WO2016205434A1 - Virb10 for vaccination against gram negative bacteria - Google Patents
Virb10 for vaccination against gram negative bacteria Download PDFInfo
- Publication number
- WO2016205434A1 WO2016205434A1 PCT/US2016/037728 US2016037728W WO2016205434A1 WO 2016205434 A1 WO2016205434 A1 WO 2016205434A1 US 2016037728 W US2016037728 W US 2016037728W WO 2016205434 A1 WO2016205434 A1 WO 2016205434A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virblo
- seq
- vaccine
- spp
- rickettsia
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/0233—Rickettsiales, e.g. Anaplasma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
Definitions
- Type 4 secretion system (T4SS) is used by many gram negative bacteria, including certain pathogenic bacteria, to secrete effector proteins and DNA across cell membranes.
- the bacteria belonging to the genus Rickettsia and Anaplasma provide examples of the pathogenic bacteria having T4SS. Rickettsial diseases are present worldwide and pose the threat of use in a biological weapon. Vaccines currently available against diseases mediated by the bacteria having T4SS are inadequate.
- T4SS is typically formed from a macromolecular complex of about 12 proteins.
- One of the proteins of T4SS is VirBlO.
- the invention provides for the use of VirBlO to immunize against an infection by a bacterium having T4SS. Accordingly, the invention provides a vaccine comprising VirBlO, a fragment of VirBlO, a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirB lO and a pharmaceutically acceptable carrier and/or an adjuvant.
- the invention also provides a method of immunizing a host against an infection caused by a bacterium having T4SS, the method comprising administering to the host a vaccine comprising or consisting of VirB lO, a fragment of VirBlO, a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirB lO and a pharmaceutically acceptable carrier and/or an adjuvant.
- the vaccines and the methods of the invention can be used to prevent infections caused by bacteria having T4SS in various hosts, for example, dogs, rabbits, cats, pigs, cattle, sheep, goats, deer, horses, rodents and humans.
- FIGS 1A-1F SDS-PAGE and Western Blot analysis of the recombinant proteins VirB9-l, VirB9-2 and VirB lO.
- FIG. 1 A. phagocytophilum burden in mouse blood (different strains infected with HZ).
- A. phagocytophilum growth kinetics in blood were measured by determining GE/ ⁇ based on the single copy gene msp5. GE/ ⁇ calculations were normalized based on the volume of blood collected per animal at each time point.
- FIGS 3A-3B A. phagocytophilum antibody responses in immunized C3H/HeN mice.
- A) A. phagocytophilum specific antibody responses in immunized mice were measured by IFA and titers expressed as the reciprocal of the highest dilution at which specific fluorescence was detected (B). Binding of antibodies specific to A. phagocytophilum was seen as defined red fluorescent inclusions (morulae) in infected HL-60 cells; in contrast similar fluorescent inclusions were not visualized using antibodies from negative control group V. Picture taken at 1 : 160 dilution of all antisera.
- FIG. 4 A. phagocytophilum burden in immunized/challenged C3H/HeN mice blood.
- A. phagocytophilum growth kinetics in blood were measured by determining GE/ ⁇ based on the single copy gene msp5. GE/ ⁇ calculations were normalized based on the volume of blood collected per animal at each time point.
- FIG. 5 Protection against A. phagocytophilum induced by immunization.
- A. phagocytophilum GE means plus standard deviations (error bars) at the peak of infection. 7 mice from each group were used for this analysis. The values that are significantly different from the values for the control group are indicated by asterisks *, p ⁇ 0.05.
- FIG. 6 mice from the groups immunized with either VirBlO or ovalbumin control were sacrificed prior to challenge. Their antibody response was assayed by ELISA using intact A. phagocytophilum organisms attached to the ELISA plate. The values represent the average of duplicate readings from the three mice in either the VirBlO or control group. The data show the response of VirB lO-immunized mice to whole organisms on the plate and suggest epitopes of VirBlO are surface-exposed and available to bind antibodies.
- FIG. 7 CLUSTAL format alignment of VirB lOs from multiple organisms by MAFFT (v7.220) (Amarginale_Virb, SEQ ID NO: 123; Aphagocytophilu, SEQ ID NO: 124; Echaffeenis Vi, SEQ ID NO: 125; Eruminantium Vi, SEQ ID NO: 126; Rtyphi VirblO C, SEQ ID NO: 127; Rprowazekii Vir; SEQ ID NO: 128; Rconorii VirBlO; SEQ ID NO: 129; Rrickettsii Vir, SEQ ID NO: 130; Otsutsugamushi_, SEQ ID NO: 131; and Ecoli_VirB10_3J, SEQ ID NO: 132).
- SEQ ID NO: 1 Sequence of VirBlO from A. phagocytophilum strain HZ.
- SEQ ID NO: 2 Sequence of VirB9-l protein from A. phagocytophilum strain HZ.
- SEQ ID NO: 3 Sequence of VirB9-2 protein from A. phagocytophilum strain HZ.
- SEQ ID NO: 4 Forward primer for amplification of DNA encoding Vir9B-l protein.
- SEQ ID NO: 5 Reverse primer for amplification of DNA encoding Vir9B-l protein.
- SEQ ID NO: 6 Forward primer for amplification of DNA encoding Vir9B-2 protein.
- SEQ ID NO: 7 Reverse primer for amplification of DNA encoding Vir9B-2 protein.
- SEQ ID NO: 8 Forward primer for amplification of DNA encoding VirB lO.
- SEQ ID NO: 9 Reverse primer for amplification of DNA encoding VirBlO.
- SEQ ID NO: 10 Forward primer for amplification of msp5 gene from A. phagocytophilum strain HZ for qPCR.
- SEQ ID NO: 11 Reverse primer for amplification of msp5 gene from A. phagocytophilum strain HZ for qPCR.
- SEQ ID NO: 12 Sequence of the qPCR probe for msp5 gene from A. phagocytophilum strain HZ.
- SEQ ID NOs: 13 to 27 Sequences of antigenic peptides of VirB lO.
- SEQ ID NOs: 28-113 VirBlO sequences obtained from UniProt (web site: uniprot.org/uniprot).
- SEQ ID NOs: 114-122 Sequences of PCR primers used to amplify VirB9-l, VirB9- 2 and VirBlO and Taqman qPCR primers and probes used to quantify A. phagocytophilum load.
- SEQ ID NOs: 123-132 Sequences of VirB lOs from multiple organisms.
- HGA Human granulocytic anaplasmosis
- phagocytophilum a bacterium containing T4SS.
- HGA was designated as a nationally notifiable disease in the United States in 1998.
- HGA is described as a zoonosis since the pathogen infects humans as well as animals including dogs, cattle, sheep, deer, horses and rodents.
- Vaccines against HGA are not currently available and the currently available vaccines against other bacteria containing T4SS are not adequate.
- the subject application provides a component of T4SS as a vaccine against diseases caused by bacteria having T4SS, for example, A.
- outer membranes and fragments thereof that are obtained from bacteria having T4SS and which contain VirBlO are excluded as vaccine components in the methods of immunizing a host against infection by a bacterium having T4SS or as components of a vaccine.
- the invention provides a protein present in T4SS, for example, VirBlO or a fragment of VirBlO, to immunize against an infection by a bacterium having T4SS, for example, A. phagocytophilum.
- the invention provides a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO to immunize against an infection by a bacterium having T4SS, for example, A. phagocytophilum.
- the VirBlO polypeptide comprises SEQ ID NO: 1.
- T4SS is present in gram negative bacteria, such as Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp., and Anaplasma spp.
- Non-limiting examples of the bacterial species containing endogenous T4SS include: Rickettsia typhi, Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, Bartonella species, Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium, Brucella species and Ehrlichia canis. Additional examples of bacterial species having T4SS and in which the invention can be practiced are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention. The subject invention can also provide protection against bacterial species that lack an endogenous T4SS system and which have been genetically manipulated to express T4SS.
- VirBlO of Anaplasma phagocytophilum or a fragment of VirB lO can be used to immunize a host against A. phagocytophilum infection.
