen and vaccine formulations (including adjuvants),
- chemotherapeutic agents also referred to herein as "antineoplastic chemotherapy agent,” “antineoplastic agents,” or “antineoplastic chemotherapeutic agents”
- cytokines such as bacterial
- Exemplary cytokines include, but are not limited to, IL-1 a, IL- ⁇ , IL-2, IL-3, IL-4, IL-6, IL-8, IL-9, IL-10, IL-12, IL-13, IL-15, IL-18, IL-19, IL-20, IFN-a, IFN- ⁇ , IFN- ⁇ , tumor necrosis factor (TNF), transforming growth factor- ⁇ (TGF- ⁇ ), granulocyte colony stimulating factor (G- CSF), macrophage colony stimulating factor (M-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), and Flt-3 ligand.
- TGF tumor necrosis factor
- TGF- ⁇ tumor necrosis factor
- TGF- ⁇ tumor necrosis factor
- TGF- ⁇ tumor necrosis factor
- TGF- ⁇ tumor necrosis factor
- G- CSF granulocyte colony stimulating factor
- M-CSF macrophage colony stimulating factor
- Some embodiments include a cell based therapy such as sipuleucel-T treatment.
- a PTEN inhibitor is administered to a subject after sipuleucel-T
- PROVENGE ® preferably to treat metastatic castration-resistant prostate cancer.
- the invention relates to methods of treatment that comprise administering a vaccine to a subject in combination with a PTEN inhibitor.
- a vaccine targets or comprises a tumor antigen.
- a vaccine may be directed to or comprise an antigen from a lung tumor, a breast tumor, an ovarian tumor or a melanoma tumor.
- the vaccine targets or comprises human gp100, NY-ESO-1 , Mud or EGFR-vlll.
- the vaccine may be a tumor-specific cancer cell line that stimulates the subject's immune system to attack the subject's cancer cells.
- the vaccine is a HyperAcuteTM immunotherapy.
- a cell-based vaccine may be genetically modified to express alpha-gal carbohydrates on cell surface molecules.
- the vaccine may be any of the vaccines disclosed in U.S. 7,763,461 , U.S. 8,551 ,474, U.S. 8,535,658, U.S. 2014/0037692 or U.S. 2014/0072597, each of which is specifically incorporated herein by reference in its entirety.
- Non-limiting examples of cell-based vaccines that may be used in the methods and compositions of the invention are Algenpantucel-L, Tergenpumatucel-L and Dorgenmeltucel- L.
- a vaccine used in the methods and compositions of the invention may be formulated or administered with an adjuvant.
- the role of the adjuvant is to increase the immune system activation in the presence of target antigens.
- immunostimulatory components of adjuvants and specific adjuvants include aluminum salts (e.g. , alum, aluminum phosphate, aluminum hydroxide), squalene-in-water emulsions (e.g.
- MPL ® Monophosphoryl Lipid A
- 3DMPL 3-O-deacetylated MPL ®
- AS04 M PL ® and alum
- MPL ® and QS-21 e.g. , MPL ® and formulations such as AS01 and AS02
- typhimurium e.g. , flagellin or flagellin-Ag fusion proteins
- imidazoquinoline derivatives e.g., imiquimods
- synthetic phophorothioate-linked DNA oligonucleotides with optimized CpG motifs e.g. , CpG oligodeoxynuceotides and formulations (IC31 , QB10)
- trehalose dimycolate e.g, CAF01
- saponins e.g. , ISCOMS ((see, e.g., Sjolander et al., J. Leukocyte Biol.
- I FA incomplete Freund's adjuvant
- CFA complete Freund's adjuvant
- QS-21 serin adjuvant
- LT/CT mutants poly(D, L-lactide-co-glycolide) (PLG) microparticles
- Quil A interleukins
- thr-MDP N-acetyl-nor- muramyl-L-alanyl-D-isoglutamine
- nor-MDP nor-MDP
- TLR toll-like receptors
- synthetic or synthesized see, e.g. Kanzler et al. , Nature Med. 13: 1552-1559 (2007)
- TLR3 ligands such as polylC and similar compounds such as Hiltonol and Ampligen.
- suitable adjuvants are also found in Coffman et al., Immunity 33, 492-503 (2010).
- Administration is not limited to the treatment of an existing tumor or cancer but can also be used to prevent or lower the risk of developing such diseases in an individual, i.e. , for prophylactic use.
- Potential candidates for prophylactic vaccination include individuals with a high risk of developing cancer, i.e. , with a personal or familial history of certain types of cancer.
- a PTEN inhibitor can be administered in conjunction with, or as a component of a vaccine composition.
- a PTEN inhibitor can be administered prior to, concurrently with, or after the administration of a vaccine.
- a PTEN inhibitor is administered at the same time as administration of a vaccine.
- a PTEN inhibitor can be administered in conjunction with prophylactic vaccines, which confer resistance in a subject to subsequent exposure to cancer-causing molecules or events, or in conjunction with therapeutic vaccines, which can be used to initiate or enhance a subject's immune response to a pre-existing antigen, such as a tumor antigen in a subject with cancer, or a viral antigen in a subject infected with a virus.
- the desired outcome of a prophylactic, therapeutic or de-sensitized immune response may vary according to the disease, according to principles well known in the art.
- an immune response against a tumor-related or cancer-related antigen may completely prevent tumor or cancer presence in the patient, with an absence of any disease symptoms.
- a vaccine treatment against tumor-related or cancer-related antigens may be considered effective if it reduces the number, severity or duration of symptoms; if it reduces the number of individuals in a population with symptoms.
- immune responses against cancer may completely treat a disease, may alleviate symptoms, or may be one facet in an overall therapeutic intervention against a disease.
- the stimulation of an immune response against a cancer may be coupled with surgical, chemotherapeutic, radiologic, hormonal and other immunologic approaches in order to affect treatment.
- the invention includes methods of treatment comprising administering to a subject a PTEN inhibitor and a chemotherapeutic agent (in some cases, after administering a vaccine to the subject).
- a chemotherapeutic agent is an
- antineoplastic chemotherapeutic agent antineoplastic chemotherapeutic agent.
- a chemotherapeutic agent may be, for example, a cytotoxic chemotherapy agent, such as, for example, epidophyllotoxin, procarbazine, mitoxantrone, platinum coordination complexes such as cisplatin and carboplatin, leucovorin, tegafur, paclitaxel, docetaxol, vincristine, vinblastine, methotrexate, cyclophosphamide, gemcitabine, estramustine, carmustine, adriamycin (doxorubicin), etoposide, arsenic trioxide, irinotecan, epothilone derivatives, navelbene, CPT-1 1 , anastrazole, letrazole, capecitabine, reloxafine, ifosamide, temozolomide and droloxafine.
- a cytotoxic chemotherapy agent such as, for example, epidophyllotoxin, procarbazine, mit
- a chemotherapeutic agent may be, for example, an alkylating agent, such as, for example, nitrogen mustards (such as chlorambucil, cyclophosphamide, ifosfamide, temozolomide, echlorethamine, melphalan, and uracil mustard), aziridines (such as thiotepa), methanesulphonate esters (such as busulfan), nitroso ureas (such as carmustine, lomustine, and streptozocin), platinum complexes (such as cisplatin and carboplatin), and bioreductive alkylators (such as mitomycin, procarbazine, dacarbazine and altretamine), ethylenimine derivatives, alkyl sulfonates, triazenes, pipobroman, temozolomide, triethylene- melamine, and triethylenethiophosphoramine.
- nitrogen mustards such as chlorambucil, cycl
- a chemotherapeutic agent may be an antimetabolite, such as, for example, a folate antagonist (such as methotrexate and trimetrexate), a pyrimidine antagonist (such as fluorouracil, fluorodeoxyuridine, CB3717, azacitidine, cytarabine, gemcitabine, and floxuridine), a purine antagonist (such as mercaptopurine, 6-thioguanine, fludarabine, and pentostatin), a ribonucleotide reductase inhibitor (such as hydroxyurea), and an adenosine deaminase inhibitor.
- a folate antagonist such as methotrexate and trimetrexate
- a pyrimidine antagonist such as fluorouracil, fluorodeoxyuridine, CB3717, azacitidine, cytarabine, gemcitabine, and floxuridine
- a purine antagonist such as mercaptopurine, 6-thi
- a chemotherapeutic agent may be a DNA strand-breakage agent (such as, for example, bleomycin), a topoisomerase II inhibitor (such as, for example, amsacrine, dactinomycin, daunorubicin, idarubicin, mitoxantrone, doxorubicin, etoposide, and teniposide), a DNA minor groove binding agent (such as, for example, plicamydin), a tubulin interactive agent (such as, for example, vincristine, vinblastine, and paclitaxel), a hormonal agent (such as, for example, estrogens, conjugated estrogens, ethinyl estradiol,
- a DNA strand-breakage agent such as, for example, bleomycin
- a topoisomerase II inhibitor such as, for example, amsacrine, dactinomycin, daunorubicin, idarubicin, mitoxantrone, dox
- corticosteroid such as, for example, prednisone, dexamethasone, methylprednisolone, and prednisolone
- a leutinizing hormone releasing agent or gonadotropin-releasing hormone antagonist such as, for example, leuprolide acetate and goserelin acetate
- an antihormonal agent such as, for example, tamoxifen
- an antiandrogen agent such as flutamide
- an antiadrenal agent such as mitotane and aminoglutethimide
- a natural product or derivative thereof such as, for example, vinca alkaloids, antibiotics, enzymaes and epipodophyllotoxins, including, for example vinblastine, vincristine, vindesine, bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, ara-C, paclitaxel,
- a PTEN inhibitor is administered to a subject in combination with temozolomide (TEMODAR®) (e.g., for treating primary malignant brain tumors); or with docetaxel (TAXOTERE®) (e.g., for treating metastatic breast cancer).
- TEMODAR® temozolomide
- TXOTERE® docetaxel
- a PTEN inhibitor is administered to a subject in combination with cyclophosphamide.
- Cyclophosphamide (CTX, CYTOXAN®, or NEOSAR®) is an oxazahosphorine drug and analogs include ifosfamide (IFO, Ifex), perfosfamide, trophosphamide (trofosfamide; Ixoten), and pharmaceutically acceptable salts, solvates, prodrugs and metabolites thereof (U.S. 2007/0202077, which is specifically incorporated herein by reference in its entirety).
- Ifosfamide (MITOXANA®) is a structural analog of cyclophosphamide and its mechanism of action is considered to be identical or substantially similar to that of cyclophosphamide.
- Perfosfamide (4-hydroperoxycyclophosphamide) and trophosphamide are also alkylating agents, which are structurally related to
- cyclophosphamide For example, perfosfamide alkylates DNA, thereby inhibiting DNA replication and RNA and protein synthesis.
- New oxazaphosphorines derivatives have been designed and evaluated with an attempt to improve the selectivity and response with reduced host toxicity (Liang et al., Curr Pharm Des. 2007; 13(9):963-78). These include mafosfamide (NSC 345842), glufosfamide (D19575, beta-D-glucosylisophosphoramide mustard), S-(-)-bromofosfamide (CBM-11), NSC 612567 (aldophosphamide
- Mafosfamide is an oxazaphosphorine analog that is a chemically stable 4-thioethane sulfonic acid salt of 4- hydroxy-CPA.
- Glufosfamide is IFO derivative in which the isophosphoramide mustard, the alkylating metabolite of IFO, is glycosidically linked to a beta-D-glucose molecule. Additional cyclophosphamide analogs are described in U.S. 5,190,929, which is specifically
- CTX may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the 8 mg/kg dose for an average male or compared to a 15-150 mg/kg dose for a mouse, when administered in combination with a PTEN inhibitor.
- mg/m2 doses may be used but unit doses administered over a finite time interval may be preferred.
- unit doses may be administered on a daily basis for a finite time period, such as up to 3 days, or up to 5 days, or up to 7 days, or up to 10 days, or up to 15 days or up to 20 days or up to 25 days, are all specifically contemplated by the invention.
- the same regimen may be applied for the other potentiating agents recited herein.
- the chemotherapeutic agent may be Sunitinib
- a mitosis inhibitor such as paclitaxel
- an aromatase inhibitor e.g. Letrozole
- an angiogenesis inhibitor VEGF inhibitors e.g.
- Chemotherapeutic agents that kill tumor cells may be administered in combination with a PTEN inhibitor according to the methods of the invention.
- Non-limiting examples of such agent include imatinib, sunitinib, trastuzumab, cetuximab, gefitinib, erlotinib, panituzumab, bevacizumab, NEXAVAR ® (sorafenib), venurafinib, bortezomib, carfilzomib, lenolidomide and rituximab.
- sorafenib for treating cancer is 400 mg (2 x 200 mg tablets) taken twice daily.
- the methods of the invention would allow a lower dose of sorafenib to be used in combination with a PTEN inhibitor without reducing its anti-cancer or anti-tumor efficacy.
- sorafenib may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the 400 mg twice daily dose, when administered in combination with a PTEN inhibitor.
- the methods of the invention would allow a lower dose of any one of adriamycin, cisplatin, carboplatin, oxaliplatin, cyclophosphamide, ifosfamide, temozolomide, gemcitabine, pactilaxel, docetaxel or etoposide to be used in combination with a PTEN inhibitor without reducing the chemotherapeutic agent's anti-cancer or antitumor efficacy.
- adriamycin, cisplatin, carboplatin, oxaliplatin for example, adriamycin, cisplatin, carboplatin, oxaliplatin,
- cyclophosphamide, ifosfamide, temozolomide, gemcitabine, pactilaxel, docetaxel or etoposide may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the daily or aggregate standard dose of the corresponding chemotherapeutic agent shown in Table 1 , when administered in combination with a PTEN inhibitor.
- temozolomide 200 1 ,2,3,4,5 28
- GCT germ cell tumor / testicular cancer
- the disclosed methods involve co-administration with a PD-1 antagonist.
- PD-1 antagonists also referred to herein as inhibitors of the PD-1/PD-L pathway, include, but are not limited to, antibodies, peptides, nucleic acid molecules
- An antibody may be an intact antibody, an antibody binding fragment, or a chimeric antibody.
- a chimeric antibody may include both human and non-human portions.
- An antibody may be a polyclonal or a moncoclonal antibody.
- An antibody may be a derived from a wide variety of species, including, but not limited to mouse and human.
- An antibody may be a humanized antibody.
- An antibody may be linked to another functional molecule, for example, another peptide or protein, a toxin, a radioisotype, a cytotoxic agent, cytostatic agent, a polymer, such as, for example, polyethylene glycol, polypropylene glycol or polyoxyalkenes.
- another functional molecule for example, another peptide or protein, a toxin, a radioisotype, a cytotoxic agent, cytostatic agent, a polymer, such as, for example, polyethylene glycol, polypropylene glycol or polyoxyalkenes.
- PD-1 is a member of the CD28 family of receptors that delivers a negative immune response when induced on T-cells.
- Contact between PD-1 and one of its ligands (B7-H1 or B7-DC) induces an inhibitory response that decreases T-cell multiplication and/or the strength and/or duration of a T-cell response.
- Suitable PD-1 antagonists are described in U.S. 8, 114,845, U.S. 8,609,089, and U.S.
- the PD-1 receptor antagonist binds directly to the PD- 1 receptor without triggering inhibitory signal transduction and also binds to a ligand of the PD-1 receptor to reduce or inhibit the ligand from triggering signal transduction through the PD-1 receptor.
- PD-1 signaling is driven by binding to a PD-1 ligand (such as B7-H1 or B7-DC) in close proximity to a peptide antigen presented by major
- MHC histocompatibility complex
- the PD-1 receptor antagonists are small molecule antagonists or antibodies that reduce or interfere with PD-1 receptor signal transduction by binding to ligands of PD-1 or to PD-1 itself, especially where co-ligation of PD-1 with TCR does not follow such binding, thereby not triggering inhibitory signal transduction through the PD-1 receptor.
- PD-1 antagonists contemplated by the methods of this invention include antibodies that bind to PD-1 or ligands of PD-1 , and other antibodies.
- Suitable anti- PD-1 antibodies include, but are not limited to, those described in the following publications: WO 2003/099196; WO 2006/121168; WO 2009/014708; WO 2004/004771 ; WO
- a specific example of an anti-PD-1 antibody is an antibody described in US 2007/0166281 at par. 42, a human anti-PD-1 antibody, preferably administered at a dose of 3 mg/kg.
- anti-B7-H1 antibodies include, but are not limited to, those described in the following publications: WO 2006/133396; WO 2008/083174; and US 2006/01 10383; each of which is specifically incorporated by reference herein in its entirety.
- a specific example of an anti-B7-H1 antibody is an antibody described in WO/2007/005874, a human anti-B7-H1 antibody.