- VirBlO in bacteria other than A. phagocytophilum can be identified based on sequence homology and such VirBlO or their fragments can be used in a vaccine to immunize against the infection by bacteria having T4SS.
- an embodiment of the invention provides a vaccine comprising an immunologically effective amount of VirBlO or a fragment of VirB lO and a pharmaceutically acceptable carrier and/or an adjuvant.
- Another embodiment of the invention provides a vaccine comprising an immunologically effective amount of a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant.
- the term "immunologically effective amount” refers to the amount of VirB lO or a fragment of the VirBlO which elicits immune response in a host so that the host is protected from future infection caused by the bacterium in which VirBlO is present naturally (endogenously) or a bacterium genetically modified to express VirBlO.
- VirBlO a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO is labeled.
- the label can be designed for in vivo visualization of the protein, peptide or polynucleotide, for targeting the protein, peptide or polynucleotide to a specific tissue, organ or cell of the host, to increase the in vivo stability of the protein, peptide or polynucleotide or to increase immunogenicity of the protein or peptide.
- Non-limiting examples of a label designed to visualize VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO include a fluorescent label, an enzyme label and a chromophore label. Additional examples of labels designed to visualize VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
- a label designed to target VirBlO, a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO to a tissue, organ or cell includes antibodies or fragments of antibodies or other biomolecules which specifically bind to one or more surface biomolecules present on the target tissue, organ or cell.
- the label can be designed to target, for example, Fc receptors, C-type lectins, complement receptors, major histocompatibility proteins, or other receptors present on the surface of dendritic cells or antigen presenting cells. Additional examples of suitable target biomolecules and corresponding binding biomolecules are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
- a label designed to increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirBlO includes tripalmitoyl-S-glyceryl cysteine, polylysine core, carbohydrate, N-pyroglutamate, amide group on the C terminus, acetyl group, glycosyl group, lipid group, unnatural amino acids, peptidomimetics, peptide carriers and polyethylene glycol (PEG).
- Non-limiting examples of labels that increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirBlO are discussed in Goodwin et al. The contents of Goodwin et al. are herein incorporated by reference in their entirety. Additional examples of labels which can increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirB lO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
- VirBlO or a fragment of VirB lO is modified to increase its in vivo stability.
- modifications which increase the in vivo stability of VirBlO or a fragment of VirBlO include incorporation of non-natural amino acids, pseudo- peptide bonds and cyclization. Additional examples of modifications that increase the in vivo stability of VirB lO or a fragment of VirBlO are also described in Goodwin et al. and Gentilucci et al. The contents Goodwin et al. and Gentilucci et al. are herein incorporated by reference in their entirety. Additional examples of modifications which can increase the in vivo stability of VirB lO or a fragment of VirBlO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
- An embodiment of the invention provides a vaccine comprising a fragment of VirBlO or a polynucleotide encoding a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant, wherein the fragment elicits an immune response in a host and the host is immune to a future infection caused by the bacterium in which the particular VirBlO is present naturally.
- the fragment of VirB 10 used in the vaccines of the invention can comprise about 5 to about 50, about 10 to about 40, about 15 to about 30, about 20, about 10 or about 5 amino acids.
- the fragment of VirB lO is selected from the fragments provided in Table 1.
- the VirB lO fragment or VirBlO polypeptide can be fused to a heterologous sequence, such as a carrier protein (e.g., bovine serum albumin, keyhole limpet hemocyanin, ovalbumin or other carrier protein used to stimulate an immune response to peptides).
- a carrier protein e.g., bovine serum albumin, keyhole limpet hemocyanin, ovalbumin or other carrier protein used to stimulate an immune response to peptides.
- the vaccine of the invention can be formulated using adjuvants, emulsifiers, pharmaceutically-acceptable carriers or other ingredients routinely provided in a vaccine.
- Optimum formulations can be readily designed by one of ordinary skill in the art and can include formulations for immediate release and/or for sustained release, and for induction of systemic immunity and/or induction of localized mucosal immunity (e.g, the formulation can be designed for intranasal, intravaginal or intrarectal administration).
- the vaccine disclosed herein can be formed with a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, or an adjuvant to produce a pharmaceutical composition.
- a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, or an adjuvant to produce a pharmaceutical composition.
- the carrier must be "acceptable” in the sense that it is compatible with the active ingredient of the composition, and preferably capable of stabilizing the active ingredient and not deleterious to the subject to be treated.
- the carrier is selected on the basis of the mode and route of administration and standard pharmaceutical practice. Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are described in Remington's Pharmaceutical Sciences.
- the antigen is mixed with an adjuvant to form a composition useful for immune modulation.
- This composition may be prepared as injectable, as liquid solutions or as emulsions. See U.S. Pat. Nos. 4,601,903; 4,599,231; 4,599,230; and 4,596,792.
- An "adjuvant” refers to a substance added to an immunogenic composition, such as a vaccine, that, while not having any specific antigenic effect in itself, can stimulate the immune system and increase the immune response to the immunogenic composition.
- adjuvants include, but are not limited to, alum, alum-precipitate, Freund's complete adjuvant, Freund's incomplete adjuvant, monophosphoryl-lipid A/trehalose dicorynomycolate adjuvant and water in oil emulsions.
- a further embodiment of the invention provides a method of immunizing a host against an infection by a bacterium having T4SS, the method comprising administering to the host a vaccine comprising a pharmaceutically effective amount of VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding the fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant.
- the method of the invention can be used to immunize a host, for example, a mammal, against an infection by a bacterium having the T4SS.
- a host for example, a mammal
- mammals in which the methods of the invention can be practiced include dogs, cats, pigs, cattle, rabbits, sheep, goats, deer, horses, rodents and humans. Additional examples of hosts in which the methods of the invention can be practiced are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
- the invention provides a method of immunizing a host against an infection by a bacterium containing T4SS, wherein the method comprises administering to the host a vaccine comprising VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding the fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant, and wherein the bacterium is a member of Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp., and/or Anaplasma spp.
- the bacterium is Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, a Bartonella species, a Brucella species (e.g., Brucella abortus), Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium or Ehrlichia canis.
- Brucella species e.g., Brucella abortus
- the vaccine of the invention can be administered by any convenient route including subcutaneous, intradermal, intranasal, oral, intramuscular, intraperitoneal, or other parenteral or enteral route.
- a person of ordinary skill in the art can identify a particular route of administration suitable for a particular host and a given bacterium and such embodiments are within the purview of the invention.
- VirBlO a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO can be administered as a single dose or multiple doses.
- Optimum immunization schedules can be readily determined by the ordinarily skilled artisan and can vary with parameters, for example, age, weight and species of the host, the type of vaccine composition and the bacterium against which immunization is desired and such embodiments are within the purview of the invention.
- An embodiment of the invention provides a method of immunizing a host against an infection by a bacterium having T4SS, wherein the immunization is performed according to prime boost immunization.
- the phrase "prime boost immunization" indicates that the VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO is administered in a plurality of doses.
- the immune system of a host encounters multiple exposures to VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO, which results in a stronger immune response compared to single administration of the vaccine.
- Certain examples of prime boost immunizations are discussed in Woodland et al., the contents of which are herein incorporated by reference in their entirety.
- the prime boost immunization comprises administering a pharmaceutically effective amount of a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO followed by administering a pharmaceutically effective amount of VirB lO or a fragment of VirBlO.
- the prime boost immunization comprises administering a pharmaceutically effective amount of VirB lO or a fragment of VirB lO followed by administering a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO.
- the interval between the administration of the polynucleotide and the protein or a fragment of the protein is about 1 week to about 4 weeks, about 2 weeks to 3 weeks, 2 to 4 weeks, or about 2 weeks.
- the vaccine is administered in the form of a "cocktail" that contains at least two polynucleotides or at least two peptides.
- the cocktail can also contain a mixture of a polynucleotide and a peptide.
- the open reading frames of A. phagocy tophi lum virB9-l, virB9-2 and virB lO genes were amplified by PCR (Table 2) and the purified products cloned into a DNA vaccine vector and the pET101/D-TOPO directional expression system. Recombinant constructs were purified and sequences were confirmed by PCR and DNA sequencing. The pETlOl constructs were re-transformed into E. coli BL21 Star (DE3) cells and induced to express with 0.5 mM IPTG and growth in M9 minimal media supplemented with 50 ⁇ g/ml carbenicillin and 1% glucose.