- exemplary PD-1 receptor antagonists include, but are not limited to B7- DC polypeptides, including homologs and variants of these, as well as active fragments of any of the foregoing, and fusion proteins that incorporate any of these.
- the fusion protein includes the soluble portion of B7-DC coupled to the Fc portion of an antibody, such as human IgG, and does not incorporate all or part of the transmembrane portion of human B7-DC.
- the PD-1 antagonist can also be a fragment of a mammalian B7-H1 , preferably from mouse or primate, preferably human, wherein the fragment binds to and blocks PD-1 but does not result in inhibitory signal transduction through PD-1.
- the fragments can also be part of a fusion protein, for example an Ig fusion protein.
- PD-1 antagonists include those that bind to the ligands of the PD-1 receptor. These include the PD-1 receptor protein, or soluble fragments thereof, which can bind to the PD-1 ligands, such as B7-H1 or B7-DC, and prevent binding to the endogenous PD-1 receptor, thereby preventing inhibitory signal transduction. B7-H1 has also been shown to bind the protein B7.1 (Butte et al., Immunity, Vol. 27, pp. 1 11-122, (2007)).
- Such fragments also include the soluble ECD portion of the PD-1 protein that includes mutations, such as the A99L mutation, that increases binding to the natural ligands (Molnar et al., PNAS, 105:10483-10488 (2008)).
- B7-1 or soluble fragments thereof which can bind to the B7-H1 ligand and prevent binding to the endogenous PD-1 receptor, thereby preventing inhibitory signal transduction, are also useful.
- PD-1 and B7-H1 anti-sense nucleic acids can also be PD-1 antagonists.
- Such anti-sense molecules prevent expression of PD-1 on T-cells as well as production of T-cell ligands, such as B7-H1 , PD-L1 and/or PD-L2.
- siRNA for example, of about 21 nucleotides in length, which is specific for the gene encoding PD-1 , or encoding a PD-1 ligand, and which oligonucleotides can be readily purchased commercially
- carriers such as polyethyleneimine (see Cubillos-Ruiz et al., J. Clin.
- Invest. 1 19(8): 2231-2244 (2009), are readily taken up by cells that express PD-1 as well as ligands of PD-1 and reduce expression of these receptors and ligands to achieve a decrease in inhibitory signal transduction in T-cells, thereby activating T-cells.
- One or more PD-1 antagonists may include a combination of PD-1 antagonists.
- one or more inhibitors of PD-1 , one or more inhibitors of PD-L1 , and/or one or more inhibitors of PD-L2 may be administered.
- One or more of such inhibitors may be an antibody.
- a mixture of inhibitors of PD-1 , PD-L1 , and/or PD-L2 may be used in combination.
- one or more inhibitors of PD-1 and one or more inhibitors of PD-L1 may be administered.
- one or more inhibitors of PD-1 and one or more inhibitors of PD-L2 may be administered.
- one or more inhibitors of PD-1 , one or more inhibitors of PD-L1 , and one or more inhibitors of PD-2 may be administered.
- a mixture or cocktail of inhibitors of the PD-1/PD-L pathway may be administered.
- a cocktail of antibodies to PD-1 , PD-L1 , and/or PD-L2 may be administered.
- Suitable PD-1 pathway antagonists are provided in U.S.
- CTLA4 Cytotoxic T-Lymphocyte Antigen 4
- CD28 CD80 and CD86 on B cells and dendritic cells
- CTLA4 inhibits T-cell functioning.
- CTLA4 blockade releases inhibitory controls on T-cell activation and proliferation, inducing antitumor immunity in both preclinical and early clinical trials (Quezada et al., 2006, J Clin Invest; 1 16: 1935-1945, U.S. Pat. No. 7,229,628).
- Blockade of CTLA4 with anti-CTLA4 antibodies can induce rejection of several types of established transplantable tumors in mice, including colon carcinoma, fibrosarcoma, prostatic carcinoma, lymphoma, and renal carcinoma (Leach et al., 1996, Science; 271 : 1734-1736; Kwon et al., 1997, Proc Natl Acad Sci USA; 94:8099-8103; Yang et al., 1997, Cancer Res; 57:4036-4041 ; Shrikant et al., 1999, Immunity; 1 1 :483-493; and Sotomayor et al., 1999, Proc Natl Acad Sci USA; 96: 11476-1 1481).
- immunomodulators such as anti-CTLA4 can be administered at a lower, less toxic dosage when co-administered with the disclosed PTEN inhibitor compositions.
- Dosages for anti-PD-1 , anti-B7-H1 , and anti-CTLA4 antibody are known in the art and can be in the range of 0.1 to 100 mg/kg, with shorter ranges of 1 to 50 mg/kg preferred and ranges of 10 to 20 mg/kg being more preferred.
- An appropriate dose for a human subject is between 5 and 15 mg/kg, with 10 mg/kg of antibody (for example, human anti-PD-1 antibody) most preferred.
- an anti-CTLA4 antibody useful in the methods of the invention are Ipilimumab, a human anti-CTLA4 antibody, preferably administered at a dose of about 10 mg/kg, and Tremelimumab a human anti-CTLA4 antibody, preferably administered at a dose of about 15 mg/kg. See also Sammartino, et al., Clinical Kidney Journal, 3(2): 135-137 (2010), published online December 2009.
- the antagonist is a small molecule.
- a series of small organic compounds have been shown to bind to the B7-1 ligand to prevent binding to CTLA4 (see Erbe et al., J. Biol. Chem., 277:7363-7368 (2002). Such small organics could be administered alone or together with an anti-CTLA4 antibody to reduce inhibitory signal transduction of T-cells.
- a PTEN inhibitor is administered to a subject in combination with ipilimumab (YERVOY ® ) (e.g., to treat melanoma).
- ipilimumab YERVOY ®
- compositions comprising a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent for improving the efficacy of anti-tumor immunotherapy are provided.
- the compositions are typically pharmaceutical compositions including an effective amount of a PTEN-inhibitor drug.
- the compositions may additionally comprise a vaccine directed against a tumor or a cancer antigen.
- compositions can be supplied as a kit comprising a container that comprises the pharmaceutical composition as described herein.
- a pharmaceutical composition can be provided, for example, in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection.
- such a kit can include a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a pharmaceutical composition.
- a kit can further comprise written information on indications and usage of the pharmaceutical composition.
- B16-OVA is the B16F10 cell line transfected with full-length chicken ovalbumin, clone M04 (see, Falo et al., Nat. Med. 1 , 649-653 (1995)).
- Tumor implantation was performed as described previously (Sharma et al., J. Clin. Invest.
- Tumor volume was calculated from orthogonal diameters using the formula
- mice received approved euthanasia when tumors reached a size of 300 mm 2 ; death was not used a planned endpoint in any study.
- OT-I mice CD8 + , recognizing the SIINFEKL (SEQ ID NO: 1) peptide of ovalbumin (OVA) on H2K (Hogquist et al., Cell 76, 17-27 (1994).)); and pmel-1 mice, B6.Cg-T/7y7 a /CyTg(TcraTcrb)8Rest/J, recognizing a peptide from human gp100 (Overwijk et al., J. Exp. Med. 198, 569-580 (2003)), were obtained from Jackson Laboratory, Bar Harbor, ME. CD8 + effector cells were FACS-sorted from spleens of OT-I or pmel-1 mice.
- CpG-1826 (phosphorothioate oligo 5'-TCCATGACGTTCCTGAGCTT-3' (SEQ ID NO:2)) was synthesized from the published sequence (Chu et al., J. Exp. Med. 186, 1623-1631 (1997)).
- Whole OVA protein was obtained from Sigma (#A-5503).
- Human gp100 25 -33 (KVPRNQDWL (SEQ ID NO:3) was synthesized from the published sequence (Overwijk et al., J. Exp. Med. 198, 569-580 (2003)).
- Vaccines were prepared with 100 ⁇ g of OVA protein or 25 ⁇ g peptide, with 50 ⁇ g CpG-1826 in incomplete Freund's adjuvant (I FA, Sigma F-5506) and administered in the hind-limb footpad. Popliteal lymph nodes (LNs) were harvested 4 days later.
- I FA incomplete Freund's adjuvant
- mice received a carboxyfluorescein succinimidyl ester (CFSE)-labeled cohort of resting CD8 + pmel-1 transgenic T-cells
- CFSE carboxyfluorescein succinimidyl ester
- OT-I or pmel-1 spleen cells were enriched by negative selection using magnetic beads (mouse CD8 isolation kit II, #130-095-236, Miltenyi Biotech). Staining for bead isolation was performed on ice, with short incubation times. Mice received 2* 10 6 enriched CD8 + cells via tail-vein.
- the labeled vaccine-specific resting T-cells were used to determine whether tumor-bearing hosts contained a new, systemic population of activated Tregs in response to vaccine treatment. After vaccine treatment, the transferred T-cells were stained for the differentiation marker granzyme B (GzmB) and CFSE dye dilution and analyzed by FACS. CFSE dye dilution allows tracing of multiple T-cells.
- GzmB differentiation marker granzyme B
- FACS FACS
- mice without B16F10 tumors immunization with cognate antigen generated a robust response in vaccine-draining lymph nodes (VDLNs), driving proliferation of pmel-1 T-cells and up-regulation of the differentiation marker granzyme B.
- VDLNs vaccine-draining lymph nodes
- the presence of a growing B16F10 tumor even at a remote site, caused progressive loss of response to vaccine.
- a second tumor type, E.G7 lymphoma also showed tumor-induced inhibition of vaccine response at distant sites.
- VO-OHpic (Biovision #1801-5) was used at 1 ⁇ in vitro unless otherwise specified and at 10 mg/kg/d in vivo, administered in 10% DMSO.
- lymph nodes were prepared by rapidly passing through a 40 ⁇ mesh, then stained using short incubation times (10 min on ice), as described (Sharma et al., Immunity 38, 998-1012 (2013)). Tumors were disaggregated by treating for 1 hr with 1 mg/mL collagenase (C5138, Sigma), 0.1 mg/mL DNAse (D5025, Sigma), and 0.1 mg/mL hyaluronidase (H3884, Sigma) in RPMI 1640 medium.
- conjugated mAbs were obtained from BD-Pharmingen against: CD86 (clone GL1); CD1 1c (clone HL3); Ly6c (clone AL-21).
- Conjugated antibodies obtained from eBioscience were against: Foxp3 (clone FJK-16s); granzyme B (clone NGZB); PD-L1 (clone MIH5); CD103 (Ber-ACT8) and Ly6c (clone HK1.4).
- Intracellular antigens were detected using fixation-permeabilization reagent and matching perm-wash buffer from eBioscience (Cat. #00-5521), with blocking using 5% normal donkey serum, then acquired immediately after staining.
- Unconjugated anti-Fox03a (rabbit mAb, clone 75D8, Cell Signaling Technology) was used at 4 ⁇ g/ml in perm-wash buffer, and was detected with donkey-anti-rabbit-PE (Jackson ImmunoResearch #711-116- 152) 1 : 100 dilution. All washes were in perm-wash buffer in the cold.
- B16-OVA tumors bearing a nominal ovalbumin transgene were treated with pmel-1/vaccine, with or without VO-OHpic.
- the Ly6c NEG or Ly6c + fraction of DCs was sorted as shown, and tested for ability to present endogenous OVA antigen to OT-I responder cells in vitro.
- control Ly6c NEG DCs were isolated from tumors receiving the same pmel-1 /vaccine treatment but without VO-OHpic, these DCs were suppressive and did not cross-present endogenous tumor antigens effectively.
- FIG. 2A Mice with established B16F10 tumors were treated with a single dose of cyclophosphamide (CTX, 150 mg/kg) or VO-OHpic (10 mg/kg/d) or both, as shown.
- CX cyclophosphamide
- VO-OHpic 10 mg/kg/d
- Example 5 Inhibition of PTEN allows reduction in chemotherapeutic agent dose
- PTEN inhibition allowed the use of lower doses of chemotherapy in mice with established B16F10 tumors (Figs. 4A and 4B).
- a PTEN inhibitor VO- OHpic
- a chemotherapeutic agent cyclophosphamide (CTX)
- CX cyclophosphamide
- CTX tumor regression was seen with only 50 mg/kg of CTX (when PTEN-inhibitor was given). This result is advantageous in chemotherapeutic treatment because 50 mg/kg of CTX is a minimally-toxic dose and much lower than the maximum tolerated dose (MTD) in mice.
- the PTEN inhibitor increased the efficacy of low-dose CTX into the type usually seen with high-dose CTX as a single agent (e.g., 3- to 10-fold higher).
- mice with a BAC-transgenic GFP-Cre fusion protein under the Foxp3 promoter were obtained from Jackson Laboratories (NOD/ShiLt- Tg(Foxp3-EGFP/cre)1Jbs/J) (Zhou et al., J. Exp. Med. 205, 1983-1991 (2008); Zhou et al., Nat. Immunol. 10, 1000-1007 (2009)) and back-crossed onto the B6 background. These were used for intercrosses with floxed alleles
- mice were crossed with mice bearing loxP sites flanking exon 5 of the PTEN gene (Lesche et al., Genesis 32, 148-149 (2002)) (B6.129S4-Pten im1Hw J, Jackson Laboratories). The resulting strain was maintained as hemizygous for the GFP-Cre and homozygous for pten loxP/loxP .
- Tregs in PTEN -KO tumors did not express Fox03a or PD-1 ; instead, they appeared unstable, with many expressing pro-inflammatory markers such as IL-2, CD40L and IL-17 (Fig. 5B, lower panels). All of these "re-programmed" Tregs continued to express residual Foxp3 (Fig. 5B, bottom graph) thus showing that they derived from former Tregs.
- DCs in tumors from PTEN -KO mice also showed a more activated phenotype (Fig. 5D). More DCs expressed an activated myeloid DC phenotype of Ly6c + CD1 1 b + CD103 + , which has been associated with anti-tumor immune surveillance. Many of these CD103 + DCs produced IL-6 (bottom panels). This was significant because IL-6 is a key driver of Treg reprogramming. Similar changes were seen when E.G7 lymphoma tumors were grown in
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Pain & Pain Management (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present disclosure relates to methods for treating a tumor or cancer by administering to a subject a PTEN inhibitor and a chemotherapeutic agent. The subject may be pre-treated with a vaccine that targets or comprises a tumor or cancer antigen or another therapeutic that enhances immune responses. The disclosure also provides compositions related to coadministration of a PTEN inhibitor, a chemotherapeutic and, optionally, a vaccine.
Description
METHODS AND COMPOSITIONS FOR TREATING CANCER
[001] This application claims priority to and benefit of U.S. Provisional Patent Application No. 62/187,438, filed on July 1 , 2015. The contents of this application are herein
incorporated by reference in their entirety.
DESCRIPTION OF THE TEXT FILE SUBMITTED ELECTRONICALLY
[002] The contents of the text file submitted electronically herewith are incorporated herein by reference in their entirety: A computer readable format copy of the Sequence Listing (filename:NEWL_024_01WO_SeqList_ST25, date recorded: June 23, 2016, file size 7, 147 bytes).
STATEMENT REGARDING GOVERNMENT SUPPORT
[003] The invention described herein was made in part with government support under Grant Nos. CA112431 , CA103320 and CA096651 awarded by the National Institutes of Health. The United States government has certain rights in the invention.
FIELD OF THE INVENTION
[004] The field of the invention generally relates to methods and compositions for treating cancers and tumors.
BACKGROUND OF THE INVENTION
[005] Many chemotherapeutic agents have adverse side effects associated with the toxicity of the chemotherapeutic dose required to achieve efficacy. Furthermore, the efficacy is limited by the toxicity of the drug because tumors often regrow before the patient can tolerate another dose of the chemotherapeutic agent. Thus, there is a need for treatments that would allow reducing the chemotherapeutic dose and, optionally, increasing the frequency of the chemotherapeutic dose while maintaining or improving the efficacy of the chemotherapeutic agent.
[006] Many chemotherapeutics kill tumor cells and release antigens from the tumor.
Immune response to these antigens would be beneficial, and would increase the efficacy of chemotherapy, but such immune responses are hindered by suppression of the immune response in the tumor microenvironment. T-cell anergy and the existence of regulatory T- cells contribute to tumor evasion of immune surveillance. In particular, the tumor
microenvironment is profoundly suppressive for anti-tumor T-cell responses, which has generally been considered an intrinsic property of the tumor milieu. Although
immunotherapy offers a promising approach to activating the immune system against
cancer, problems with efficacy and toxicity have hindered its practical application.
Therefore, there remains a need for improved approaches to immunotherapy.
SUMMARY OF THE INVENTION
[007] It is an object of the invention to provide compositions and methods for treating a cancer or a tumor in a subject in need thereof. When combined with a chemotherapeutic agent, a PTEN inhibitor allows a reduction in dose of the chemotherapeutic agent, thus decreasing adverse side effects associated with toxicity. A reduced dose of the
chemotherapeutic agent may be adminstered more frequently.
[008] The invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to reduce the volume of that tumor, wherein the reduction in tumor volume by the combination is greater than the reduction in tumor volume produced by the chemotherapeutic agent administered without any PTEN inhibitor. The efficacy of the combination (e.g., as measured by reduction in tumor volume) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose. The invention further encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering a PTEN inhibitor and a
chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. The chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles. In such multiple cycles, the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered. For example, the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
[009] The invention also encompasses a method of treating cancer in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to treat that cancer, wherein the efficacy in treating cancer by the combination is greater than the efficacy in treating cancer produced by the chemotherapeutic agent administered without any PTEN inhibitor. The efficacy of the combination (e.g., as measured by reduction in a symptom of the cancer) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose. The invention further encompasses a method of treating cancer in a subject in need thereof, the method comprising administering a PTEN inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. The
chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
[0010] In one aspect of the invention, a vaccine that targets or comprises a tumor antigen is administered to a subject in combination with at least one PTEN inhibitor and a
chemotherapeutic agent. In some embodiments, the chemotherapeutic agent is
administered after the vaccine. A PTEN inhibitor may be administered concurrently with the vaccine or concurrently with the chemotherapeutic agent. In certain embodiments, a PTEN inhibitor is administered both concurrently with the vaccine and, later, concurrently with the chemotherapeutic agent. Administration of the vaccine and the chemotherapeutic agent may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about two weeks, at least about three weeks or at least about four weeks.
[0011] The invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising: (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and an antineoplastic chemotherapeutic agent to the subject.
[0012] The invention relates to a method of treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and an antineoplastic chemotherapeutic agent to the subject.
[0013] In any of the disclosed methods, step (ii) may be performed at least about one week, at least about two weeks, at least about three weeks or at least about every four weeks after step (i). In some embodiments, step (ii) is performed 24 hrs to 72 hrs after step (i), 48 hrs to 96 hrs after step (i) or 72 hrs to 120 hrs after step (i). The PTEN inhibitor, the vaccine and the chemotherapeutic agent may be administered to the subject concurrently or sequentially.
[0014] In any of the disclosed methods, step (i) may further comprise administering a PTEN inhibitor to the subject. In such embodiments, the same PTEN inhibitor may be administered to the subject in steps (i) and (ii).
[0015] The vaccine of any of the disclosed methods may target or comprise a tumor antigen from a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor. In one embodiment, the vaccine targets or comprises human gp100, NY-ESO-1 , Mud or EGFR-vlll.
[0016] The PTEN inhibitor of any of the disclosed methods may be a small molecule, a nucleic acid or a protein. In certain embodiments, the PTEN inhibitor may be N-(9, 10- Dioxo-9, 10-dihydrophenanthren-2-yl)-2,2-dimethylpropionamide; or 3,4-Dephostatin, ethyl-. In some embodiments, the PTEN inhibitor is a vanadium complex (e.g., VO-OHpic, also known as [V(=0)(H20)(OHpic)2], see, e.g., Mak et al., J. Chem. Biol. 3: 157-163 (2010)).
[0017] The disclosed methods may be used to treat a refractory tumor or a tumor with particularly low immunogenicity.
[0018] In some embodiments, the tumor treated by the disclosed methods is a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor. In some embodiments, the cancer treated by the disclosed methods is lung cancer, breast cancer, ovarian cancer, brain cancer, pancreatic cancer, colon cancer or melanoma.
[0019] Optionally, the disclosed method further comprises (iii) at least about two weeks after step (ii), administering the vaccine that targets or comprises a tumor antigen to the subject; and (iv) after step (iii), administering a PTEN inhibitor and the chemotherapeutic agent to the subject. Step (iv) may be performed at least about one week or at least about two weeks after step (iii). The PTEN inhibitor and the chemotherapeutic agent of step (iv) may be administered to the subject concurrently or sequentially. Step (iii) may further comprise administering a PTEN inhibitor to the subject. In such embodiments, the same PTEN inhibitor may be administered to the subject in steps (iii) and (iv). The combination of a PTEN inhibitor, a chemotherapeutic agent, and, optionally, a vaccine may be administered to a subject in multiple cycles (e.g., steps (iii) and (iv) may be repeated). The number of cycles may be at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9
or at least 10. In some cases, a subject may be treated with such cycles indefinitely, as long as the treatment remains effective.
[0020] These and other embodiments and/or other aspects of the invention will become evident upon reference to the following detailed description of the invention and the attached drawings.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] Figure 1A shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on B16F10 tumor volume in wild-type mouse hosts. The upper part of the figure shows the sequence of treatment with pmel-1 T- cells, hgp100 vaccine and the VO-OHpic PTEN inhibitor (also known as
[V(=0)(H20)(OHpic)2], see, e.g., Mak et al., J. Chem. Biol. 3: 157-163 (2010)). Human gp10025-33 had the sequence of KVPRNQDWL (SEQ ID NO:3). The lower part of the figure is a graph showing the changes in tumor volume (mm3) in groups that were treated with (1) pmel-1/vaccine; (2) pmel-1 /vaccine and VO-OHpic; or (3) nothing.
[0022] Figure 1 B shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on E.G7 tumor volume in wild-type mouse hosts. The upper part of the figure shows the sequence of treatment with OT-I T-cells, OVA vaccine and the VO-OHpic PTEN inhibitor. The lower part of the figure is a graph showing the changes in tumor volume (mm3) in groups that were treated with (1) OT-l/vaccine; (2) OT-l/vaccine and VO-OHpic; or (3) nothing.
[0023] Figure 1C shows the results of an experiment studying the effects of vaccine treatment and pharmacologic inhibition of PTEN on the intratumoral milieu in a B16F10 mouse tumor model. The figure includes FACS analysis scatter plots showing loss of Fox03a expression in regulatory T-cells (Tregs) (top panel); proliferation of
carboxyfluorescein succinimidyl ester (CFSE)-labeled effector cells (pmel-1 cells) within the tumor (second panel from the top); and emergence of activated Ly6c+CD11 b+ myeloid DCs (dendritic cells) (third panel from the top) and an inflammatory milieu with DCs expressing high levels of CD86 and low levels of PD-L1 (fourth panel from the top) in mice treated with pmel-1/vaccine and VO-OHpic. The pie charts in the bottom panel summarize the CD86 and PD-L1 expression data directly above. The figure is representative of 5 experiments using both B16F10 and E.G7 tumors.
[0024] Figure 1 D shows the results of an experiment comparing endogenous tumor antigen presentation by DCs (dendritic cells) in B16-OVA mouse tumor models treated with (1) pmel- 1 T-cells, hgp100 vaccine and VO-OHpic or (2) pmel-1 T-cells and hgp100 vaccine. Ly6c+ and Ly6cNEG cells were sorted and the SIINFEKL (SEQ ID NO: 1) peptide was added as shown. The DCs were tested for ability to present endogenous OVA antigen to OT-I responder cells in vitro. DCs from mice treated with pmel-1 T-cells, hgp100 vaccine and VO- OHpic were able to robustly cross-present endogenous tumor antigen acquired in vivo. DCs from mice treated with pmel-1 T-cells and hgp100 vaccine without VO-OHpic were suppressive and did not cross-present endogenous tumor antigens effectively.
[0025] Figure 2A shows the results of experiments studying the effects of pharmacologic inhibition of PTEN and chemotherapy on B16F10 tumor volume in wild-type mouse hosts. The upper part of the figure shows the sequence of treatment with CTX (cyclophosphamide) and the VO-OHpic PTEN inhibitor. The lower part of the figure is a graph showing the changes in tumor volume (mm3) in groups that were treated with (1) CTX; (2) VO-OHpic; or (3) CTX and VO-OHpic. The figure shows pooled data from 5 independent experiments; n=10-16 tumors in each group; bars show standard deviation.
[0026] Figure 2B shows the results of a FACS analysis of cells in B16F10 tumors treated with (1) CTX (cyclophosphamide); (2) CTX and VO-OHpic; or (3) nothing, analyzed four days after treatment with CTX. Addition of VO-OHpic to CTX treatment abrogated Fox03a expression in Tregs, down-regulated PD-L1 , and increased the number of inflammatory Ly6c+CD11 b+ CD1 1c+ DCs. Call-out shows gated CD11 c+ DCs from the CTX+ VO-OHpic group showing co-expression of CD103. The pie charts in the bottom panel summarize the CD86 and PD-L1 expression data directly above. The figure shows pooled data from 5 independent experiments; n=10-16 tumors in each group; bars show standard deviation.
[0027] Figure 2C shows the results of an experiment studying the contribution of the adaptive immune response to B16F10 tumor regression in mice. Rag1-KO hosts (lacking an adaptive immune system) or WT (wild-type) B6 controls were treated with CTX
(cyclophosphamide) plus concurrent VO-OHpic. The figure shows a mean of 16 tumors from 2 independent experiments. Bars show standard deviation; bars in WT group are smaller than the symbols.
[0028] Figure 3 shows the results of an experiment studying the effects of vaccine treatment, pharmacologic inhibition of PTEN and chemotherapy on Lewis Lung Carcinoma tumor cells stably transfected with the gp100 nominal tumor antigen (LLC-gp100). Tumor volume is shown in wild-type mouse hosts. The upper part of the figure shows the sequence of treatment with hgp100 vaccine, the VO-OHpic PTEN inhibitor and CTX
(cyclophosphamide). The lower part of the figure is a graph showing the changes in tumor volume (mm3) in groups that were treated with (1) vaccine and CTX; (2) vaccine and VO- OHpic; (3) vaccine, VO-OHpic and CTX; or (4) VO-OHpic and CTX. CpG-1826
(phosphorothioate oligo 5'-TCCATGACGTTCCTGAGCTT-3' (SEQ ID NO:2)) was synthesized from the published sequence (Chu et al., J. Exp. Med. 186, 1623-1631 (1997)).
[0029] Figure 4A is a graph showing a hypothetical model of increased chemotherapy efficacy at a lower dose when combined with a PTEN inhibitor. The combination of both drugs creates a greater anti-tumor effect than could be achieved even by a maximum tolerated dose (MTD) of chemotherapy; and this increased efficacy occurs at a low dose of chemotherapy, which by itself would have minimal effect.
[0030] Figure 4B shows the results of an experiment studying the effects of pharmacologic inhibition of PTEN and chemotherapy on B16F10 tumor volume in wild-type mouse hosts. Mice with B16F10 tumors were treated with 0 or 10 mg/kg VO-OHpic (PTEN inhib.) at days 9, 10, 1 1 , 12, and 13 and with 0, 25, 50, or 150 mg/kg cyclophosphamide (CTX;
chemotherapeutic agent) at day 10, as shown in the table in Fig. 4B. The combination of a PTEN inhibitor (VO-OHpic) and a chemotherapeutic agent (cyclophosphamide (CTX)) given at a dose of 50 mg/kg created a greater anti-tumor effect than could be achieved even by a higher dose (150mg/kg) of the chemotherapeutic agent used alone.
[0031] Figure 5A is a graph showing the growth of B16F10 tumors in PTENTre9-KO hosts and WT B6 hosts. Tumor volume (mm3) is shown on the y-axis. Pooled data from 4 experiments, n=6-8 tumors per time-point. *p<.05 vs. WT, and all points thereafter.
[0032] Figures 5B, 5C, and 5D show the results of experiments analyzing tumor-infiltrating immune cells in B16F10 tumors after 10 days of tumor growth in either PTENTre9-KO or parental Foxp3-GFP-Cre hosts. (Figure 5B) Tregs; (Figure 5C) CD8+ T cells (Figure 5D) CD1 1c+ DCs. Representative of a total of 9 experiments on days 10, 15 and 22. Intracellular cytokines were measured after 4 hr activation with PMA/ionomycin.
[0033] Figures 6A, 6B, and 6C show the results of experiments analyzing the inflammatory intra-tumoral milieu in E.G7 lymphoma tumors grown in PTENTre9-KO hosts. The changes in Tregs (Figure 6A), CD8+ cells (Figure 6B) and DCs (Figure 6C) in these tumors were similar to those seen in B16F10 tumors (see Figures 5B, 5C, and 5D).
DETAILED DESCRIPTION OF THE INVENTION
[0034] The disclosure provides methods for treating a subject in need thereof with a combination of a PTEN inhibitor and a chemotherapeutic agent. A PTEN inhibitor increases the efficacy of a chemotherapeutic agent and surprisingly allows a reduction in the dose of
the chemotherapeutic agent. The reduced dose provides the advantage of decreased side effects associated with toxicity of a chemotherapeutic agent and may be administered more frequently. In the case of tumors and cancers, more frequent doses are advantageous because they may be given before the tumor or cancer regrows.
[0035] A PTEN inhibitor may also be administered in combination with a chemotherapeutic agent and a vaccine directed to or comprising a tumor or a cancer antigen. A PTEN inhibitor surprisingly improves the efficacy of the chemotherapeutic agent and the vaccine.
[0036] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited herein, including but not limited to patents, patent applications, articles, books, and treatises, are hereby expressly incorporated by reference in their entirety for any purpose. In the event that one or more of the incorporated documents or portions of documents define a term that contradicts that term's definition in the application, the definition that appears in this application controls. However, mention of any reference, article, publication, patent, patent publication, and patent application cited herein is not, and should not be taken as an acknowledgment, or any form of suggestion, that they constitute valid prior art or form part of the common general knowledge in any country in the world.
[0037] In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. As used herein, "about" means ± 20% of the indicated range, value, or structure, unless otherwise indicated. It should be understood that the terms "a" and "an" as used herein refer to "one or more" of the enumerated components unless otherwise indicated. The use of the alternative (e.g., "or") should be understood to mean either one, both, or any combination thereof of the alternatives. As used herein, the terms "include" and "comprise" are used synonymously.
[0038] As used herein, the terms "treat," "treating," "treatment" and "therapeutic use" refer to the elimination, reduction or amelioration of one or more symptoms of a disease or disorder. As used herein, a "therapeutically effective amount" refers to that amount of a therapeutic agent sufficient to mediate a clinically relevant elimination, reduction or amelioration of such symptoms. An effect is clinically relevant if its magnitude is sufficient to impact the health or prognosis of a recipient subject. A therapeutically effective amount may refer to the amount of therapeutic agent sufficient to delay or minimize the onset of disease, e.g. , delay or minimize the spread of cancer. A therapeutically effective amount may also refer to the
amount of the therapeutic agent that provides a therapeutic benefit in the treatment or management of a disease.
[0039] As used herein, the term "cancer" refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells. As used herein, cancer explicitly includes, leukemias and lymphomas. The term "cancer" refers to a disease involving cells that have the potential to metastasize to distal sites and exhibit phenotypic traits that differ from those of non-cancer cells, for example, formation of colonies in a three-dimensional substrate such as soft agar or the formation of tubular networks or web-like matrices in a three-dimensional basement membrane or extracellular matrix preparation. Non-cancer cells do not form colonies in soft agar and form distinct sphere-like structures in three-dimensional basement membrane or extracellular matrix preparations.
[0040] As used herein, an "immune cell" refers to any cell from the hemopoietic origin including, but not limited to, T-cells, B cells, monocytes, dendritic cells, and macrophages.
[0041] As used herein, the terms "immunologic," "immunological" or "immune" response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T-cells or their secretion products) response directed against a peptide in a recipient patient. Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells. A cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules to activate antigen-specific CD4+ T helper cells and/or CD8+ cytotoxic T-cells. The response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity. The presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T-cells) or CTL (cytotoxic T lymphocyte) assays. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating antibodies and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
[0042] As used herein, an "immunogenic agent" or "immunogen" is capable of inducing an immunological response against itself on administration to a mammal, optionally in conjunction with an adjuvant.
[0043] As used herein, the terms "individual," "host," "subject" and "patient" are used interchangeably, and refer to a mammal, including, but not limited to, humans, non-human primates, rodents, such as mice and rats, and other laboratory animals.
[0044] As used herein, the term "polypeptide" refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation). The term polypeptide includes proteins and fragments thereof. The polypeptides can be "exogenous," meaning that they are "heterologous," i.e., foreign to the host cell being utilized, such as human polypeptide produced by a bacterial cell. Polypeptides are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gin, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (lie, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M),
Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).
[0045] As used herein, the term "variant" refers to a polypeptide or polynucleotide that differs from a reference polypeptide or polynucleotide, but retains essential properties. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical. A variant and reference polypeptide may differ in amino acid sequence by one or more modifications (e.g., substitutions, additions, and/or deletions). A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polypeptide may be naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally.