- the VirB9-l, VirB9-2, and VirB lO were separately amplified by PCR and cloned into the vector pcDNA3.1/CT-GFP-TOPO (Invitrogen).
- This vector provides the CMV (cytomegalovirus) promoter 5' to the inserted gene for constitutive expression in mammalian cells and the GFP (Green Fluorescent Protein) gene 3' to the inserted gene.
- CMV cytomegalovirus
- GFP Green Fluorescent Protein
- plasmid DNA For preparation of immunizing plasmid DNA, bacteria were grown in LB/Ampicillin 100 ⁇ g/ml. The ZR Plasmid Gigaprep kit (Zymo Research) was used to isolate endotoxin-free plasmid DNA from the bacterial pellets. The yields of DNA obtained were: TOPO-GFP (control, no inserted gene): 6 liters of culture gave ⁇ 6.5mg; VirB 9-1 plasmid: 6 liters of culture gave ⁇ 29mg; VirB 9-2 plasmid: 6 liters of culture gave ⁇ 19mg; and VirBlO plasmid: 4 liters of culture gave ⁇ 23mg.
- TOPO-GFP control, no inserted gene
- the culture and purification conditions described above were optimized to produce adequate yields of soluble recombinant VirB9-l, VirB9-2 and VirBlO.
- the temperature was reduced to 4°C to avoid protein aggregation and reduction of heat shock proteases that could promote inclusion body formation, cellular toxicity and high levels of protein degradation.
- modification of nutrient media was employed to avoid excess bacterial growth and depletion of substrates and cofactors. This resulted in the isolation of soluble recombinant VirB9-l, VirB9-2 and VirBlOs (Fig. 1) suitable for use in the immunization experiments.
- mice Three different mouse strains (C57BL/6, C3H/HeN, and Balb/C) were tested to evaluate A. phagocy tophi lum infection kinetics and to select an appropriate mouse strain for A. phagocy tophi lum infection for immunization and challenge experiments.
- Two C57BL/6, two C3H/HeN and two Balb/C mice were inoculated with isolated organisms from 5.22 x 10 5 infected HL-60 cells (> 90% infection). DNA extracted from blood collected every other day over 24 days was used to determine the A. phagocy tophi lum load by measuring the increase in the number of genome equivalents (GE) using qPCR with primers and probes that target the single copy gene msp5 (Table 2).
- GE genome equivalents
- Ten-fold serial dilutions of the NY18E2/pCR-TOPO plasmid carrying the msp5 gene were used for standard curve preparation, and the msp5 gene copy numbers were calculated based on the
- mice are susceptible to A. phagocy tophi lum (human HZ strain) infection as shown by an increase of GE in blood at 8 days post-infection for C3H/HeN mice (average of 705 GE/ ⁇ of blood) and between 6 and 8 days post-infection in Balb/C mice (average of 636 GE/ ⁇ of blood) (Fig. 2).
- mouse # 2 presented a minor increase of up to 150 GE/ ⁇ of blood at day 6 post-infection indicating that this strain better controlled A. phagocy tophi lum infection.
- C3H/HeN strain was selected to determine mouse response to immunization with DNA vaccine followed by a recombinant protein vaccine encoding VirB9-l, VirB9-2 and VirB lO because the results presented here support previous work which indicate that C3H/HeN is a good model for phagocy tophi lum infection.
- mice 5 groups of 10 mice were vaccinated in a prime boost fashion with plasmid DNA immunization followed by recombinant proteins as described in Table 3.
- mice Two weeks after the last immunization, three mice were randomly selected for serum collection and for isolation of spleen and lymph nodes from each group. Preliminary serological work was performed using immunofluorescence assay (IF A) to determine how the immunized mice reacted to whole A. phagocy tophi lum organisms and to measure antibody titers. Antigen slides were prepared from A. phagocytophilum/HZ infected HL-60 cells. Sera from the three mice in each group were combined and serially diluted starting from 1 :80 up to 1 :81920. Ten microliters of serum was applied to each well with duplicates for each dilution and incubated for 1 hour at room temperature in a humidified chamber.
- IF A immunofluorescence assay
- the bacterial load in the blood ranged from 451 GE/ ⁇ up to 1267 GE/ ⁇ in the mice in Group I, from 358 GE/ ⁇ up to 2188 GE/ ⁇ in Group II, from 396 GE/ ⁇ up to 980 GE/ ⁇ in Group III, from 118 GE/ ⁇ up to 2225 GE/ ⁇ in Group IV and from 607 GE/ ⁇ up to 2988 GE/ ⁇ in negative control Group V (Fig. 4).
- VirBlO and the mixture of VirB9-l, VirB9-2 and VirBlO developed antibodies that reacted with A. phagocytophilum.
- real-time qPCR of DNA extracted from the blood of the challenged mice showed that the bacterial load was significantly lower only in Group III when compared to the negative control mice in Group V.
- Such an result was not expected in view of the antibody titers observed in the Group II and Group IV mice and in view of the Group IV animals that were immunized (primed and boosted) with a mixture of VirB9-l, VirB9-2 and VirB lO (see Table 3 and Figure 3).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The invention pertains to the use of VirB10 to immunize a host against an infection by a bacterium having T4SS. The invention provides a vaccine comprising VirB10, a fragment of VirB10, a polynucleotide encoding VirB10 or a polynucleotide encoding a fragment of VirB10 and a pharmaceutically acceptable carrier and/or adjuvant. The invention also provides a method of immunizing a host against an infection caused by a bacterium having T4SS, the method comprising administering to the host a vaccine of the invention. The vaccines and the methods of the invention can be used to immunize against infections caused by bacteria having T4SS in dogs, rabbits, cats, pigs, cattle, sheep, goats, deer, horses, rodents and humans.
Description
DESCRIPTION
VIRB10 FOR VACCINATION AGAINST GRAM NEGATIVE BACTERIA CROSS-REFERENCE TO RELATED APPLICATION
This application claims the benefit of U.S. Provisional Application Serial No. 62/180,245, filed June 16, 2015, the disclosure of which is hereby incorporated by reference in its entirety, including all figures, tables and amino acid or nucleic acid sequences.
This invention was made with government support under U54AI1057156 awarded by National Institutes of Health. The government has certain rights in the invention.
The Sequence Listing for this application is labeled "Seq-List.txt" which was created on June 10, 2016 and is 343 KB. The entire content of the sequence listing are incorporated herein by reference in its entirety. BACKGROUND OF THE INVENTION
Type 4 secretion system (T4SS) is used by many gram negative bacteria, including certain pathogenic bacteria, to secrete effector proteins and DNA across cell membranes.
The bacteria belonging to the genus Rickettsia and Anaplasma provide examples of the pathogenic bacteria having T4SS. Rickettsial diseases are present worldwide and pose the threat of use in a biological weapon. Vaccines currently available against diseases mediated by the bacteria having T4SS are inadequate.
BRIEF SUMMARY OF THE INVENTION
T4SS is typically formed from a macromolecular complex of about 12 proteins. One of the proteins of T4SS is VirBlO. The invention provides for the use of VirBlO to immunize against an infection by a bacterium having T4SS. Accordingly, the invention provides a vaccine comprising VirBlO, a fragment of VirBlO, a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirB lO and a pharmaceutically acceptable carrier and/or an adjuvant.
The invention also provides a method of immunizing a host against an infection caused by a bacterium having T4SS, the method comprising administering to the host a vaccine comprising or consisting of VirB lO, a fragment of VirBlO, a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirB lO and a pharmaceutically
acceptable carrier and/or an adjuvant. The vaccines and the methods of the invention can be used to prevent infections caused by bacteria having T4SS in various hosts, for example, dogs, rabbits, cats, pigs, cattle, sheep, goats, deer, horses, rodents and humans. BRIEF DESCRIPTION OF THE DRAWINGS
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication, with color drawing(s), will be provided by the Office upon request and payment of the necessary fee.
Figures 1A-1F. SDS-PAGE and Western Blot analysis of the recombinant proteins VirB9-l, VirB9-2 and VirB lO. SDS-PAGE analysis of recombinant VirB9-l (A), VirB9-2 (C), and VirB lO (E). Lanes represent the different fractions analyzed during the purification procedure, 1 = Total crude protein, 2 = Supernatant fraction obtained after high speed centrifugation, 3 = Filtered supernatant, 4 = Nickel Column filtrate, 5 = Washed fraction, 6 = Eluted protein, 7 = Concentrated protein. Western Blot analysis using the monoclonal anti- His6-tag antibody reacting with the recombinant protein (red arrows) VirB9-l (33.5KDa) (B), VirB9-2 (31.6KDa) (D) and VirB lO (52.2KDa) (F) in different fractions.
Figure 2. A. phagocytophilum burden in mouse blood (different strains infected with HZ). A. phagocytophilum growth kinetics in blood were measured by determining GE/μΙ based on the single copy gene msp5. GE/μΙ calculations were normalized based on the volume of blood collected per animal at each time point.
Figures 3A-3B. A. phagocytophilum antibody responses in immunized C3H/HeN mice. A) A. phagocytophilum specific antibody responses in immunized mice were measured by IFA and titers expressed as the reciprocal of the highest dilution at which specific fluorescence was detected (B). Binding of antibodies specific to A. phagocytophilum was seen as defined red fluorescent inclusions (morulae) in infected HL-60 cells; in contrast similar fluorescent inclusions were not visualized using antibodies from negative control group V. Picture taken at 1 : 160 dilution of all antisera.
Figure 4. A. phagocytophilum burden in immunized/challenged C3H/HeN mice blood. A. phagocytophilum growth kinetics in blood were measured by determining GE/μΙ based on the single copy gene msp5. GE/μΙ calculations were normalized based on the volume of blood collected per animal at each time point.
Figure 5. Protection against A. phagocytophilum induced by immunization. A. phagocytophilum GE means plus standard deviations (error bars) at the peak of infection. 7
mice from each group were used for this analysis. The values that are significantly different from the values for the control group are indicated by asterisks *, p <0.05.
Figure 6. 3 mice from the groups immunized with either VirBlO or ovalbumin control were sacrificed prior to challenge. Their antibody response was assayed by ELISA using intact A. phagocytophilum organisms attached to the ELISA plate. The values represent the average of duplicate readings from the three mice in either the VirBlO or control group. The data show the response of VirB lO-immunized mice to whole organisms on the plate and suggest epitopes of VirBlO are surface-exposed and available to bind antibodies.
Figure 7. CLUSTAL format alignment of VirB lOs from multiple organisms by MAFFT (v7.220) (Amarginale_Virb, SEQ ID NO: 123; Aphagocytophilu, SEQ ID NO: 124; Echaffeenis Vi, SEQ ID NO: 125; Eruminantium Vi, SEQ ID NO: 126; Rtyphi VirblO C, SEQ ID NO: 127; Rprowazekii Vir; SEQ ID NO: 128; Rconorii VirBlO; SEQ ID NO: 129; Rrickettsii Vir, SEQ ID NO: 130; Otsutsugamushi_, SEQ ID NO: 131; and Ecoli_VirB10_3J, SEQ ID NO: 132).
BRIEF DESCRIPTION OF THE SEQUENCES SEQ ID NO: 1: Sequence of VirBlO from A. phagocytophilum strain HZ.
SEQ ID NO: 2: Sequence of VirB9-l protein from A. phagocytophilum strain HZ. SEQ ID NO: 3: Sequence of VirB9-2 protein from A. phagocytophilum strain HZ. SEQ ID NO: 4: Forward primer for amplification of DNA encoding Vir9B-l protein.
SEQ ID NO: 5: Reverse primer for amplification of DNA encoding Vir9B-l protein. SEQ ID NO: 6: Forward primer for amplification of DNA encoding Vir9B-2 protein.
SEQ ID NO: 7: Reverse primer for amplification of DNA encoding Vir9B-2 protein.
SEQ ID NO: 8: Forward primer for amplification of DNA encoding VirB lO.
SEQ ID NO: 9: Reverse primer for amplification of DNA encoding VirBlO.
SEQ ID NO: 10: Forward primer for amplification of msp5 gene from A. phagocytophilum strain HZ for qPCR.
SEQ ID NO: 11: Reverse primer for amplification of msp5 gene from A. phagocytophilum strain HZ for qPCR.
SEQ ID NO: 12: Sequence of the qPCR probe for msp5 gene from A. phagocytophilum strain HZ.
SEQ ID NOs: 13 to 27: Sequences of antigenic peptides of VirB lO.
SEQ ID NOs: 28-113: VirBlO sequences obtained from UniProt (web site: uniprot.org/uniprot).
SEQ ID NOs: 114-122: Sequences of PCR primers used to amplify VirB9-l, VirB9- 2 and VirBlO and Taqman qPCR primers and probes used to quantify A. phagocytophilum load.
SEQ ID NOs: 123-132: Sequences of VirB lOs from multiple organisms.
DETAILED DISCLOSURE OF THE INVENTION
Human granulocytic anaplasmosis (HGA) is a tick-borne disease caused by the etiologic agent phagocytophilum, a bacterium containing T4SS. HGA was designated as a nationally notifiable disease in the United States in 1998. HGA is described as a zoonosis since the pathogen infects humans as well as animals including dogs, cattle, sheep, deer, horses and rodents. Vaccines against HGA are not currently available and the currently available vaccines against other bacteria containing T4SS are not adequate. Thus, the subject application provides a component of T4SS as a vaccine against diseases caused by bacteria having T4SS, for example, A. phagocytophilum and methods of immunizing a host against an infection by a bacterium having T4SS. In some embodiments, outer membranes and fragments thereof that are obtained from bacteria having T4SS and which contain VirBlO are excluded as vaccine components in the methods of immunizing a host against infection by a bacterium having T4SS or as components of a vaccine.
In one embodiment, the invention provides a protein present in T4SS, for example, VirBlO or a fragment of VirBlO, to immunize against an infection by a bacterium having T4SS, for example, A. phagocytophilum. In another embodiment, the invention provides a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO to immunize against an infection by a bacterium having T4SS, for example, A. phagocytophilum. In particular embodiments, the VirBlO polypeptide comprises SEQ ID NO: 1.
Typically, T4SS is present in gram negative bacteria, such as Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp., and Anaplasma spp.
Non-limiting examples of the bacterial species containing endogenous T4SS include: Rickettsia typhi, Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, Bartonella species, Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium, Brucella species and Ehrlichia canis. Additional examples of bacterial species having T4SS and in which the invention can be practiced are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention. The subject invention can also provide protection against bacterial species that lack an endogenous T4SS system and which have been genetically manipulated to express T4SS.