[0046] Modifications and changes can be made in the structure of the polypeptides of the disclosure and still obtain a molecule having similar characteristics as the polypeptide (e.g., a conservative amino acid substitution). For example, certain amino acids can be substituted for other amino acids in a sequence without appreciable loss of activity.
Because it is the interactive capacity and nature of a polypeptide that defines that polypeptide's biological functional activity, certain amino acid sequence substitutions can be made in a polypeptide sequence and nevertheless obtain a polypeptide with like properties.
[0047] In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. Those
indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8);
cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (- 3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
[0048] It is believed that the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and cofactors. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within ± 2 is preferred, those within ± 1 are particularly preferred, and those within ± 0.5 are even more particularly preferred.
[0049] Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly where the biological functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments. The following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ± 1); glutamate (+3.0 ± 1); serine (+0.3); asparagine (+0.2); glutamnine (+0.2); glycine (0); proline (-0.5 ± 1); threonine (-0.4); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an
immunologically equivalent polypeptide. In such changes, the substitution of amino acids whose hydrophilicity values are within ± 2 is preferred, those within ± 1 are particularly preferred, and those within ± 0.5 are even more particularly preferred.
[0050] As outlined above, amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take various foregoing characteristics into consideration are well known to those of skill in the art and include (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gin, His), (Asp: Glu, Cys, Ser), (Gin: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gin), (lie: Leu, Val), (Leu: lie, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: lie, Leu). Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above. In particular, embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to the polypeptide of interest.
[0051] The term "percent (%) sequence identity" is defined as the percentage of nucleotides or amino acids in a candidate sequence that are identical with the nucleotides or amino acids in a reference nucleic acid sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
[0052] For purposes herein, the % sequence identity of a given nucleotides or amino acids sequence C to, with, or against a given nucleic acid sequence D (which can alternatively be phrased as a given sequence C that has or comprises a certain % sequence identity to, with, or against a given sequence D) is calculated as follows:
100 times the fraction W/Z,
[0053] where W is the number of nucleotides or amino acids scored as identical matches by the sequence alignment program in that program's alignment of C and D, and where Z is the total number of nucleotides or amino acids in D. It will be appreciated that where the length of sequence C is not equal to the length of sequence D, the % sequence identity of C to D will not equal the % sequence identity of D to C.
[0054] As used herein, the term "pharmaceutically acceptable carrier" encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water and emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents.
[0055] Typically, the disclosed methods of reducing tumor volume or treating cancer include administering to a subject in need thereof an effective amount of a PTEN inhibitor in combination with a chemotherapeutic agent and, optionally, a vaccine (e.g., a vaccine directed to or comprising a tumor antigen or a cancer antigen). The disclosed methods may increase the efficacy of a chemotherapeutic (e.g., an antineoplastic) agent.
[0056] The invention encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to reduce the volume of that tumor, wherein the reduction in tumor volume by the combination is greater than the reduction in tumor volume produced by the chemotherapeutic agent administered without any PTEN inhibitor. The efficacy of the combination (e.g., as measured by reduction in tumor volume)
may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose. The invention further encompasses a method of reducing tumor volume in a subject in need thereof, the method comprising administering a PTEN inhibitor and a
chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. The chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles. In such multiple cycles, the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered. For example, the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
[0057] The invention also encompasses a method of treating cancer in a subject in need thereof, the method comprising administering to the subject a PTEN inhibitor and a chemotherapeutic agent given at the standard dose used to treat that cancer, wherein the efficacy in treating cancer by the combination is greater than the efficacy in treating cancer produced by the chemotherapeutic agent administered without any PTEN inhibitor. The efficacy of the combination (e.g., as measured by reduction in a symptom of the cancer) may be increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the efficacy of the chemotherapeutic agent administered alone at the same dose. The invention further encompasses a method of treating cancer in a subject in need thereof, the method comprising administering a PTEN inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor. The PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. The
chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least
about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor. As described above, the PTEN inhibitor and the reduced dose of chemotherapeutic agent may be administered to the subject in multiple cycles. In such multiple cycles, the reduced dose of chemotherapeutic agent may be administered more frequently than the standard dose is administered. For example, the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
[0058] In one aspect of the invention, the chemotherapeutic agent is administered to a subject concurrently with a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor. In some embodiments, the chemotherapeutic agent is administered after the vaccine. A PTEN inhibitor may be administered concurrently with the vaccine or concurrently with the chemotherapeutic agent. In certain embodiments, a PTEN inhibitor is administered both concurrently with the vaccine and, later, concurrently with the chemotherapeutic agent. In one embodiment, the invention encompasses a method of reducing tumor size or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a
chemotherapeutic (e.g., an antineoplastic) agent to the subject. In another embodiment, the invention encompasses a method of reducing tumor size or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., an antineoplastic) agent to the subject.
[0059] The methods can be used in vivo or ex vivo in cancer treatment applications. In general, the combination of a PTEN inhibitor, a chemotherapeutic agent and a vaccine can be used for treating a subject having or being predisposed to any tumor-related or cancer- related antigen. The methods and compositions of the invention allow a reduction in chemotherapeutic agent dose compared to the dose of the same chemotherapeutic agent used as a standard of care without a PTEN inhibitor. The reduced dose exhibits decreased adverse side effects and may be administered more frequently.
[0060] The disclosed methods and compositions can be used to treat cancer or reduce tumor volume in a subject in need thereof. In some embodiments, the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a chemotherapeutic (e.g., an antineoplastic) agent to the
subject; and (ii) after step (i), administering a PTEN inhibitor and a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject. In some embodiments, the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., an antineoplastic) agent to the subject. In some embodiments, the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method comprising: (i) administering a chemotherapeutic (e.g., an antineoplastic) agent and a PTEN inhibitor to the subject; and (ii) after step (i), administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen to the subject. In other embodiments, the invention relates to a method of reducing tumor volume or treating cancer in a subject in need thereof, the method
comprising: (i) administering a vaccine that is directed to or comprises a tumor antigen or a cancer antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., an antineoplastic) agent to the subject. In further embodiments, a PTEN inhibitor is administered in both step (i) and step (ii).
[0061] The disclosed methods are useful for treating refractory tumors or tumors that exhibit particularly low immunogenicity. The types of cancer and tumor that may be treated with the provided compositions and methods include, but are not limited to, prostate, colorectum, pancreas, cervix, stomach, endometrium, brain, liver, bladder, ovary, testis, head, neck, skin, melanoma, basal carcinoma, mesothelial lining, white blood cells, lymphoma, leukemia, and other hematological cancers, esophagus, breast, muscle, esophageal, nasopharangeal, uterine, connective tissue, lung, small-cell lung carcinoma, non-small-cell lung carcinoma, adrenal gland, thyroid, kidney, or bone; glioblastoma, mesothelioma, renal cell carcinoma, gastric carcinoma, sarcoma, choriocarcinoma, cutaneous basocellular carcinoma, and testicular seminoma.
[0062] Malignant tumors which may be treated are classified herein according to the embryonic origin of the tissue from which the tumor is derived. Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands. Sarcomas, which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage. The leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer.
[0063] Many pathogens are associated with inducing cancer via chronic infection and inflammation (e.g., HCV, HPV and bacteria such as H. pylori). Accordingly, in some
embodiments, the cancer is caused by a pathogen, and/or the result of an infection or inflammation. In a particular embodiment, the cancer is hepatocellular carcinoma.
[0064] Adoptive T-cell therapy may be used with the methods of the invention. The disclosed methods can be used to treat T-cells ex vivo. One embodiment provides a method for treating cancer by administering an inhibitor of PTEN in combination with a vaccine and a chemotherapeutic agent to overcome T-cell exhaustion and/or T-cell anergy. The adoptive T-cell transfer can be administered to the subject prior to or following administration of the agent.
[0065] Antigen-specific T-cell lines can be generated by in vitro stimulation with antigen followed by nonspecific expansion (for example, on CD3/CD28 beads). The ability to expand antigen-specific T-cells can be assessed using IFN-gamma and granzyme B enzyme-linked immunosorbent spot. The phenotype of the resultant T-cell lines can be evaluated by flow cytometry, for example, by monitoring for the presence of FOXP3-expressing CD4(+) T- cells. Amplification of antigen-specific T-cell populations from Peripheral Blood Mononuclear Cells (PBMCs) is usually performed through repeated in vitro stimulation with optimal length antigenic peptides in the presence of a cytokine (e.g., IL-2). Low doses of IL-2 (between 10 and 50 U/ml) have been used traditionally to avoid the activation/expansion of lymphokine- activated killer cells, as revealed in chromium release assays that were commonly employed to monitor specific T-cell expansion. Concentrations of antigenic peptides can be 0.1-10 μΜ.
[0066] In the methods and compositions of the invention, the active agents (e.g., PTEN inhibitors, vaccines, and chemotherapeutic agents) are typically administered to a subject in need thereof in an effective amount. For example, the active agents can be administered in a dosage sufficient reduce or prevent a least one, two, three, or more symptoms of the cancer, or to otherwise provide a desired pharmacologic and/or physiologic effect. The symptom may be physical or biological. For example, in the context of cancer treatment, the symptom may be physical, such as tumor burden, or biological such as proliferation of cancer cells. In some embodiments, the amount is effective to increase the killing of tumor cells or inhibit proliferation or metastasis of tumor cells. In some embodiments, the amount is effective to reduce tumor burden. In some embodiments, the amount is effective to reduce or prevent at least one comorbidity of a cancer.
[0067] In some embodiments, the effect of the active agent on a subject is compared to a control. For example, the effect of the active agent on a particular symptom, pharmacologic, or physiologic indicator can be compared to an untreated subject, or the condition of the subject prior to treatment. In some embodiments, the symptom, pharmacologic, or
physiologic indicator is measured in a subject prior to treatment, and again one or more times after treatment is initiated. In some embodiments, the control is a reference level, or average determined based on measuring the symptom, pharmacologic, or physiologic indicator in one or more subjects that do not have the disease or condition to be treated (e.g., healthy subjects).
[0068] In some embodiments, the effect of the treatment is compared to a conventional treatment that is known in the art, such as one of those discussed herein. Co-administration of a PTEN inhibitor allows a reduction of the dose of the chemotherapeutic agent used as the standard of care (e.g., for human patients) or the maximum tolerated dose (MTD) without a PTEN inhibitor. Standard dose ranges for specific chemotherapy drugs are known to those skilled in the art. Doses of different chemotherapeutic agents vary, depending on the tumor type and on concomitant administration of other chemotherapy drugs, but
recommended doses are usually strictly followed. These doses are taught by published literature, based on controlled clinical trials, and also by sources such as the approved dose on package inserts approved for marketing in various countries. Because chemotherapy drugs almost always have a strong dose-response relationship, the standard-of-care doses are chosen to be as high as possible within the limitation of unacceptable toxicity to the patient. Lower doses than the standard-of-care doses would be expected to produce lower efficacy. However, the disclosed methods allow a reduction in the chemotherapeutic dose while maintaining, or even improving, the chemotherapeutic agent efficacy. Even modestly lower doses of chemotherapy often produce much lower toxicity in the patient (threshold effect). Thus, in a given clinical setting, the ability to reduce the standard dose of a chemotherapy drug by even a modest percentage, while maintaining equal or superior efficacy, is of great value to the patient. The chemotherapeutic agent may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume (or to treat cancer) or the MTD when the chemotherapeutic agent is administered without any PTEN inhibitor. The reduced dose of the chemotherapeutic agent may maintain the same efficacy (or an improved efficacy) in reducing tumor volume or treating cancer as the standard of care dose.
[0069] The precise dosage of a PTEN inhibitor, a chemotherapeutic agent and a vaccine will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, clinical symptoms etc.). In general, the doses may range from about 1 ng/kg to 100 mg/kg for a typical subject, with exemplary shorter ranges being 1 to 50 mg/kg and 10 to 20 mg/kg. Such doses may be repeated. The dose will be correlated with the identity of the mammal receiving said dose. Doses in the above-recited mg/kg ranges
are convenient for mammals, including rodents, such as mice and rats, and primates, especially humans.
[0070] The timing of the administration of various components of the disclosed methods and compositions will depend on the formulation and/or route of administration used. In some embodiments, administration is given as a long-term treatment regimen whereby
pharmacokinetic steady state conditions will be reached.
[0071] The data obtained from cell culture assays and animal studies can be used to formulate a dosage range for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration. For any compound, the therapeutically effective dose can be estimated initially from cell culture assays. A dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma can be measured, for example, by high performance liquid chromatography (HPLC).
[0072] The invention encompasses a treatment regimen comprising multiple cycles of administering a PTEN inhibitor, a chemotherapeutic agent, and, optionally, a vaccine that targets or comprises a tumor antigen to a subject in need thereof. The number of cycles may be at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10. In some cases, a subject may be treated with such cycles indefinitely, as long as the treatment remains effective. The cycles may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about ten days, at least about two weeks, at least about three weeks or at least about four weeks.
[0073] In some embodiments, the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject. In further embodiments, the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a chemotherapeutic (e.g., antineoplastic) agent to the subject. In some embodiments, the disclosed method comprises (i) administering a vaccine that targets or comprises a tumor antigen and a PTEN inhibitor to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject. In such embodiments, the same PTEN inhibitor may be administered to the subject
in steps (i) and (ii). In step (i) of these multistep regimens, the PTEN inhibitor and the vaccine may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the vaccine are administered sequentially, either the PTEN inhibitor or the vaccine may be administered first. Step (ii) may be performed at least about 1 week, at least about 2 weeks, at least about 3 weeks or at least about 4 weeks after step (i). In step (ii), the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the chemotherapeutic agent are administered sequentially, either the PTEN inhibitor or the chemotherapeutic agent may be administered first.
[0074] The PTEN inhibitor, vaccine, and chemotherapeutic agent (and optional additional active agents) can be administered as part of a therapeutic regimen. A treatment regimen of the combination therapy can include one or multiple administrations of the PTEN inhibitor. In some embodiments, the vaccine, PTEN inhibitor and chemotherapeutic agent may be administered to the patients in multiple rounds. These rounds (e.g., administration of the vaccine and the chemotherapeutic agent) may be separated by 24 hrs to 72 hrs, 48 hrs to 96 hrs, or 72 hrs to 120 hrs, or by at least one week, at least about ten days, at least about two weeks, at least about three weeks or at least about four weeks. For example, the disclosed method may comprise (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject; (iii) at least about two weeks after step (ii), administering the vaccine to the subject; and (iv) after step (iii), administering a PTEN inhibitor and the chemotherapeutic (e.g., antineoplastic) agent to the subject. In some embodiments, the disclosed method may comprise (i) administering a vaccine that targets or comprises a tumor antigen to the subject; and (ii) after step (i), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject; (iii) administering the vaccine and a PTEN inhibitor to the subject; and (iv) after step (iii), administering a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent to the subject. In such embodiments, the same PTEN inhibitor may be administered to the subject in steps (iii) and (iv). In step (iii), the PTEN inhibitor and the vaccine may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the vaccine are administered sequentially, either the PTEN inhibitor or the vaccine may be administered first. Step (iv) may be performed at least about 1 week, at least about 10 days, at least about 2 weeks, at least about 3 weeks, or at least about 4 weeks after step (iii). In step (iv), the PTEN inhibitor and the chemotherapeutic agent may be administered to the subject concurrently or sequentially. If the PTEN inhibitor and the chemotherapeutic agent are administered
sequentially, either the PTEN inhibitor or the chemotherapeutic agent may be administered first.
[0075] In some embodiments, the disclosed methods include administering a subject in need thereof an effective amount of one or more additional active agents, for example, a PD- 1 or CTLA4 antagonist or other immunomodulator in either step (i), (ii), (iii) and/or (iv). In some embodiments, the PTEN inhibitor and the one or more additional active agents are administered to the subject separately, but simultaneously. The PTEN inhibitor and the additional active agent(s) can also be administered as part of the same composition. In other embodiments, the PTEN inhibitor and the additional active agent(s) are administered separately and at different times, but as part of the same treatment regimen. If the PTEN inhibitor is administered first, the additional active agent(s) can be administered second. Likewise, if the additional active agent(s) is administered first, the PTEN inhibitor can be administered second.
[0076] Dosage regimens or cycles of the agents can be completely, or partially overlapping, or can be sequential. For example, in some embodiments, all such administration(s) of the PTEN inhibitor occur before or after administration of the chemotherapeutic agent.