In one embodiment, VirBlO of Anaplasma phagocytophilum or a fragment of VirB lO can be used to immunize a host against A. phagocytophilum infection. VirBlO in bacteria other than A. phagocytophilum can be identified based on sequence homology and such VirBlO or their fragments can be used in a vaccine to immunize against the infection by bacteria having T4SS. The following list provides non-limiting examples of UniProt entries for VirB lO proteins (each of which is hereby incorporated by reference in its entirety) in various bacteria having T4SS: A0A011QMA5 (SEQ ID NO: 28), A0A011TLZ5 (SEQ ID NO: 29), A0A021WBD5 (SEQ ID NO: 30), A0A021XC05 (SEQ ID NO: 31), A0A059FPP8 (SEQ ID NO: 32), A0A061Q3H1 (SEQ ID NO: 33), A0A063X2U5 (SEQ ID NO: 34), A0A068HFV0 (SEQ ID NO: 35), A0A069HMU4 (SEQ ID NO: 36), A0A070A750 (SEQ ID NO: 37), A0A071M5U1 (SEQ ID NO: 38), A0A073IY47 (SEQ ID NO: 39), A0A074MLS9 (SEQ ID NO: 40), A0A074TCY6 (SEQ ID NO: 41), A0A076G4V3 (SEQ ID NO: 42), A0A085AA72 (SEQ ID NO: 43), A0A085IIV0 (SEQ ID NO: 44), A0A090MT70 (SEQ ID NO: 45), A0A095CKP1 (SEQ ID NO: 46), A0A099QA58 (SEQ ID NO: 47), A0A0A0XLH7 (SEQ ID NO: 48), A0A0A1FHZ1 (SEQ ID NO: 49), A0A0A1IXK7 (SEQ ID NO: 50), A0A0A1PDK4 (SEQ ID NO: 51), A0A0A6W9W5 (SEQ ID NO: 52), A0A0B2BVJ6 (SEQ ID NO: 53), A0A0B2C1C1 (SEQ ID NO: 54), A0A0B5E2C6 (SEQ ID NO: 55), A0A0B7J1D9 (SEQ ID NO: 56), A0A0B7MV56 (SEQ ID NO: 57), A0A0C1ELG7 (SEQ ID NO: 58), A0A0C1MQK6 (SEQ ID NO: 59), A0A0D6GL13 (SEQ ID NO: 60), A0A0D6PK86 (SEQ ID NO: 61), A0A0D6QEJ3 (SEQ ID NO: 62), A1YBN8 (SEQ ID NO: 63), A3U3E8 (SEQ ID NO: 64), A3UHL6 (SEQ ID NO: 65), A3VIX9 (SEQ ID NO: 66), A3XDX0 (SEQ ID NO: 67), A5CFI6 (SEQ ID NO: 68), A7FCK5 (SEQ ID NO: 69), B2FJH5 (SEQ ID NO: 70), B4RHY3 (SEQ ID NO: 71), B6JK51 (SEQ ID NO: 72), B9JE62 (SEQ ID NO: 73), C3KFT1 (SEQ ID NO: 74), C6V5M2 (SEQ ID NO: 75), D3NTS2 (SEQ
ID NO: 76), D5T6H3 (SEQ ID NO: 77), E0SJI8 (SEQ ID NO: 78), E5Y6Z7 (SEQ ID NO: 79), F0J7S0 (SEQ ID NO: 80), F4GMM5 (SEQ ID NO: 81), F7XVQ3 (SEQ ID NO: 82), H2ERZ5 (SEQ ID NO: 83), H9AY00 (SEQ ID NO: 84), I0EPK5 (SEQ ID NO: 85), I4MQG7 (SEQ ID NO: 86), I7F101 (SEQ ID NO: 87), J0B7G3 (SEQ ID NO: 88), J1IY73 (SEQ ID NO: 89), J8TK55 (SEQ ID NO: 90), K9P1 S4 (SEQ ID NO: 91), L7SYL6 (SEQ ID NO: 92), N1MFN1 (SEQ ID NO: 93), Q0FXR1 (SEQ ID NO: 94), Q1LN34 (SEQ ID NO: 95), Q2K2E3 (SEQ ID NO: 96), Q2YJ81 (SEQ ID NO: 97), Q52SK2 (SEQ ID NO: 98), Q5EPB9 (SEQ ID NO: 99), Q69BE6 (SEQ ID NO: 100), Q8RPM1 (SEQ ID NO: 101), Q9A5M5 (SEQ ID NO: 102), Q9AGG7 (SEQ ID NO: 103), S2WS02 (SEQ ID NO: 104), S5YJB5 (SEQ ID NO: 105), S9QA92 (SEQ ID NO: 106), T0HQB6 (SEQ ID NO: 107), T0QH67 (SEQ ID NO: 108), T1XMT8 (SEQ ID NO: 109), U1H6S8 (SEQ ID NO: 110), V8QMP0 (SEQ ID NO: 111), X6JZV3 (SEQ ID NO: 112) and X7EE79 (SEQ ID NO: 113). A person of ordinary skill in the art can identify VirB lO in additional bacteria having T4SS and such embodiments are within the purview of the invention.
Accordingly, an embodiment of the invention provides a vaccine comprising an immunologically effective amount of VirBlO or a fragment of VirB lO and a pharmaceutically acceptable carrier and/or an adjuvant. Another embodiment of the invention provides a vaccine comprising an immunologically effective amount of a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant. For the purposes of this invention the term "immunologically effective amount" refers to the amount of VirB lO or a fragment of the VirBlO which elicits immune response in a host so that the host is protected from future infection caused by the bacterium in which VirBlO is present naturally (endogenously) or a bacterium genetically modified to express VirBlO.
The term "endogenous" (and grammatical variations thereof) or the phrase "the bacterium in which VirBlO is present naturally" indicates that a particular VirBlO is a part of the T4SS present in the bacterium as the bacterium exists in nature, i.e., in the wild type bacterium.
In one embodiment VirBlO, a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO is labeled. The label can be designed for in vivo visualization of the protein, peptide or polynucleotide, for targeting the protein, peptide or polynucleotide to a specific tissue, organ or cell of the host, to increase the in vivo
stability of the protein, peptide or polynucleotide or to increase immunogenicity of the protein or peptide.
Non-limiting examples of a label designed to visualize VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO include a fluorescent label, an enzyme label and a chromophore label. Additional examples of labels designed to visualize VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
A label designed to target VirBlO, a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO to a tissue, organ or cell includes antibodies or fragments of antibodies or other biomolecules which specifically bind to one or more surface biomolecules present on the target tissue, organ or cell. The label can be designed to target, for example, Fc receptors, C-type lectins, complement receptors, major histocompatibility proteins, or other receptors present on the surface of dendritic cells or antigen presenting cells. Additional examples of suitable target biomolecules and corresponding binding biomolecules are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
A label designed to increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirBlO includes tripalmitoyl-S-glyceryl cysteine, polylysine core, carbohydrate, N-pyroglutamate, amide group on the C terminus, acetyl group, glycosyl group, lipid group, unnatural amino acids, peptidomimetics, peptide carriers and polyethylene glycol (PEG). Non-limiting examples of labels that increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirBlO are discussed in Goodwin et al. The contents of Goodwin et al. are herein incorporated by reference in their entirety. Additional examples of labels which can increase the in vivo stability or immunogenicity of VirBlO or a fragment of VirB lO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
In one embodiment, VirBlO or a fragment of VirB lO is modified to increase its in vivo stability. Non-limiting examples of modifications which increase the in vivo stability of VirBlO or a fragment of VirBlO include incorporation of non-natural amino acids, pseudo- peptide bonds and cyclization. Additional examples of modifications that increase the in vivo stability of VirB lO or a fragment of VirBlO are also described in Goodwin et al. and Gentilucci et al. The contents Goodwin et al. and Gentilucci et al. are herein incorporated by
reference in their entirety. Additional examples of modifications which can increase the in vivo stability of VirB lO or a fragment of VirBlO are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
An embodiment of the invention provides a vaccine comprising a fragment of VirBlO or a polynucleotide encoding a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant, wherein the fragment elicits an immune response in a host and the host is immune to a future infection caused by the bacterium in which the particular VirBlO is present naturally. The fragment of VirB 10 used in the vaccines of the invention can comprise about 5 to about 50, about 10 to about 40, about 15 to about 30, about 20, about 10 or about 5 amino acids.
In one embodiment, the fragment of VirB lO is selected from the fragments provided in Table 1. In another embodiment, the VirB lO fragment or VirBlO polypeptide can be fused to a heterologous sequence, such as a carrier protein (e.g., bovine serum albumin, keyhole limpet hemocyanin, ovalbumin or other carrier protein used to stimulate an immune response to peptides).
Table 1. Examples of fragments of VirB lO protein used in the vaccines of the invention.