Alternatively, administration of one or more doses of the PTEN inhibitor can be temporally staggered with the administration of the chemotherapeutic agent to form a uniform or nonuniform course of treatment whereby one or more doses of PTEN inhibitor are administered, followed by one or more doses of the chemotherapeutic agent, followed by one or more doses of PTEN inhibitor; or one or more doses of the chemotherapeutic agent are administered, followed by one or more doses of PTEN inhibitor, followed by one or more doses of the chemotherapeutic agent; etc., all according to whatever schedule is selected or desired by the researcher or clinician administering the therapy.
[0077] An effective amount of each of the agents can be administered as a single unit dosage (e.g., as dosage unit), or sub-therapeutic doses that are administered over a finite time interval. Such unit doses may be administered on a daily basis for a finite time period, such as up to 3 days, or up to 5 days, or up to 7 days, or up to 10 days, or up to 15 days or up to 20 days or up to 25 days, are all specifically contemplated by the invention.
[0078] The invention relates to methods of treatment that comprise administering to a subject a pharmaceutical composition comprising an effective amount of at least one PTEN inhibitor. Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase ("PTEN" and also referred to as MMAC1 , TEP1 , phosphatase and tensin homolog, and phosphatase and tensin homolog deleted on chromosome 10) is a dual- specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine-
phosphorylated protein. PTEN is also a lipid phosphatase that removes the phosphate in the D3 position of the inositol ring from phosphatidylinositol 3,4,5-trisphosphate,
phosphatidylinositol 3,4-diphosphate, phosphatidylinositol 3-phosphate and inositol 1 ,3,4,5- tetrakisphosphate.
[0079] Amino acid and nucleic acid sequences for PTEN are known in the art. See, for example, UniProt Accession No. P60484, which provides the canonical amino acid sequence including:
MTAI IKEIVSRNKRRYQEDGFDLDLTYIYPNI IAMGFPAERLEGVYRNNIDDVVRFLDSK HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY LLK HLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI DSICSIERADNDKEYLVLTLTKNDLDKANKDKA RYFSPNFKVKLYF KTVEEPSNPEAS SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
(SEQ ID NO:4) (UniProt Accession No. P60484 (PTEN_HUMAN)), which can be encoded by the nucleic acid sequence:
GAATTCGGCACGAGGTGAGGCGAGGCCGGGCTCAGGCGAGGGAGATGAGAGACGGCGGCG GCCGCGGCCCGGAGCCCCTCTCAGCGCCTGTGAGCAGCCGCGGGGGCAGCGCCCTCGGGG AGCCGGCCGGCCTGCGGCGGCGGCAGCGGCGGCGTTTCTCGCCTCCTCTTCGTCTTTTCT AACCGTGCAGCCTCTTCCTCGGCTTCTCCTGAAAGGGAAGGTGGAAGCCGTGGGCTCGGG CGGGAGCCGGCTGAGGCGCGGCGGCGGCGGCGGCACCTCCCGCTCCTGGAGCGGGGGGGA GAAGCGGCGGCGGCGGCGGCCGCGGCGGCTGCAGCTCCAGGGAGGGGGTCTGAGTCGCCT GTCACCATTTCCAGGGCTGGGAACGCCGGAGAGTTGGTCTCTCCCCTTCTACTGCCTCCA ACACGGCGGCGGCGGCGGCGGCACATCCAGGGACCCGGGCCGGTTTTAAACCTCCCGTCC GCCGCCGCCGCACCCCCCGTGGCCCGGGCTCCGGAGGCCGCCGGCGGAGGCAGCCGTTCG GAGGATTATTCGTCTTCTCCCCATTCCGCTGCCGCCGCTGCCAGGCCTCTGGCTGCTGAG GAGAAGCAGGCCCAGTCGCTGCAACCATCCAGCAGCCGCCGCAGCAGCCATTACCCGGCT GCGGTCCAGAGCCAAGCGGCGGCAGAGCGAGGGGCATCAGCTACCGCCAAGTCCAGAGCC ATTTCCATCCTGCAGAAGAAGCCCCGCCACCAGCAGCTTCTGCCATCTCTCTCCTCCTTT TTCTTCAGCCACAGGCTCCCAGACATGACAGCCATCATCAAAGAGATCGTTAGCAGAAAC AAAAGGAGATATCAAGAGGATGGATTCGACTTAGACTTGACCTATATTTATCCAAACATT ATTGCTATGGGATTTCCTGCAGAAAGACTTGAAGGCGTATACAGGAACAATATTGATGAT GTAGTAAGGTTTTTGGATTCAAAGCATAAAAACCATTACAAGATATACAATCTTTGTGCT GAAAGACATTATGACACCGCCAAATTTAATTGCAGAGTTGCACAATATCCTTTTGAAGAC CATAACCCACCACAGCTAGAACTTATCAAACCCTTTTGTGAAGATCTTGACCAATGGCTA AGTGAAGATGACAATCATGTTGCAGCAATTCACTGTAAAGCTGGAAAGGGACGAACTGGT
GTAATGATATGTGCATATTTATTACATCGGGGCAAATTTTTAAAGGCACAAGAGGCCCTA
GATTTCTATGGGGAAGTAAGGACCAGAGACAAAAAGGGAGTAACTATTCCCAGTCAGAGG CGCTATGTGTATTAT A AGCTACCTGTTAAAGAATCATCTGGAT A AGACCAGTGGCA CTGTTGTTTCACAAGATGATGTTTGAAACTATTCCAATGTTCAGTGGCGGAACTTGCAAT CCTCAGTTTGTGGTCTGCCAGCTAAAGGTGAAGATATATTCCTCCAATTCAGGACCCACA CGACGGGAAGACAAGTTCATGTACTTTGAGTTCCCTCAGCCGTTACCTGTGTGTGGTGAT ATCAAAGTAGAGTTCTTCCACAAACAGAACAAGATGCTAAAAAAGGACAAAATGTTTCAC TTTTGGGTAAATACATTCTTCATACCAGGACCAGAGGAAACCTCAGAAAAAGTAGAAAAT GG AAGT C AT GT GAT C AAGAAAT C GAT AGC AT T T GC AGT AT AGAGC GT GC AG AT AAT G AC AAGGAATAT C T AGT AC T T AC T T T AAC AAAAAAT G AT CT T G AC AAAGC AAAT AAAGAC AAA GCCAACCGATACTTTTCTCCAAATTTTAAGGTGAAGCTGTACTTCACAAAAACAGTAGAG GAGCCGTCAAATCCAGAGGCTAGCAGTTCAACTTCTGTAACACCAGATGTTAGTGACAAT GAACCTGATCATTATAGATATTCTGACACCACTGACTCTGATCCAGAGAATGAACCTTTT GATGAAGATCAGCATACACAAATTACAAAAGTCTGAATTTTTTTTTATCAAGAGGGATAA AAC AC C AT G AAAAT AAAC T T G AAT AAAC T G AAAAAAAAAAAAAAAAAAA
(SEQ ID NO:5) (ENA Sequence No. U96180.1 (Human protein tyrosine phosphatase (TEP1) mRNA, complete cds)).
[0080] As used herein, "PTEN inhibitor" refers to agents that directly reduce, block, inhibit, prevent or suppress expression or activity of PTEN and/or agents that reduce, block, inhibit, prevent or suppress the downstream effects of PTEN activation. The agent can be a small molecule, or a biomacromolecule, such as a protein, polypeptide, or nucleic acid. In some embodiments, at least two PTEN inhibitors are administered to the subject. In one embodiment, at least one of the agents directly reduces, blocks, inhibits, prevents or suppresses expression or activity of PTEN. In particular embodiments, the composition includes, or the subject is otherwise administered, two PTEN inhibitors in combination, wherein one inhibitor directly inhibits PTEN and the other PTEN inhibitor reduces or prevents the downstream effects of PTEN activation in the subject.
[0081] A PTEN inhibitor may reduce, block, inhibit, prevent, or suppress the activity of PTEN with a particular potency. For example, a PTEN inhibitor may have an IC50 of less than about 100 μΜ, less than about 50 μΜ, less than about 25 μΜ, less than about 10 μΜ, less than about 5 μΜ, less than about 1 μΜ, less than about 500 nM, less than about 250 nm, less than about 100 nM, less than about 50 nM, less than about 25 nM, less than about 10 nM, less than about 5 nM, or less than about 1 nM. PTEN inhibition assays for general screening (to identify and confirm alternative, suitable inhibitors) and IC50 determinations are described in the working examples provided herein and/or known in the art, e.g. U.S. 2007/0203098 and WO 2005/097119, each of which is specifically incorporated by reference
herein in its entirety. For instance, a PTEN inhibition assay and IC50 determination may be performed as described in Examples 3 and 4 of U.S. 2007/0203098. Briefly, free phosphate, which is a product of the PTEN dephosphorylation reaction, can be detected by a
colorimetric reaction with a commercially available malachite green solution. Various volumes of the test inhibitor candidates can be mixed with PTEN solution and then substrate can be added. The reaction mix can be incubated for a suitable time. Subsequently, an aliquot of malachite green buffer can be added to develop the color in the dark. A
spectrophotometer can be used to measure the optical density at, for example, 650 nanometers. The activity of PTEN can be measured in vivo by quantifying cellular
PI(3,4,5)P3 levels after treatment with a PTEN inhibitor.
[0082] In some embodiments, the PTEN is a PTEN inhibitor such as N-(9, 10-Dioxo-9, 10- dihydrophenanthren-2-yl)-2,2-dimethylpropionamide; or 3,4-Dephostatin, ethyl-.
[0083] Formulas for non-limiting examples of PTEN inhibitor compounds are disclosed in U.S. 2007/0203098, WO2005/0971 19, U.S. 201 1/0002877, and U.S. 2011/0189308, each of which is specifically incorporated by reference herein in its entirety. In particular
embodiments, the PTEN inhibitor is a vanadium complex including, for example, vanadate (VO) or bisperoxovanadate (bpV) complexed to one or more organic ligands. Non-limiting examples of ligands include 1-isoquinoline (isoqu), phenanthroline (phen), phenylbiguanide (biguan), 3-hydropicolinate (OH-pic), bipyridine (bipy) and picolinato (pic). See examples of such small molecules disclosed in Rosivatz, et al., ACS Chem. Biol., 1 (12):780-90 (2006); which is herein incorporated by reference. PTEN inhibitors including bpV(bipy), bpV(OHpic), bpV(phen), bpV(pic) are available from commercial vendors.
[0084] In some embodiments, a PTEN inhibitor is a vanadium-based PTEN inhibitor described in U.S. 2007/0292532 or U.S. 7,692,012, each of which is specifically incorporated by reference herein in its entirety. For example, a PTEN inhibitor may be a vanadium- containing compound of the formula:
or wherein L and L' together form a group:
wherein L" is O, S or NH;
R1, R2, R3, R4, R5 and R6 are independently H, hydroxyl, Ci-6 alkyl, optionally substituted by hydroxy or NR7R8, 03.6 cycloalkyi, optionally substituted by hydroxy or NR7R8, phenyl, optionally substituted by Ci-3 alkyl, hydroxy, NR7R8 or S03, (OCHzCHzMNHCHzCI-yn, an amino acid or a peptide consisting of 2 to 5 amino acids; and
R7 and R8 are independently H or Ci-6 alkyl; or a pharmaceutically acceptable salt thereof.
[0085] In another embodiment, a PTEN inhibitor may be a vanadium-containing compound of the formula:
and L' is COO, CONR5, CONHR6, CH2NR5R'
or wherein L and L' together form a group:
wherein L" is O, S or NH;
R1, R2, R3, R4, R5 and R6 are independently H, hydroxyl, Ci-6 alkyl, optionally substituted by hydroxy or NR7R8, C3.6 cycloalkyl, optionally substituted by hydroxy or NR7R8, phenyl, optionally substituted by Ci.3 alkyl, hydroxy, NR7R8 or S03, (OCH2CH2)n(NHCH2CH2)n, an amino acid or a peptide consisting of 2 to 5 amino acids; and
R7 and R8 are independently H or Ci-6 alkyl; or a pharmaceutically acceptable salt thereof.
[0086] Additional non-limiting examples of PTEN inhibitors include potassium bisperoxo (bipyridine) oxovanadate (bpV(bipy), potassium bisperoxo(1 ,10-phenanthroline)oxovanadate (pV(phenanthroline)), potassium bisperoxo (piconlinate) oxovanadate (pV(pic)), potassium bisperoxo(phenylbiguanide)oxovanadate (pV(biguan)), pV(phenbig) [dipotassium
bisperoxo(phenylbiguanide)oxovanadate], bpV(HOpic) [dipotassium bisperoxo(5- hydroxypyridine-2-carboxyl)oxovanadate], VO-OHpic [V(=0)(H20)(OHpic)2], bpV(pic), bpV(phen).
[0087] The PTEN inhibitor can be a functional nucleic acid selected from the group consisting of antisense molecules, siRNA, shRNA, miRNA, aptamers, ribozymes, triplex forming molecules, RNAi, or external guide sequences that target SEQ ID NO:5, or gene editing compositions such as CRISPR/Cas, zinc finger nuclease, or TALEN compositions that target the PTEN gene and reduce or otherwise modify its expression.
[0088] Methods for designing functional nucleic acids to suppress or inhibit expression of a nucleic acid, such as a nucleic acid encoding PTEN, are known in the art. For example, in some embodiments, the composition includes a functional nucleic acid or polypeptide designed to target and reduce or inhibit expression or translation of PTEN mRNA; or to reduce or inhibit expression, reduce activity, or increase degradation of PTEN protein. In some embodiments, the composition includes a vector suitable for in vivo expression of the functional nucleic acid.
[0089] In some embodiments, a functional nucleic acid or polypeptide is designed to target a segment of the nucleic acid sequence of SEQ ID NO:5, or the complement thereof, or variants thereof having a nucleic acid sequence at least about 65%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to SEQ ID NO:5.
[0090] In some embodiments, a functional nucleic acid or polypeptide is designed to target a segment of a the nucleic acid encoding the amino acid sequence of SEQ ID NO:4, or the complement thereof, or variants thereof having a nucleic acid sequence at least about 65%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to a nucleic acid encoding the amino acid sequence of SEQ ID NO:4.
[0091] In some embodiments, the functional nucleic acid hybridizes to the nucleic acid of SEQ ID NO:5, or a complement thereof, for example, under stringent conditions. In some embodiments, the functional nucleic acid hybridizes to a nucleic acid sequence that encodes SEQ ID NO:4, or a complement thereof, for example, under stringent conditions.
[0092] According to the invention, a PTEN inhibitor may be administered with one or more additional therapeutic agents. Additional therapeutic agents useful for the treatment of cancer are known to the skilled artisan. Additional therapeutic treatments include, but are not limited to, surgical resection, radiation therapy, hormone therapy, antibody-based therapies, whole body irradiation, bone marrow transplantation, peripheral blood stem cell
transplantation, vaccines, the administration of chemotherapeutic agents (also referred to herein as "antineoplastic chemotherapy agent," "antineoplastic agents," or "antineoplastic chemotherapeutic agents"), cytokines, antiviral agents, immune enhancers, tyrosine kinase
inhibitors, signal transduction inhibitors, antibiotic, antimicrobial agents, a TLR agonists, such as for example, bacterial lipopolysaccharides (LPS), ligands that bind to Toll-Like Receptors such as CpG oligonucleotides (ODN), metabolic breakdown products of tryptophan, inhibitors of a GCN2 kinase, adjuvants, radionuclides, enzymes, anti-parasites (helminths, protozoans), growth factors, growth inhibitors, hormones, hormone antagonists, antibodies and bioactive fragments thereof (including humanized, single chain, and chimeric antibodies), antigen and vaccine formulations (including adjuvants), peptide drugs, molecules that mobilize and optimize the adaptive immune system, other molecules that activate or up-regulate the action of cytotoxic T lymphocytes, natural killer cells and helper T- cells, and other molecules that deactivate or down-regulate suppressor or regulatory T-cells.
[0093] Exemplary cytokines include, but are not limited to, IL-1 a, IL- β, IL-2, IL-3, IL-4, IL-6, IL-8, IL-9, IL-10, IL-12, IL-13, IL-15, IL-18, IL-19, IL-20, IFN-a, IFN-β, IFN-γ, tumor necrosis factor (TNF), transforming growth factor-β (TGF-β), granulocyte colony stimulating factor (G- CSF), macrophage colony stimulating factor (M-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), and Flt-3 ligand.
[0094] Some embodiments include a cell based therapy such as sipuleucel-T treatment. In one embodiment, a PTEN inhibitor is administered to a subject after sipuleucel-T
(PROVENGE®), preferably to treat metastatic castration-resistant prostate cancer.
[0095] Some additional therapeutic agents suitable for use in the methods and compositions of the invention are described in more detail below.
[0096] In some aspects, the invention relates to methods of treatment that comprise administering a vaccine to a subject in combination with a PTEN inhibitor. In some embodiments, a vaccine targets or comprises a tumor antigen. For example, a vaccine may be directed to or comprise an antigen from a lung tumor, a breast tumor, an ovarian tumor or a melanoma tumor. In some embodiments, the vaccine targets or comprises human gp100, NY-ESO-1 , Mud or EGFR-vlll.
[0097] The vaccine may be a tumor-specific cancer cell line that stimulates the subject's immune system to attack the subject's cancer cells. In one embodiment, the vaccine is a HyperAcute™ immunotherapy. A cell-based vaccine may be genetically modified to express alpha-gal carbohydrates on cell surface molecules. The vaccine may be any of the vaccines disclosed in U.S. 7,763,461 , U.S. 8,551 ,474, U.S. 8,535,658, U.S. 2014/0037692 or U.S. 2014/0072597, each of which is specifically incorporated herein by reference in its entirety. Non-limiting examples of cell-based vaccines that may be used in the methods and compositions of the invention are Algenpantucel-L, Tergenpumatucel-L and Dorgenmeltucel- L.
[0098] A vaccine used in the methods and compositions of the invention may be formulated or administered with an adjuvant. The role of the adjuvant is to increase the immune system activation in the presence of target antigens. Non-limiting examples of immunostimulatory components of adjuvants and specific adjuvants include aluminum salts (e.g. , alum, aluminum phosphate, aluminum hydroxide), squalene-in-water emulsions (e.g. , AS03 or MF59 (4.3% w/v squalene, 0.5% w/v polysorbate 80, 0.5% w/v sorbitan trioleate)), MPL® (Monophosphoryl Lipid A), 3DMPL (3-O-deacetylated MPL®), AS04 (M PL® and alum), MPL® and QS-21 (e.g. , MPL® and formulations such as AS01 and AS02), flagellin from S.
typhimurium (e.g. , flagellin or flagellin-Ag fusion proteins), imidazoquinoline derivatives (e.g., imiquimods), synthetic phophorothioate-linked DNA oligonucleotides with optimized CpG motifs (e.g. , CpG oligodeoxynuceotides and formulations (IC31 , QB10)), trehalose dimycolate (cord factor) (e.g, CAF01), saponins (e.g. , ISCOMS ((see, e.g., Sjolander et al., J. Leukocyte Biol. 64:713 (1998); WO 90/03184, WO 96/1 171 1 , WO 00/48630, WO 98/36772, WO 00/41720, WO 06/134423 and WO 07/026190)) and ISCOMATRIX), surfactant plus mineral or paraffin oil (e.g. , incomplete Freund's adjuvant (I FA) (and Montanide formulations)), I FA plus peptidoglycan and trehalose dimycolate (e.g., complete Freund's adjuvant (CFA)), QS-21 (saponin adjuvant), LT/CT mutants, poly(D, L-lactide-co-glycolide) (PLG) microparticles, Quil A, interleukins, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor- muramyl-L-alanyl-D-isoglutamine (CGP 1 1637, referred to as nor-MDP), N-acetylmuramyl-L- alanyl-D-isoglutaminyl-L-alanine-2-(T-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)- ethylamine (CGP 19835A, referred to as MTP-PE), RIBI , which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL®+TDM+CWS) in a 2% squalene/polysorbate 80 emulsion, synthetic derivatives of dsRNA (e.g. , Poly-IC or Poly-ICLC), and ligands for toll-like receptors (TLR), natural or synthesized (see, e.g. Kanzler et al. , Nature Med. 13: 1552-1559 (2007)), including TLR3 ligands such as polylC and similar compounds such as Hiltonol and Ampligen. Examples of suitable adjuvants are also found in Coffman et al., Immunity 33, 492-503 (2010).
[0099] Administration is not limited to the treatment of an existing tumor or cancer but can also be used to prevent or lower the risk of developing such diseases in an individual, i.e. , for prophylactic use. Potential candidates for prophylactic vaccination include individuals with a high risk of developing cancer, i.e. , with a personal or familial history of certain types of cancer.
[00100] Therefore, a PTEN inhibitor can be administered in conjunction with, or as a component of a vaccine composition. A PTEN inhibitor can be administered prior to, concurrently with, or after the administration of a vaccine. In one embodiment, a PTEN inhibitor is administered at the same time as administration of a vaccine.
[00101] A PTEN inhibitor can be administered in conjunction with prophylactic vaccines, which confer resistance in a subject to subsequent exposure to cancer-causing molecules or events, or in conjunction with therapeutic vaccines, which can be used to initiate or enhance a subject's immune response to a pre-existing antigen, such as a tumor antigen in a subject with cancer, or a viral antigen in a subject infected with a virus.
[00102] The desired outcome of a prophylactic, therapeutic or de-sensitized immune response may vary according to the disease, according to principles well known in the art. For example, an immune response against a tumor-related or cancer-related antigen may completely prevent tumor or cancer presence in the patient, with an absence of any disease symptoms. However, a vaccine treatment against tumor-related or cancer-related antigens may be considered effective if it reduces the number, severity or duration of symptoms; if it reduces the number of individuals in a population with symptoms.
[00103] Similarly, immune responses against cancer may completely treat a disease, may alleviate symptoms, or may be one facet in an overall therapeutic intervention against a disease. For example, the stimulation of an immune response against a cancer may be coupled with surgical, chemotherapeutic, radiologic, hormonal and other immunologic approaches in order to affect treatment.
[00104] The invention includes methods of treatment comprising administering to a subject a PTEN inhibitor and a chemotherapeutic agent (in some cases, after administering a vaccine to the subject). In one embodiment, the chemotherapeutic agent is an
antineoplastic chemotherapeutic agent.
[00105] A chemotherapeutic agent may be, for example, a cytotoxic chemotherapy agent, such as, for example, epidophyllotoxin, procarbazine, mitoxantrone, platinum coordination complexes such as cisplatin and carboplatin, leucovorin, tegafur, paclitaxel, docetaxol, vincristine, vinblastine, methotrexate, cyclophosphamide, gemcitabine, estramustine, carmustine, adriamycin (doxorubicin), etoposide, arsenic trioxide, irinotecan, epothilone derivatives, navelbene, CPT-1 1 , anastrazole, letrazole, capecitabine, reloxafine, ifosamide, temozolomide and droloxafine.
[00106] A chemotherapeutic agent may be, for example, an alkylating agent, such as, for example, nitrogen mustards (such as chlorambucil, cyclophosphamide, ifosfamide, temozolomide, echlorethamine, melphalan, and uracil mustard), aziridines (such as thiotepa), methanesulphonate esters (such as busulfan), nitroso ureas (such as carmustine, lomustine, and streptozocin), platinum complexes (such as cisplatin and carboplatin), and bioreductive alkylators (such as mitomycin, procarbazine, dacarbazine and altretamine),
ethylenimine derivatives, alkyl sulfonates, triazenes, pipobroman, temozolomide, triethylene- melamine, and triethylenethiophosphoramine.
[00107] A chemotherapeutic agent may be an antimetabolite, such as, for example, a folate antagonist (such as methotrexate and trimetrexate), a pyrimidine antagonist (such as fluorouracil, fluorodeoxyuridine, CB3717, azacitidine, cytarabine, gemcitabine, and floxuridine), a purine antagonist (such as mercaptopurine, 6-thioguanine, fludarabine, and pentostatin), a ribonucleotide reductase inhibitor (such as hydroxyurea), and an adenosine deaminase inhibitor.
[00108] A chemotherapeutic agent may be a DNA strand-breakage agent (such as, for example, bleomycin), a topoisomerase II inhibitor (such as, for example, amsacrine, dactinomycin, daunorubicin, idarubicin, mitoxantrone, doxorubicin, etoposide, and teniposide), a DNA minor groove binding agent (such as, for example, plicamydin), a tubulin interactive agent (such as, for example, vincristine, vinblastine, and paclitaxel), a hormonal agent (such as, for example, estrogens, conjugated estrogens, ethinyl estradiol,
d i ethyl sti I besterol , chlortrianisen, idenestrol, progestins (such as hydroxyprogesterone caproate, medroxyprogesterone, and megestrol), and androgens (such as testosterone, testosterone propionate, fluoxymesterone, and methyltestosterone)), an adrenal
corticosteroid (such as, for example, prednisone, dexamethasone, methylprednisolone, and prednisolone), a leutinizing hormone releasing agent or gonadotropin-releasing hormone antagonist (such as, for example, leuprolide acetate and goserelin acetate), an antihormonal agent (such as, for example, tamoxifen), an antiandrogen agent (such as flutamide), an antiadrenal agent (such as mitotane and aminoglutethimide), and a natural product or derivative thereof (such as, for example, vinca alkaloids, antibiotics, enzymaes and epipodophyllotoxins, including, for example vinblastine, vincristine, vindesine, bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, ara-C, paclitaxel,
mithramycin, deoxyco-formycin, mitomycin-C, L-asparaginase, and teniposide.
[00109] In some embodiments, a PTEN inhibitor is administered to a subject in combination with temozolomide (TEMODAR®) (e.g., for treating primary malignant brain tumors); or with docetaxel (TAXOTERE®) (e.g., for treating metastatic breast cancer).
[00110] In one embodiment, a PTEN inhibitor is administered to a subject in combination with cyclophosphamide. Cyclophosphamide (CTX, CYTOXAN®, or NEOSAR®) is an oxazahosphorine drug and analogs include ifosfamide (IFO, Ifex), perfosfamide, trophosphamide (trofosfamide; Ixoten), and pharmaceutically acceptable salts, solvates, prodrugs and metabolites thereof (U.S. 2007/0202077, which is specifically incorporated herein by reference in its entirety). Ifosfamide (MITOXANA®) is a structural analog of
cyclophosphamide and its mechanism of action is considered to be identical or substantially similar to that of cyclophosphamide. Perfosfamide (4-hydroperoxycyclophosphamide) and trophosphamide are also alkylating agents, which are structurally related to
cyclophosphamide. For example, perfosfamide alkylates DNA, thereby inhibiting DNA replication and RNA and protein synthesis. New oxazaphosphorines derivatives have been designed and evaluated with an attempt to improve the selectivity and response with reduced host toxicity (Liang et al., Curr Pharm Des. 2007; 13(9):963-78). These include mafosfamide (NSC 345842), glufosfamide (D19575, beta-D-glucosylisophosphoramide mustard), S-(-)-bromofosfamide (CBM-11), NSC 612567 (aldophosphamide
perhydrothiazine) and NSC 613060 (aldophosphamide thiazolidine). Mafosfamide is an oxazaphosphorine analog that is a chemically stable 4-thioethane sulfonic acid salt of 4- hydroxy-CPA. Glufosfamide is IFO derivative in which the isophosphoramide mustard, the alkylating metabolite of IFO, is glycosidically linked to a beta-D-glucose molecule. Additional cyclophosphamide analogs are described in U.S. 5,190,929, which is specifically
incorporated herein by reference in its entirety.
[001 11] In human clinical trials where CTX has been used as an immunopotentiating agent, a dose of 300 mg/m2 has usually been used. For an average male (6 ft, 170 pound (78 kg) with a body surface area of 1.98 m2), 300 mg/m2 is 8 mg/kg, or 624 mg of total drug. In mouse models of cancer, efficacy has been seen at doses ranging from 15 - 150 mg/kg, which relates to 0.45 - 4.5 mg of total drug in a 30g mouse (Machiels et al. Cancer Res. 61 :3689-3697 (2001), Hengst et al Cancer Res. 41 :2163-2167 (1981), Hengst Cancer Res. 40:2135-2141 (1980)). The methods of the invention would allow a lower dose of CTX to be used in combination with a PTEN inhibitor without reducing its anti-cancer or anti-tumor efficacy. For example, CTX may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the 8 mg/kg dose for an average male or compared to a 15-150 mg/kg dose for a mouse, when administered in combination with a PTEN inhibitor.
[001 12] For larger mammals, such as a primate, preferably human, patient, such mg/m2 doses may be used but unit doses administered over a finite time interval may be preferred. Such unit doses may be administered on a daily basis for a finite time period, such as up to 3 days, or up to 5 days, or up to 7 days, or up to 10 days, or up to 15 days or up to 20 days or up to 25 days, are all specifically contemplated by the invention. The same regimen may be applied for the other potentiating agents recited herein.
[001 13] In other embodiments, the chemotherapeutic agent may be Sunitinib
(SUTENT®), 8ηίί-ΤΘΡβ, Imatinib (GLEEVAC®), a mitosis inhibitor (such as paclitaxel), an
aromatase inhibitor (e.g. Letrozole) or an angiogenesis inhibitor (VEGF inhibitors e.g.
Avastin, VEGF-Trap) (see, for example, Li et al., Clin Cancer Res. 2006 Nov
15; 12(22):6808-16), anthracycline, oxaliplatin, doxorubicin, a TLR4 antagonist or an IL-18 antagonist.
[00114] Chemotherapeutic agents that kill tumor cells may be administered in combination with a PTEN inhibitor according to the methods of the invention. Non-limiting examples of such agent include imatinib, sunitinib, trastuzumab, cetuximab, gefitinib, erlotinib, panituzumab, bevacizumab, NEXAVAR® (sorafenib), venurafinib, bortezomib, carfilzomib, lenolidomide and rituximab.
[00115] For example, one standard dose of sorafenib for treating cancer is 400 mg (2 x 200 mg tablets) taken twice daily. The methods of the invention would allow a lower dose of sorafenib to be used in combination with a PTEN inhibitor without reducing its anti-cancer or anti-tumor efficacy. For example, sorafenib may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the 400 mg twice daily dose, when administered in combination with a PTEN inhibitor.
[00116] Furthermore, the methods of the invention would allow a lower dose of any one of adriamycin, cisplatin, carboplatin, oxaliplatin, cyclophosphamide, ifosfamide, temozolomide, gemcitabine, pactilaxel, docetaxel or etoposide to be used in combination with a PTEN inhibitor without reducing the chemotherapeutic agent's anti-cancer or antitumor efficacy. For example, adriamycin, cisplatin, carboplatin, oxaliplatin,
cyclophosphamide, ifosfamide, temozolomide, gemcitabine, pactilaxel, docetaxel or etoposide may be administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the daily or aggregate standard dose of the corresponding chemotherapeutic agent shown in Table 1 , when administered in combination with a PTEN inhibitor.
Table 1. Examples of standard doses of selected chemotherapeutic agents
400 1 ,2 21
(sarcoma)
oxaliplatin 85-130 1 21
cyclophosphamide 300-600* first 2-5 days 21-28
ifosfamide 1800-2400** first 3-5 days 21-28
temozolomide 200 1 ,2,3,4,5 28
gemcitabine 1000-1250 1 ,8 21
gemcitabine 1000-1250 1 ,8, 15 28
pactilaxel 135 1 21
docetaxel 100 1 21
etoposide 50 1 ,2,3,4,5 21-28
etoposide 100 1 ,2,3 21-28
*aggregate dose 1500-1800 mg/mA2/cycle
**aggregate dose 1500-1800 mg/mA2/cycle
GCT = germ cell tumor / testicular cancer
[00117] In some embodiments, the disclosed methods involve co-administration with a PD-1 antagonist. PD-1 antagonists, also referred to herein as inhibitors of the PD-1/PD-L pathway, include, but are not limited to, antibodies, peptides, nucleic acid molecules
(including, for example, an antisense molecule, a PNA, or an RNAi), peptidomimetics, small molecules, a soluble PD-1 ligand polypeptide, or a chimeric polypeptide (for example, a chimeric PD-1 ligand/lmmunoglobulin molecule). An antibody may be an intact antibody, an antibody binding fragment, or a chimeric antibody. A chimeric antibody may include both human and non-human portions. An antibody may be a polyclonal or a moncoclonal antibody. An antibody may be a derived from a wide variety of species, including, but not limited to mouse and human. An antibody may be a humanized antibody. An antibody may be linked to another functional molecule, for example, another peptide or protein, a toxin, a radioisotype, a cytotoxic agent, cytostatic agent, a polymer, such as, for example, polyethylene glycol, polypropylene glycol or polyoxyalkenes.
[00118] Programmed Death-1 (PD-1) is a member of the CD28 family of receptors that delivers a negative immune response when induced on T-cells. Contact between PD-1 and one of its ligands (B7-H1 or B7-DC) induces an inhibitory response that decreases T-cell multiplication and/or the strength and/or duration of a T-cell response. Suitable PD-1 antagonists are described in U.S. 8, 114,845, U.S. 8,609,089, and U.S. 8,709,416, each of which is specifically incorporated by reference herein in its entirety, and include compounds or agents that either bind to and block a ligand of PD-1 to interfere with or inhibit the binding
of the ligand to the PD-1 receptor, or bind directly to and block the PD-1 receptor without inducing inhibitory signal transduction through the PD-1 receptor.