Start End
SEQ Position in Position
Sequence
ID NO SEQ ID in SEQ
NO: 1 ID NO: 1
13 16 DNVNVVGVAKSKKLFVIIVVLIATGLMYYFF 46
14 85 APRILTPPPRLPELPPLVMPTVPDIPVVTKLLKP 118
15 147 EISLPLPYK 155
16 214 QSPSVRA 220
17 227 RYIILQG 233
18 235 MIDAVLET 242
19 247 DISGVLRAVVSRD VYAS SGD AVVIPKG 273
20 275 RLIGSYFF 282
21 289 VRVDVNWSRVILPHGVDIQIA 309
22 321 ISGVVDN 327
23 329 VGSILT STIFL AGISLGT AYVTEQIP S 355
24 357 RTETVKVET 365
25 376 TSSSLSTKIVSD 387
26 407 TPTVYVDQ 414
27 416 TVMKVFVNQDVVFP 429
The vaccine of the invention can be formulated using adjuvants, emulsifiers, pharmaceutically-acceptable carriers or other ingredients routinely provided in a vaccine. Optimum formulations can be readily designed by one of ordinary skill in the art and can include formulations for immediate release and/or for sustained release, and for induction of systemic immunity and/or induction of localized mucosal immunity (e.g, the formulation can be designed for intranasal, intravaginal or intrarectal administration).
Guidelines for designing optimal vaccines can be found in Brito et al., Avanti and Li et al. The contents of Brito et al. are herein incorporated by reference in their entirety, particularly, page 132, Table 1; page 133 under immune potentiator adjuvants; page 133-136 under aluminum salt adjuvants; page 136-139 under emulsions; 139-140 under liposomes as adjuvants; page 140-141 under PLG particulate delivery systems; and page 141 under alternate particulate systems. The contents of Avanti et al. are also herein incorporated by reference in their entirety, particularly Chapters 1, 2 and 7. Further, the contents of Li et al. are herein incorporated by reference in their entirety, particularly pages 521-527 under Particulate Peptide Vaccine Delivery Methods.
The vaccine disclosed herein can be formed with a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, or an adjuvant to produce a pharmaceutical composition. The carrier must be "acceptable" in the sense that it is compatible with the active ingredient of the composition, and preferably capable of stabilizing the active ingredient and not deleterious to the subject to be treated. The carrier is selected on the basis of the mode and route of administration and standard pharmaceutical practice. Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are described in Remington's Pharmaceutical Sciences.
In one embodiment, the antigen is mixed with an adjuvant to form a composition useful for immune modulation. This composition may be prepared as injectable, as liquid solutions or as emulsions. See U.S. Pat. Nos. 4,601,903; 4,599,231; 4,599,230; and 4,596,792. An "adjuvant" refers to a substance added to an immunogenic composition, such as a vaccine, that, while not having any specific antigenic effect in itself, can stimulate the immune system and increase the immune response to the immunogenic composition. Examples of adjuvants include, but are not limited to, alum, alum-precipitate, Freund's complete adjuvant, Freund's incomplete adjuvant, monophosphoryl-lipid A/trehalose dicorynomycolate adjuvant and water in oil emulsions.
A further embodiment of the invention provides a method of immunizing a host against an infection by a bacterium having T4SS, the method comprising administering to the host a vaccine comprising a pharmaceutically effective amount of VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding the fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant.
The method of the invention can be used to immunize a host, for example, a mammal, against an infection by a bacterium having the T4SS. Non-limiting examples of mammals in which the methods of the invention can be practiced include dogs, cats, pigs, cattle, rabbits, sheep, goats, deer, horses, rodents and humans. Additional examples of hosts in which the methods of the invention can be practiced are well known to a person of ordinary skill in the art and such embodiments are within the purview of the invention.
In one embodiment, the invention provides a method of immunizing a host against an infection by a bacterium containing T4SS, wherein the method comprises administering to the host a vaccine comprising VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding the fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant, and wherein the bacterium is a member of Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp., and/or Anaplasma spp. In certain embodiments, the bacterium is Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, a Bartonella species, a Brucella species (e.g., Brucella abortus), Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium or Ehrlichia canis.
The vaccine of the invention can be administered by any convenient route including subcutaneous, intradermal, intranasal, oral, intramuscular, intraperitoneal, or other parenteral or enteral route. A person of ordinary skill in the art can identify a particular route of administration suitable for a particular host and a given bacterium and such embodiments are within the purview of the invention.
VirBlO, a fragment of VirB lO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO can be administered as a single dose or multiple doses. Optimum immunization schedules can be readily determined by the ordinarily skilled artisan and can vary with parameters, for example, age, weight and species of the host, the type of vaccine composition and the bacterium against which immunization is desired and such embodiments are within the purview of the invention.
An embodiment of the invention provides a method of immunizing a host against an infection by a bacterium having T4SS, wherein the immunization is performed according to prime boost immunization. For the purpose of this invention, the phrase "prime boost immunization" indicates that the VirB lO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO is administered in a plurality of doses. As such, the immune system of a host encounters multiple exposures to VirBlO, a fragment of VirBlO, a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO, which results in a stronger immune response compared to single administration of the vaccine. Certain examples of prime boost immunizations are discussed in Woodland et al., the contents of which are herein incorporated by reference in their entirety.
In one embodiment, the prime boost immunization comprises administering a pharmaceutically effective amount of a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirBlO followed by administering a pharmaceutically effective amount of VirB lO or a fragment of VirBlO. In another embodiment, the prime boost immunization comprises administering a pharmaceutically effective amount of VirB lO or a fragment of VirB lO followed by administering a polynucleotide encoding VirBlO or a polynucleotide encoding a fragment of VirB lO.
In certain embodiments, the interval between the administration of the polynucleotide and the protein or a fragment of the protein is about 1 week to about 4 weeks, about 2 weeks to 3 weeks, 2 to 4 weeks, or about 2 weeks. In another embodiment of the invention, the vaccine is administered in the form of a "cocktail" that contains at least two polynucleotides or at least two peptides. The cocktail can also contain a mixture of a polynucleotide and a peptide.
All patents, patent applications, provisional applications, and publications referred to or cited herein are incorporated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification.
Following are examples which illustrate procedures for practicing the invention. These examples should not be construed as limiting. All percentages are by weight and all solvent mixture proportions are by volume unless otherwise noted.
EXAMPLE 1 - PREPARATION OF SOLUBLE RECOMBINANT VIRB9-1, VIRB9-2
AND VIRB 10S
The open reading frames of A. phagocy tophi lum virB9-l, virB9-2 and virB lO genes were amplified by PCR (Table 2) and the purified products cloned into a DNA vaccine vector and the pET101/D-TOPO directional expression system. Recombinant constructs were purified and sequences were confirmed by PCR and DNA sequencing. The pETlOl constructs were re-transformed into E. coli BL21 Star (DE3) cells and induced to express with 0.5 mM IPTG and growth in M9 minimal media supplemented with 50 μg/ml carbenicillin and 1% glucose. Expression of recombinant VirB9-l, Vir9-2 and VirBlO was verified by SDS-PAGE followed by Western blot analyses using His6-tagged monoclonal antibody (Fig. 1). 500 ml of IPTG-induced cultures were processed and soluble fractions containing the recombinant His6-tagged fusion proteins were purified using low-density Nickel agarose bead columns. Eluted protein was concentrated using Centricon Plus-70 centrifugal filter units, and concentration determined using a Qubit protein assay kit. The recombinant proteins were run on a SDS-PAGE gel to confirm purity.
For preparation of the DNA vaccine, the VirB9-l, VirB9-2, and VirB lO were separately amplified by PCR and cloned into the vector pcDNA3.1/CT-GFP-TOPO (Invitrogen). This vector provides the CMV (cytomegalovirus) promoter 5' to the inserted gene for constitutive expression in mammalian cells and the GFP (Green Fluorescent Protein) gene 3' to the inserted gene. The validity of the constructs was checked prior to use in immunizations by sequencing the gene insert and junction regions and by transfecting RF6A endothelial cells with isolated plasmid DNA to verify GFP expression by fluorescence. For preparation of immunizing plasmid DNA, bacteria were grown in LB/Ampicillin 100 μg/ml. The ZR Plasmid Gigaprep kit (Zymo Research) was used to isolate endotoxin-free plasmid DNA from the bacterial pellets. The yields of DNA obtained were: TOPO-GFP (control, no inserted gene): 6 liters of culture gave ~6.5mg; VirB 9-1 plasmid: 6 liters of culture gave ~ 29mg; VirB 9-2 plasmid: 6 liters of culture gave ~19mg; and VirBlO plasmid: 4 liters of culture gave ~23mg.