[00119] In some embodiments, the PD-1 receptor antagonist binds directly to the PD- 1 receptor without triggering inhibitory signal transduction and also binds to a ligand of the PD-1 receptor to reduce or inhibit the ligand from triggering signal transduction through the PD-1 receptor. By reducing the number and/or amount of ligands that bind to PD-1 receptor and trigger the transduction of an inhibitory signal, fewer cells are attenuated by the negative signal delivered by PD-1 signal transduction and a more robust immune response can be achieved.
[00120] It is believed that PD-1 signaling is driven by binding to a PD-1 ligand (such as B7-H1 or B7-DC) in close proximity to a peptide antigen presented by major
histocompatibility complex (MHC) (see, for example, Freeman, Proc. Natl. Acad. Sci. U. S. A, 105: 10275-10276 (2008)). Therefore, proteins, antibodies or small molecules that prevent co-ligation of PD-1 and TCR on the T-cell membrane are also useful PD-1 antagonists.
[00121] In preferred embodiments, the PD-1 receptor antagonists are small molecule antagonists or antibodies that reduce or interfere with PD-1 receptor signal transduction by binding to ligands of PD-1 or to PD-1 itself, especially where co-ligation of PD-1 with TCR does not follow such binding, thereby not triggering inhibitory signal transduction through the PD-1 receptor.
[00122] Other PD-1 antagonists contemplated by the methods of this invention include antibodies that bind to PD-1 or ligands of PD-1 , and other antibodies. Suitable anti- PD-1 antibodies include, but are not limited to, those described in the following publications: WO 2003/099196; WO 2006/121168; WO 2009/014708; WO 2004/004771 ; WO
2004/072286; WO 2004/056875; WO 2008/083174; WO 2007/005874; WO 2009/073533; and Berger et al., Clin. Cancer Res., 14:30443051 (2008); each of which is specifically incorporated by reference herein in its entirety.
[00123] A specific example of an anti-PD-1 antibody is an antibody described in US 2007/0166281 at par. 42, a human anti-PD-1 antibody, preferably administered at a dose of 3 mg/kg.
[00124] Exemplary anti-B7-H1 antibodies include, but are not limited to, those described in the following publications: WO 2006/133396; WO 2008/083174; and US 2006/01 10383; each of which is specifically incorporated by reference herein in its entirety.
[00125] A specific example of an anti-B7-H1 antibody is an antibody described in WO/2007/005874, a human anti-B7-H1 antibody.
[00126] Additional anti-PD-1 and anti-B7-H1 antibodies are disclosed in U.S.
2014/0044738, which is specifically incorporated by reference herein in its entirety.
[00127] For anti-B7-DC antibodies see U.S. 7,411 ,051 , U.S. 7,052,694, U.S.
7,390,888, and U.S. 2006/0099203, each of which is specifically incorporated by reference herein in its entirety.
[00128] Other exemplary PD-1 receptor antagonists include, but are not limited to B7- DC polypeptides, including homologs and variants of these, as well as active fragments of any of the foregoing, and fusion proteins that incorporate any of these. In one embodiment, the fusion protein includes the soluble portion of B7-DC coupled to the Fc portion of an antibody, such as human IgG, and does not incorporate all or part of the transmembrane portion of human B7-DC.
[00129] The PD-1 antagonist can also be a fragment of a mammalian B7-H1 , preferably from mouse or primate, preferably human, wherein the fragment binds to and blocks PD-1 but does not result in inhibitory signal transduction through PD-1. The fragments can also be part of a fusion protein, for example an Ig fusion protein.
[00130] Other useful polypeptides PD-1 antagonists include those that bind to the ligands of the PD-1 receptor. These include the PD-1 receptor protein, or soluble fragments thereof, which can bind to the PD-1 ligands, such as B7-H1 or B7-DC, and prevent binding to the endogenous PD-1 receptor, thereby preventing inhibitory signal transduction. B7-H1 has also been shown to bind the protein B7.1 (Butte et al., Immunity, Vol. 27, pp. 1 11-122, (2007)). Such fragments also include the soluble ECD portion of the PD-1 protein that includes mutations, such as the A99L mutation, that increases binding to the natural ligands (Molnar et al., PNAS, 105:10483-10488 (2008)). B7-1 or soluble fragments thereof, which can bind to the B7-H1 ligand and prevent binding to the endogenous PD-1 receptor, thereby preventing inhibitory signal transduction, are also useful.
[00131] PD-1 and B7-H1 anti-sense nucleic acids, both DNA and RNA, as well as siRNA molecules can also be PD-1 antagonists. Such anti-sense molecules prevent expression of PD-1 on T-cells as well as production of T-cell ligands, such as B7-H1 , PD-L1 and/or PD-L2. For example, siRNA (for example, of about 21 nucleotides in length, which is specific for the gene encoding PD-1 , or encoding a PD-1 ligand, and which oligonucleotides can be readily purchased commercially) complexed with carriers, such as polyethyleneimine (see Cubillos-Ruiz et al., J. Clin. Invest. 1 19(8): 2231-2244 (2009), are readily taken up by cells that express PD-1 as well as ligands of PD-1 and reduce expression of these receptors
and ligands to achieve a decrease in inhibitory signal transduction in T-cells, thereby activating T-cells.
[00132] One or more PD-1 antagonists may include a combination of PD-1 antagonists. For example, one or more inhibitors of PD-1 , one or more inhibitors of PD-L1 , and/or one or more inhibitors of PD-L2 may be administered. One or more of such inhibitors may be an antibody. For example, to inhibit the PD-1/PD-L pathway a mixture of inhibitors of PD-1 , PD-L1 , and/or PD-L2 may be used in combination. In some embodiments, one or more inhibitors of PD-1 and one or more inhibitors of PD-L1 may be administered. In some embodiments, one or more inhibitors of PD-1 and one or more inhibitors of PD-L2 may be administered. In some embodiments, one or more inhibitors of PD-1 , one or more inhibitors of PD-L1 , and one or more inhibitors of PD-2 may be administered. A mixture or cocktail of inhibitors of the PD-1/PD-L pathway may be administered. For example, a cocktail of antibodies to PD-1 , PD-L1 , and/or PD-L2 may be administered.
[00133] Examples of suitable PD-1 pathway antagonists are provided in U.S.
2011/0223188, U.S. 201 1/0195068, U.S. 201 1/0159023, U.S. 2012/0114649, and U.S. 2013/0017199, each of which is specifically incorporated by reference herein in its entirety.
[00134] Other molecules useful in mediating the effects of T-cells in an immune response are also contemplated as additional therapeutic agents used in the methods and compositions of the invention. In one embodiment, the molecule is an antagonist of CTLA4, for example an antagonistic anti-CTLA4 antibody. CTLA4 (Cytotoxic T-Lymphocyte Antigen 4) is a CD28-family receptor expressed on CD4+ T-cells. It binds the same ligands as CD28 (CD80 and CD86 on B cells and dendritic cells), but with higher affinity than CD28. In contrast to CD28, which enhances cell function when bound at the same time as the T-cell receptor, CTLA4 inhibits T-cell functioning. CTLA4 blockade releases inhibitory controls on T-cell activation and proliferation, inducing antitumor immunity in both preclinical and early clinical trials (Quezada et al., 2006, J Clin Invest; 1 16: 1935-1945, U.S. Pat. No. 7,229,628).
[00135] Blockade of CTLA4 with anti-CTLA4 antibodies can induce rejection of several types of established transplantable tumors in mice, including colon carcinoma, fibrosarcoma, prostatic carcinoma, lymphoma, and renal carcinoma (Leach et al., 1996, Science; 271 : 1734-1736; Kwon et al., 1997, Proc Natl Acad Sci USA; 94:8099-8103; Yang et al., 1997, Cancer Res; 57:4036-4041 ; Shrikant et al., 1999, Immunity; 1 1 :483-493; and Sotomayor et al., 1999, Proc Natl Acad Sci USA; 96: 11476-1 1481). Fully human anti- CTLA4 are being used in clinical trials with patients with melanoma or ovarian cancer (Hodi et al., 2003, Proc Natl Acad Sci USA; 100:4712-471717; Ribas et al., 2004, J Immunother; 27:354-367; and Phan et al., 2003, Proc Natl Acad Sci USA 100:8372-8377).
[00136] Antibodies to block CTLA4 (such as Medarex MDX0101) have been the subject of clinical trials (see, for example, Peggs et al., 2006, Curr Opin Immunol; 18:206- 213). Other suitable anti-CTLA4 antibodies include those described in WO 2007/056539. Despite great potential, some anti-CTLA4 antibodies only show anti-tumor efficacy at doses that are toxic, due to development of nonspecific autoimmunity. In some embodiments, immunomodulators such as anti-CTLA4 can be administered at a lower, less toxic dosage when co-administered with the disclosed PTEN inhibitor compositions.
[00137] Dosages for anti-PD-1 , anti-B7-H1 , and anti-CTLA4 antibody, are known in the art and can be in the range of 0.1 to 100 mg/kg, with shorter ranges of 1 to 50 mg/kg preferred and ranges of 10 to 20 mg/kg being more preferred. An appropriate dose for a human subject is between 5 and 15 mg/kg, with 10 mg/kg of antibody (for example, human anti-PD-1 antibody) most preferred.
[00138] Specific examples of an anti-CTLA4 antibody useful in the methods of the invention are Ipilimumab, a human anti-CTLA4 antibody, preferably administered at a dose of about 10 mg/kg, and Tremelimumab a human anti-CTLA4 antibody, preferably administered at a dose of about 15 mg/kg. See also Sammartino, et al., Clinical Kidney Journal, 3(2): 135-137 (2010), published online December 2009.
[00139] In other embodiments, the antagonist is a small molecule. A series of small organic compounds have been shown to bind to the B7-1 ligand to prevent binding to CTLA4 (see Erbe et al., J. Biol. Chem., 277:7363-7368 (2002). Such small organics could be administered alone or together with an anti-CTLA4 antibody to reduce inhibitory signal transduction of T-cells.
[00140] In a specific combination, a PTEN inhibitor is administered to a subject in combination with ipilimumab (YERVOY®) (e.g., to treat melanoma).
[00141] The invention provides compositions comprising a PTEN inhibitor and a chemotherapeutic (e.g., antineoplastic) agent for improving the efficacy of anti-tumor immunotherapy are provided. The compositions are typically pharmaceutical compositions including an effective amount of a PTEN-inhibitor drug. The compositions may additionally comprise a vaccine directed against a tumor or a cancer antigen.
[00142] Pharmaceutical compositions can be supplied as a kit comprising a container that comprises the pharmaceutical composition as described herein. A pharmaceutical composition can be provided, for example, in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection.
Alternatively, such a kit can include a dry-powder disperser, liquid aerosol generator, or
nebulizer for administration of a pharmaceutical composition. Such a kit can further comprise written information on indications and usage of the pharmaceutical composition.
[00143] The disclosure will be further clarified by the following examples, which are intended to be purely exemplary of the disclosure and in no way limiting.
EXAMPLES
Example 1 : General methods
[00144] The B16F10, LLC, EL4 and E.G7 cell lines were obtained from the American
Type Culture Collection (Manassas, VA). B16-OVA is the B16F10 cell line transfected with full-length chicken ovalbumin, clone M04 (see, Falo et al., Nat. Med. 1 , 649-653 (1995)).
Tumor implantation was performed as described previously (Sharma et al., J. Clin. Invest.
117, 2570-2582 (2007)), using 1 x105 cells for B16F10 and 1 x106 cells for other cell lines
(large inocula were used to ensure rapid tumor engraftment and immune suppression).
Mice received approved euthanasia when tumors reached a size of 300 mm2; death was not used a planned endpoint in any study.
[00145] OT-I mice (CD8+, recognizing the SIINFEKL (SEQ ID NO: 1) peptide of ovalbumin (OVA) on H2K (Hogquist et al., Cell 76, 17-27 (1994).)); and pmel-1 mice, B6.Cg-T/7y7a/CyTg(TcraTcrb)8Rest/J, recognizing a peptide from human gp100 (Overwijk et al., J. Exp. Med. 198, 569-580 (2003)), were obtained from Jackson Laboratory, Bar Harbor, ME. CD8+ effector cells were FACS-sorted from spleens of OT-I or pmel-1 mice.
[00146] CpG-1826 (phosphorothioate oligo 5'-TCCATGACGTTCCTGAGCTT-3' (SEQ ID NO:2)) was synthesized from the published sequence (Chu et al., J. Exp. Med. 186, 1623-1631 (1997)). Whole OVA protein was obtained from Sigma (#A-5503). Human gp10025-33 (KVPRNQDWL (SEQ ID NO:3)) was synthesized from the published sequence (Overwijk et al., J. Exp. Med. 198, 569-580 (2003)). Vaccines were prepared with 100 μg of OVA protein or 25 μg peptide, with 50 μg CpG-1826 in incomplete Freund's adjuvant (I FA, Sigma F-5506) and administered in the hind-limb footpad. Popliteal lymph nodes (LNs) were harvested 4 days later.
[00147] To assess responses to the vaccines, mice received a carboxyfluorescein succinimidyl ester (CFSE)-labeled cohort of resting CD8+ pmel-1 transgenic T-cells
(recognizing a peptide from the human gp100) or CFSE-labeled OT-I cells (recognizing a peptide of OVA). To prevent nonspecific activation, responder cells were always purified by negative selection. For all adoptive transfers, OT-I or pmel-1 spleen cells were enriched by negative selection using magnetic beads (mouse CD8 isolation kit II, #130-095-236, Miltenyi
Biotech). Staining for bead isolation was performed on ice, with short incubation times. Mice received 2* 106 enriched CD8+ cells via tail-vein. The labeled vaccine-specific resting T-cells were used to determine whether tumor-bearing hosts contained a new, systemic population of activated Tregs in response to vaccine treatment. After vaccine treatment, the transferred T-cells were stained for the differentiation marker granzyme B (GzmB) and CFSE dye dilution and analyzed by FACS. CFSE dye dilution allows tracing of multiple
generations of cells. In mice without B16F10 tumors, immunization with cognate antigen generated a robust response in vaccine-draining lymph nodes (VDLNs), driving proliferation of pmel-1 T-cells and up-regulation of the differentiation marker granzyme B. However, the presence of a growing B16F10 tumor, even at a remote site, caused progressive loss of response to vaccine. A second tumor type, E.G7 lymphoma, also showed tumor-induced inhibition of vaccine response at distant sites.
[00148] VO-OHpic (Biovision #1801-5) was used at 1 μΜ in vitro unless otherwise specified and at 10 mg/kg/d in vivo, administered in 10% DMSO.
[00149] For FACS staining, lymph nodes were prepared by rapidly passing through a 40 μηι mesh, then stained using short incubation times (10 min on ice), as described (Sharma et al., Immunity 38, 998-1012 (2013)). Tumors were disaggregated by treating for 1 hr with 1 mg/mL collagenase (C5138, Sigma), 0.1 mg/mL DNAse (D5025, Sigma), and 0.1 mg/mL hyaluronidase (H3884, Sigma) in RPMI 1640 medium.
[00150] The following conjugated mAbs were obtained from BD-Pharmingen against: CD86 (clone GL1); CD1 1c (clone HL3); Ly6c (clone AL-21). Conjugated antibodies obtained from eBioscience were against: Foxp3 (clone FJK-16s); granzyme B (clone NGZB); PD-L1 (clone MIH5); CD103 (Ber-ACT8) and Ly6c (clone HK1.4).
[00151] Intracellular antigens were detected using fixation-permeabilization reagent and matching perm-wash buffer from eBioscience (Cat. #00-5521), with blocking using 5% normal donkey serum, then acquired immediately after staining. Unconjugated anti-Fox03a (rabbit mAb, clone 75D8, Cell Signaling Technology) was used at 4 μg/ml in perm-wash buffer, and was detected with donkey-anti-rabbit-PE (Jackson ImmunoResearch #711-116- 152) 1 : 100 dilution. All washes were in perm-wash buffer in the cold.
[00152] Multiple treatment groups were compared by ANOVA with Tukey's HSD correction. Where given, error bars show standard deviation.