The culture and purification conditions described above were optimized to produce adequate yields of soluble recombinant VirB9-l, VirB9-2 and VirBlO. For protein expression the temperature was reduced to 4°C to avoid protein aggregation and reduction of heat shock proteases that could promote inclusion body formation, cellular toxicity and high levels of protein degradation. Additionally, modification of nutrient media was employed to
avoid excess bacterial growth and depletion of substrates and cofactors. This resulted in the isolation of soluble recombinant VirB9-l, VirB9-2 and VirBlOs (Fig. 1) suitable for use in the immunization experiments.
Table 2. PCR primers used to amplify VirB9-l, VirB9-2 and VirBlO and Taqman qPCR primers and probes used to quantify A. phagocy tophi lum load.
PCR Target Size
AB1703 CACCATGAGCACAAATATTGGCGTACCAG (SEQ
ID NO: 114)
virB9-l 769bp AB1704 ACTAAGAGCCTGATTC ACAACTTCTAC ACTCCTGC
(SEQ ID NO: 115)
AB1705 CACCATGGCTGATGATCACATTAAGACCTTGAAC
(SEQ ID NO: 116)
virB9-2 736bp AB1706 TTTCCGGCGTCTTTCAGCACCCTTC (SEQ ID NO:
117)
AB1707 CACCATGGCTGACGAAATAAGGGGTTCTAG (SEQ
ID NO: 118)
virBlO 1306bp AB1708 CCTCACCGCATCACGAGGAAATACTACG (SEQ ID
NO: 119)
qPCR
AB1334 AGATGCTGACTGGGGATGAG (SEQ ID NO: 120)
AB1335 TCGGCATCAACCAAGTACAA (SEQ ID NO: 121) msp5 125bp *AB1336 CGTAGGTGAGTCTGATAGTGAAGG (SEQ ID NO:
122)
* Oligonucleotide labeled with Hexachloro-fluorescein (HEX) at the 5' end and
Tetramethylrhodamine T AMRA at the 3 ' end
EXAMPLE 2 - A. PHAGOCYTOPHIL UM INFECTION KINETICS IN DIFFERENT
MOUSE STRAINS
Three different mouse strains (C57BL/6, C3H/HeN, and Balb/C) were tested to evaluate A. phagocy tophi lum infection kinetics and to select an appropriate mouse strain for A. phagocy tophi lum infection for immunization and challenge experiments. Two C57BL/6, two C3H/HeN and two Balb/C mice were inoculated with isolated organisms from 5.22 x 105 infected HL-60 cells (> 90% infection). DNA extracted from blood collected every other day over 24 days was used to determine the A. phagocy tophi lum load by measuring the increase in the number of genome equivalents (GE) using qPCR with primers and probes that target the single copy gene msp5 (Table 2). Ten-fold serial dilutions of the NY18E2/pCR-TOPO
plasmid carrying the msp5 gene were used for standard curve preparation, and the msp5 gene copy numbers were calculated based on the standard curve.
Results showed that C3H/HeN and Balb/C mice are susceptible to A. phagocy tophi lum (human HZ strain) infection as shown by an increase of GE in blood at 8 days post-infection for C3H/HeN mice (average of 705 GE/μΙ of blood) and between 6 and 8 days post-infection in Balb/C mice (average of 636 GE/μΙ of blood) (Fig. 2). In contrast, in C57BL/6 mice, only mouse # 2 presented a minor increase of up to 150 GE/μΙ of blood at day 6 post-infection indicating that this strain better controlled A. phagocy tophi lum infection. During the course of infection, a relapse peak of infection was detected after 16 days postinfection in both C3H/HeN and Balb/C strains suggesting a possible chronic infection. C3H/HeN strain was selected to determine mouse response to immunization with DNA vaccine followed by a recombinant protein vaccine encoding VirB9-l, VirB9-2 and VirB lO because the results presented here support previous work which indicate that C3H/HeN is a good model for phagocy tophi lum infection.
Immunization and challenge of C3H/HeN
5 groups of 10 mice were vaccinated in a prime boost fashion with plasmid DNA immunization followed by recombinant proteins as described in Table 3.
Table 3. C3H/HeN mice immunization schedule.
Two weeks after the last immunization, three mice were randomly selected for serum collection and for isolation of spleen and lymph nodes from each group. Preliminary serological work was performed using immunofluorescence assay (IF A) to determine how the immunized mice reacted to whole A. phagocy tophi lum organisms and to measure antibody titers. Antigen slides were prepared from A. phagocytophilum/HZ infected HL-60
cells. Sera from the three mice in each group were combined and serially diluted starting from 1 :80 up to 1 :81920. Ten microliters of serum was applied to each well with duplicates for each dilution and incubated for 1 hour at room temperature in a humidified chamber. After incubation the serum was removed and the slides washed five times for 5 minutes. Ten microliters of Alexa fluor 568-Goat anti -mouse IgG antibody at a dilution of 1 : 1600 was applied to each well and incubated for 1 hour at room temperature. The slides then were washed as described above and mounted with ProLong Gold antifade reagent with DAPI (4',6-diamidino-2-phenylindole) (Fig. 3). IFA analysis showed that higher titers of antibodies against A. phagocytophilum were detected in the serum of vaccinated animals (Groups I through IV), compared to negative control mice (Group V) vaccinated with Empty TOPO- G /Ovalbumin (Fig. 3).
Protection against phagocytophilum induced by virB9/\k 9, virB9-2 /VirB9-2, and virBl 0/VirBlO was evaluated. 35 immunized mice (7 mice/group) were challenged with one dose of isolated organisms from 5.63 x 105 HL-60 infected cells (> 90% infected) and the bacterial burden in the blood of each mouse was measured by real time qPCR targeting the single copy gene msp5 to determine the number of A. phagocytophilum GE as described above. On day 8, the bacterial load in the blood ranged from 451 GE/μΙ up to 1267 GE/μΙ in the mice in Group I, from 358 GE/μΙ up to 2188 GE/μΙ in Group II, from 396 GE/μΙ up to 980 GE/μΙ in Group III, from 118 GE/μΙ up to 2225 GE/μΙ in Group IV and from 607 GE/μΙ up to 2988 GE/μΙ in negative control Group V (Fig. 4). However real time qPCR did not detect any A. phagocytophilum GE in one mouse from Group I, or in two mice from Group III. Although the bacterial load in Groups I, II and IV was lower than in Group V, these differences were not significant. In contrast, there was a significant difference between the bacterial load in Group III when compared with Group V (p = 0.032).
These results indicate that immunized mice (pre-challenge) with VirB9, VirB9-2,
VirBlO and the mixture of VirB9-l, VirB9-2 and VirBlO developed antibodies that reacted with A. phagocytophilum. However real-time qPCR of DNA extracted from the blood of the challenged mice showed that the bacterial load was significantly lower only in Group III when compared to the negative control mice in Group V. Such an result was not expected in view of the antibody titers observed in the Group II and Group IV mice and in view of the Group IV animals that were immunized (primed and boosted) with a mixture of VirB9-l, VirB9-2 and VirB lO (see Table 3 and Figure 3).
It should be understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and the scope of the appended claims. In addition, any elements or limitations of any invention or embodiment thereof disclosed herein can be combined with any and/or all other elements or limitations (individually or in any combination) or any other invention or embodiment thereof disclosed herein, and all such combinations are contemplated within the scope of the invention without limitation thereto.
REFERENCES
Brito et al. (2013), Vaccine adjuvant formulations: A pharmaceutical perspective, Seminars in Immunology, 25: 130-145. Avanti (2012), Innovative strategies for stabilization of therapeutic peptides in aqueous formulations (Doctoral Dissertation), project D6-202 of the Dutch Top Institute Pharma. Li et al. (2014), Peptide Vaccine: Progress and Challenges, Vaccines, 2:515-536. Woodland et al. (2004), Jump-starting the immune system: prime-boosting comes of age, TRENDS in Immunology, 25(2):98-104. Goodwin et al. (2009), Peptides as therapeutics with enhanced bioactivity, Current Medicinal Chemistry, 19:4451-4461. Yang et al. (2009), An introduction to epitope prediction methods and software, Reviews in Medical Virology, 19: 77-96. Gentilucci et al. (2010), Chemical modifications designed to improve peptide stability: Incorporation of non-natural amino acids, pseudo-peptide bonds, and cyclization, Current Pharmaceutical Design, 16:3185-3203.