Example 2: Rapid reconfiguration of the suppressive tumor milieu when PTEN is inhibited
[00153] The effect of pharmacologic inhibition of PTEN on an existing,
immunosuppressive tumor microenvironment was tested. B16F10 tumors were grown in WT (wild-type) hosts, then treated with pmel-1 T-cells and hgp100 vaccine, with or without PTEN
inhibitor VO-OHpic (10 mg/kg) (Fig. 1A). In the absence of VO-OHpic, the pmel-1/vaccine treatment had little effect on these large established tumors. However, if PTEN was blocked then pmel-1/vaccine became able to drive rapid tumor involution. In the case of E.G7 tumors (Fig. 1 B), which bear a strong OVA (ovalbumin) xenoantigen, treatment with high- affinity OT-I cells plus OVA vaccine was sufficient to slow tumor growth. However, in order to shrink the size of a large established tumor, addition of VO-OHpic (10 mg/kg) was required.
[00154] In both models, the enhanced anti-tumor response was accompanied by widespread reconfiguration of the intratumoral milieu (Fig. 1C). B16F10 tumors were treated as in Fig. 1A, then disaggregated on day 4 after vaccine and stained as shown. The results are representative of 5 experiments using both B16F10 and E.G7 tumors. This included loss of Fox03a expression in Tregs; proliferation of CFSE-labeled effector cells within the tumor; and emergence of activated Ly6c+CD1 1 b+ myeloid DCs (dendritic cells). Sorting studies on these DCs showed that they were able to robustly cross-present endogenous tumor antigen acquired in vivo (Fig. 1 D). B16-OVA tumors bearing a nominal ovalbumin transgene were treated with pmel-1/vaccine, with or without VO-OHpic. The Ly6cNEG or Ly6c+ fraction of DCs was sorted as shown, and tested for ability to present endogenous OVA antigen to OT-I responder cells in vitro. In contrast, when control Ly6cNEG DCs were isolated from tumors receiving the same pmel-1 /vaccine treatment but without VO-OHpic, these DCs were suppressive and did not cross-present endogenous tumor antigens effectively. Thus, taken together, these data showed that it was possible to reconfigure an established, suppressive tumor microenvironment into an immunogenic milieu when PTEN was blocked.
Example 3: Inhibition of PTEN fundamentally alters the response to chemotherapy
[00155] If PTEN was blocked at the time of chemotherapy, even a modest dose of chemotherapy became able to trigger rapid and prolonged regression of established tumors
(Fig. 2A). Mice with established B16F10 tumors were treated with a single dose of cyclophosphamide (CTX, 150 mg/kg) or VO-OHpic (10 mg/kg/d) or both, as shown.
Chemotherapy by itself was not effective, and VO-OHpic alone had no effect; but together the two agents displayed striking synergy. Consistent with the need to "de-activate" an existing pool of pre-activated, PTEN-dependent Tregs, the initial tumor regression was influenced primarily by the PTEN pathway.
[00156] Analysis of the tumor microenvironment showed that treatment with chemotherapy alone had little effect on the suppressive milieu, which remained dominated by Fox03a+ Tregs and PD-L1+ DCs (Fig. 2B). However, addition of PTEN inhibitor abrogated Fox03a expression in Tregs, down-regulated PD-L1 , and increased the number
of inflammatory Ly6c+CD11 b+ CD1 1c+ DCs. Of note, this new population of Ly6c+CD11 b+ DCs also expressed the integrin marker CD103. A similar CD103+ phenotype has recently been associated with pro-inflammatory and cross-presenting DCs in the tumor
microenvironment (Broz et al., Cancer Cell 26, 638-652 (2014); Ruffell et al., Cancer Cell 26, 623-637 (2014)). The contribution of the adaptive immune response was required for tumor regression (Fig. 2C). In the absence of an adaptive immune system (Rag1-KO mice), the anti-tumor effect of CTX+VO-OHpic was lost.
Example 4: Pre-vaccination and PTEN inhibition improve effect of chemotherapy
[00157] Combining pre-vaccination with PTEN inhibition and chemotherapy reduced volume of Lewis Lung Carcinoma (LLC) tumors transfected with the nominal antigen (LLC- gplOO tumors) to a greater extent than the combination of any two of these treatments (Fig. 3). As shown in Fig. 3, groups of mice with established LLC-gp100 tumore were treated with various combinations of vaccinattion with hgp100/CpG/IFA (incomplete Freund's adjuvant), CTX (cyclophosphamide; 150 mg/kg) and VO-OHpic. The group treated with vaccine, VO- OHpic and CTX showed a slower tumor growth than the groups treated with vaccine and CTX; vaccine and VO-OHpic; or VO-OHpic and CTX.
Example 5: Inhibition of PTEN allows reduction in chemotherapeutic agent dose
[00158] PTEN inhibition allowed the use of lower doses of chemotherapy in mice with established B16F10 tumors (Figs. 4A and 4B). The combination of a PTEN inhibitor (VO- OHpic) and a chemotherapeutic agent (cyclophosphamide (CTX)) created a greater anti- tumor effect than could be achieved even by a larger dose of chemotherapy alone. Mice with B16F10 tumors were treated with 0 or 10 mg/kg VO-OHpic at days 9, 10, 1 1 , 12, and 13 and with 0, 25, 50, or 150 mg/kg CTX at day 10, as shown in the table in Fig. 4B.
Surprisingly, tumor regression was seen with only 50 mg/kg of CTX (when PTEN-inhibitor was given). This result is advantageous in chemotherapeutic treatment because 50 mg/kg of CTX is a minimally-toxic dose and much lower than the maximum tolerated dose (MTD) in mice. The PTEN inhibitor increased the efficacy of low-dose CTX into the type usually seen with high-dose CTX as a single agent (e.g., 3- to 10-fold higher).
Example 6: Absence of PTEN-Tregs contributes to failure to creat a suppressive tumor microenvironment
Treg
[00159] The effect of PTEN -KO hosts on tumor growth was tested. Mice with a BAC-transgenic GFP-Cre fusion protein under the Foxp3 promoter (Foxp3GFP'CRE) were obtained from Jackson Laboratories (NOD/ShiLt- Tg(Foxp3-EGFP/cre)1Jbs/J) (Zhou et al., J. Exp. Med. 205, 1983-1991 (2008); Zhou et al., Nat. Immunol. 10, 1000-1007 (2009)) and back-crossed onto the B6 background. These were used for intercrosses with floxed alleles
Treg „FP„
to create PTEN -KO mice, as follows. Foxp3 mice were crossed with mice bearing loxP sites flanking exon 5 of the PTEN gene (Lesche et al., Genesis 32, 148-149 (2002)) (B6.129S4-Pten im1Hw J, Jackson Laboratories). The resulting strain was maintained as hemizygous for the GFP-Cre and homozygous for ptenloxP/loxP.
Treg
[00160] Aggressive melanoma tumors implanted in PTEN -KO hosts grew much slower than the same tumors implanted in wild-type (WT) parental strains (Fig. 5A). Slower growth was also seen with E.G7 (EL4-OVA) and LLC tumors. Analysis of immune cells
+
infiltrating the tumors (Fig. 5B) showed that WT hosts contained many PTEN Tregs that also co-expressed Fox03a and PD-1 , consistent with a suppressive phenotype. In contrast, the
Treg
Tregs in PTEN -KO tumors did not express Fox03a or PD-1 ; instead, they appeared unstable, with many expressing pro-inflammatory markers such as IL-2, CD40L and IL-17 (Fig. 5B, lower panels). All of these "re-programmed" Tregs continued to express residual Foxp3 (Fig. 5B, bottom graph) thus showing that they derived from former Tregs.
Treg
[00161] The tumor-infiltrating CD8 T cells in PTEN -KO hosts appeared more activated (Fig. 5C). Fewer CD8+ cells were PD-1+ (implying an "exhausted" phenotype) and more had an activated phenotype expressing CD103+, CD69+ and IFNv. Dendritic cells
Treg
(DCs) in tumors from PTEN -KO mice also showed a more activated phenotype (Fig. 5D). More DCs expressed an activated myeloid DC phenotype of Ly6c+CD1 1 b+CD103+, which has been associated with anti-tumor immune surveillance. Many of these CD103+ DCs produced IL-6 (bottom panels). This was significant because IL-6 is a key driver of Treg reprogramming. Similar changes were seen when E.G7 lymphoma tumors were grown in
PTENTre9-KO hosts (Figs. 6A, 6B, and 6C).
Claims
1. A method of reducing tumor volume in a subject in need thereof, the method comprising administering a phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase (PTEN) inhibitor, an antineoplastic chemotherapeutic agent and a vaccine to the subject, wherein the vaccine targets or comprises a tumor antigen.
2. A method of treating cancer in a subject in need thereof, the method comprising administering a phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase (PTEN) inhibitor, an antineoplastic chemotherapeutic agent and a vaccine to the subject, wherein the vaccine targets or comprises a tumor antigen.
3. The method of claim 1 or 2, wherein the method comprises:
(i) administering the vaccine to the subject; and
(ii) after step (i), administering the PTEN inhibitor and the antineoplastic
chemotherapeutic agent to the subject.
4. The method of claim 1 or 2, wherein the method comprises:
(i) administering the PTEN inhibitor and the vaccine to the subject; and
(ii) after step (i), administering the antineoplastic chemotherapeutic agent to the subject.
5. The method of claim 3 or 4, wherein step (ii) is performed at least about one week, at least about two weeks, at least about three weeks or at least about four weeks after step
6. The method of claim 3 or 5, wherein the PTEN inhibitor and the chemotherapeutic agent are administered to the subject concurrently or sequentially.
7. The method of claim 4 or 5, wherein the PTEN inhibitor and the vaccine are administered to the subject concurrently or sequentially.
8. The method of any one of claims 3-7, wherein the method comprises:
(i) administering the PTEN inhibitor and the vaccine to the subject; and
(ii) after step (i), administering the PTEN inhibitor and the antineoplastic
chemotherapeutic agent to the subject.
9. The method of claim 8, wherein the same PTEN inhibitor is administered to the subject in steps (i) and (ii).
10. The method of any one of claims 1-9, wherein the vaccine targets or comprises an antigen from a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor.
11. The method of claim 10, wherein the vaccine targets or comprises human gp100, NY-ESO-1 , Mud or EGFR-vlll.
12. The method of any one of claims 1-11 , wherein the PTEN inhibitor is a small molecule, a nucleic acid or a protein.
13. The method of any one of claims 1-12, wherein the PTEN inhibitor is N-(9, 10- Dioxo-9, 10-dihydrophenanthren-2-yl)-2,2-dimethylpropionamide; or 3,4-Dephostatin, ethyl-.
14. The method of any one of claims 1-12, wherein the PTEN inhibitor is a vanadium complex.
15. The method of claim 14, wherein the PTEN inhibitor is VO-OHpic.
16. The method of any one of claims 1 and 3-15, wherein the tumor is a refractory tumor.
17. The method of any one of claims 1 and 3-16, wherein the tumor is a lung tumor, a breast tumor, an ovarian tumor, a brain tumor, a pancreatic tumor, a colon tumor or a melanoma tumor.
18. The method of any one of claims 2-15, wherein the cancer is lung cancer, breast cancer, ovarian cancer, brain cancer, pancreatic cancer, colon cancer or melanoma.
19. The method of any one of claims 1-18, wherein the method further comprises
(iii) at least about one week, at least about two weeks, at least about three weeks or at least about four weeks after step (ii), administering the vaccine and, optionally, the PTEN inhibitor to the subject; and
(iv) after step (iii), administering the chemotherapeutic agent and, optionally, the PTEN inhibitor to the subject.
20. The method of claim 19, wherein step (iv) is performed at least about one week, at least about two weeks, at least about three weeks or at least about four weeks after step (iii).
21. The method of claim 19 or 20, wherein the PTEN inhibitor and the
chemotherapeutic agent of step (iii) are administered to the subject concurrently or sequentially.
22. The method of claim 19 or 20, wherein the PTEN inhibitor and the chemotherapeutic agent of step (iv) are administered to the subject concurrently or sequentially.
23. The method of claim 19, wherein the same PTEN inhibitor is administered to the subject in steps (iii) and (iv).
24. A method of reducing tumor volume in a subject in need thereof, the method comprising administering a phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase (PTEN) inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
25. The method of claim 24, wherein the PTEN inhibitor and the chemotherapeutic agent are administered to the subject concurrently or sequentially.
26. The method of claim 24 or 25, wherein the chemotherapeutic agent is administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to reduce tumor volume when the chemotherapeutic agent is administered without any PTEN inhibitor.
27. A method of treating cancer in a subject in need thereof, the method comprising administering a phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase (PTEN) inhibitor and a chemotherapeutic agent to the subject, wherein the chemotherapeutic agent is administered at a reduced dose compared to the standard
dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
28. The method of claim 27, wherein the PTEN inhibitor and the chemotherapeutic agent are administered to the subject concurrently or sequentially.
29. The method of claim 27 or 28, wherein the chemotherapeutic agent is administered at a dose reduced at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70% or at least about 80% compared to the standard dose used to treat cancer when the chemotherapeutic agent is administered without any PTEN inhibitor.
30. The method of any one of claims 24-29, wherein the PTEN inhibitor and the chemotherapeutic agent are administered to the subject in multiple cycles.
31. The method of claim of claim 30, wherein the PTEN inhibitor and the
chemotherapeutic agent are administered to the subject about every two weeks, about every ten days, about every one week, about every six days, about every five days, about every four days, about every three days, about every two days or about every one day.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562187438P | 2015-07-01 | 2015-07-01 | |
US62/187,438 | 2015-07-01 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2017004167A1 true WO2017004167A1 (en) | 2017-01-05 |
Family
ID=57609059
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2016/040039 WO2017004167A1 (en) | 2015-07-01 | 2016-06-29 | Methods and compositions for treating cancer |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2017004167A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022181515A1 (en) * | 2021-02-26 | 2022-09-01 | 国立大学法人京都大学 | Combination therapy with pd-1 signal inhibitor |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005097119A2 (en) * | 2004-04-06 | 2005-10-20 | Semafore Pharmaceuticals, Inc. | Pten inhibitors |
WO2014066615A1 (en) * | 2012-10-24 | 2014-05-01 | The Regents Of The University Of Michigan | Cancer stem cell vaccination and treatment |
-
2016
- 2016-06-29 WO PCT/US2016/040039 patent/WO2017004167A1/en active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005097119A2 (en) * | 2004-04-06 | 2005-10-20 | Semafore Pharmaceuticals, Inc. | Pten inhibitors |
WO2014066615A1 (en) * | 2012-10-24 | 2014-05-01 | The Regents Of The University Of Michigan | Cancer stem cell vaccination and treatment |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022181515A1 (en) * | 2021-02-26 | 2022-09-01 | 国立大学法人京都大学 | Combination therapy with pd-1 signal inhibitor |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP5798919B2 (en) | Compositions and methods of use of PD-1 antagonists | |
KR101205064B1 (en) | Compositions and methods for cancer immunotherapy | |
Van De Donk et al. | Monoclonal antibody-based therapy as a new treatment strategy in multiple myeloma | |
AU2013315019B2 (en) | Method for enhancing specific immunotherapies in cancer treatment | |
JP5341287B2 (en) | Stimulation of T cells against self antigens using CTLA-4 blockers | |
US20070292418A1 (en) | Compositions and methods for immunotherapy | |
JP2020515640A (en) | Protein antigens and their use | |
JP2002530294A (en) | Cell surface receptor antigen vaccine | |
AU2015205327B2 (en) | Improved cell compositions and methods for cancer therapy | |
JP7419070B2 (en) | Methods and compositions for treating cancer using ECM affinity peptides linked to immunotherapeutic antibodies | |
JP2020532991A (en) | Antibodies to Programmed Cell Death Protein 1 | |
US20180325953A1 (en) | Modified immune cells and uses thereof | |
KR20220065839A (en) | L-10/FC fusion protein useful as an immunotherapy enhancer | |
US20230087600A1 (en) | Il-10 and uses thereof | |
WO2017004167A1 (en) | Methods and compositions for treating cancer | |
JP6924747B2 (en) | Vaccine composition containing CC motif chemokine 22 (CCL22) or a fragment thereof | |
KR20220131895A (en) | Novel immunotherapy targeting PD-1 using anti-PD-1/IL-15 immunocytokines | |
US20220347282A1 (en) | Anti-tumor dna vaccine with pd-1 and lag-3 pathway blockade | |
US20230201341A1 (en) | Tlr3 and tlr9 agonists as vaccine adjuvants for anti-cancer dna vaccines | |
RU2812915C2 (en) | Antibodies to programmed cell death protein 1 | |
Fu | Tarloxotinib amplifies the anti-tumour efficacy of immune checkpoint inhibitors through multiple mechanisms | |
Rotte et al. | Promising immunotherapeutic approaches in clinical trials | |
Chotprakaikiat | Development of a novel plant expressed conjugate vaccine for HER2-positive breast cancer | |
AU2013227994A1 (en) | Compositions of PD-1 antagonists and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16818657 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 16818657 Country of ref document: EP Kind code of ref document: A1 |