Claims
1. A vaccine comprising an immunologically effective amount of VirBlO or a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant.
2. The vaccine of claim 1, wherein VirBlO or the fragment of VirBlO is conjugated to a carrier protein.
3. The vaccine of claim 2, wherein the carrier protein is keyhole limpet hemocyanin, ovalbumin or bovine serum albumin.
4. The vaccine of claim 1, wherein VirBlO or the fragment of VirB lO is cyclized or comprises SEQ ID NO: 1.
5. The vaccine of claims 1-4, wherein the fragment of VirB lO comprises about 5 to about 50, about 10 to about 40, about 15 to about 30, about 20, about 10 or about 5 amino acids.
6. The vaccine of claim 1, wherein the fragment of VirBlO is selected from SEQ ID NO: 13 to 27.
7. A vaccine comprising an immunologically effective amount of a polynucleotide encoding VirB lO or a polynucleotide encoding a fragment of VirBlO and a pharmaceutically acceptable carrier and/or an adjuvant, said polynucleotide being operably linked to a promoter in a vector.
8. A method of immunizing a host against an infection by a bacterium having Type 4 secretory system (T4SS), the method comprising administering to the host the vaccine of any of claims 1-4, 6 or 7.
9. The method of claim 8, wherein the host is a mammal.
10. The method of claim 9, wherein the mammal is a dog, cat, pig, bovine, rabbit, sheep, goat, deer, horse, rodent or human.
11. The method of claims 9-10, wherein the bacterium having T4SS is a Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp. or Anaplasma spp.
12. The method of claim 11, wherein the bacterium is Rickettsia typhi, Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, Bartonella species, Brucella abortus, Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium or Ehrlichia canis.
13. The method of claims 8-12 or 16-18, wherein the vaccine is administered via a subcutaneous, intradermal, intranasal, oral, intramuscular or intraperitoneal route.
14. The method of claims 8-13 or 16-18, wherein the vaccine is administered in a single dose or multiple doses.
15. The method of claims 8-14 or 16-18, wherein the vaccine is administered according to prime boost immunization.
16. A method of immunizing a host against an infection by a bacterium having Type 4 secretory system (T4SS), the method comprising administering to the host the vaccine of claim 5.
17. The method of claim 8, wherein the bacterium having T4SS is a Rickettsia spp., Ehrlichia spp., Helicobacter spp., Legionella spp., Bartonella spp., Brucella spp. or Anaplasma spp.
18. The method of claim 17, wherein the bacterium is Rickettsia typhi, Rickettsia prowazekii, Rickettsia rickettsia, Rickettsia conorii, Ehrlichia chaffeensis, Helicobacter pylori, Legionella pneumophila, Bartonella species, Brucella abortus, Anaplasma marginale, Anaplasma phagocytophilum, Ehrlichia ruminantium or Ehrlichia canis.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/580,740 US10918707B2 (en) | 2015-06-16 | 2016-06-16 | VirB10 for vaccination against gram negative bacteria |
| US17/142,792 US12186381B2 (en) | 2015-06-16 | 2021-01-06 | VirB10 for vaccination against gram negative bacteria |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562180245P | 2015-06-16 | 2015-06-16 | |
| US62/180,245 | 2015-06-16 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/580,740 A-371-Of-International US10918707B2 (en) | 2015-06-16 | 2016-06-16 | VirB10 for vaccination against gram negative bacteria |
| US17/142,792 Continuation US12186381B2 (en) | 2015-06-16 | 2021-01-06 | VirB10 for vaccination against gram negative bacteria |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016205434A1 true WO2016205434A1 (en) | 2016-12-22 |
Family
ID=57546349
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/037728 Ceased WO2016205434A1 (en) | 2015-06-16 | 2016-06-16 | Virb10 for vaccination against gram negative bacteria |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US10918707B2 (en) |
| WO (1) | WO2016205434A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018145182A1 (en) * | 2017-02-09 | 2018-08-16 | Biotick Pesquisa E Desenvolvimento Tecnológico Ltda. | Hybrid peptide, set of hybrid peptides, composition, uses of the hybrid peptide, method for inducing an immune response and kits |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016205434A1 (en) | 2015-06-16 | 2016-12-22 | University Of Florida Research Foundation, Incorporated | Virb10 for vaccination against gram negative bacteria |
| US11851644B2 (en) | 2019-05-02 | 2023-12-26 | University Of Rhode Island Board Of Trustees | Marine bacteria formulation useful in aquaculture |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090280137A1 (en) * | 2007-11-07 | 2009-11-12 | Auburn University | Methods, Compositions, and Sequences of ZP-Binding Peptides for Immunocontraception of Dogs and Other Animals |
| US20110143377A1 (en) * | 2009-02-27 | 2011-06-16 | Medical Diagnostic Laboratories, Llc | Protein fragments of virB10 and sero-detection of anaplasma phagocytophium |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ATE355083T1 (en) * | 1999-12-08 | 2006-03-15 | Vercell Biotechnology Bv | POLYACRYLAMIDE GEL KIT FOR THE PRODUCTION OF A CAPSULE IN THE TISSUE OF A MAMMAL ORGANISM AND ANIMAL ALLOGENE OR XENOGENE CELLS, FOR THE TREATMENT OF ONCOLOGICAL DISEASES AND DIABETES MELLITUS |
| US20100143411A1 (en) * | 2008-05-27 | 2010-06-10 | Washington State University | Method for identification of t-lymphocyte antigens |
| US8323907B2 (en) * | 2009-02-27 | 2012-12-04 | Medical Diagnostic Laboratories, Llc | Type IV secretion system proteins in sero-detection of Anaplasma phagocytophilum |
| WO2016205434A1 (en) | 2015-06-16 | 2016-12-22 | University Of Florida Research Foundation, Incorporated | Virb10 for vaccination against gram negative bacteria |
-
2016
- 2016-06-16 WO PCT/US2016/037728 patent/WO2016205434A1/en not_active Ceased
- 2016-06-16 US US15/580,740 patent/US10918707B2/en active Active
-
2021
- 2021-01-06 US US17/142,792 patent/US12186381B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090280137A1 (en) * | 2007-11-07 | 2009-11-12 | Auburn University | Methods, Compositions, and Sequences of ZP-Binding Peptides for Immunocontraception of Dogs and Other Animals |
| US20110143377A1 (en) * | 2009-02-27 | 2011-06-16 | Medical Diagnostic Laboratories, Llc | Protein fragments of virB10 and sero-detection of anaplasma phagocytophium |
Non-Patent Citations (3)
| Title |
|---|
| ARAUJO, F. R. ET AL.: "IgG and IgG2 antibodies from cattle naturally infected with Anaplasma marginale recognize the recombinant vaccine candidate antigens VirB9, VirB10, and elongation factor-Tu", MEMORIAS DO INSTITUTO OSWALDORCRUZ, vol. 103, no. 2, 2008, pages 186 - 190, XP055339238 * |
| CASTELAO, A. B. C. ET AL.: "Characterization of the immunogenicity of recombinant proteins VirB9, VirB10 and Elongation Factor Tu of Anaplasma marginale in mice", BRAZILIAN JOURNAL OF VETERINARY RESEARCH AND ANIMAL SCIENCE, vol. 49, no. 5, 2012, pages 377 - 385, XP055339242 * |
| MORSE, K. ET AL.: "Association and evidence for linked recognition of type IV secretion system proteins VirB9-1, VirB9-2, and VirBlO in Anaplasma marginale", INFECTION AND IMMUNITY, vol. 80, no. 1, 2012, pages 215 - 227, XP055339236 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018145182A1 (en) * | 2017-02-09 | 2018-08-16 | Biotick Pesquisa E Desenvolvimento Tecnológico Ltda. | Hybrid peptide, set of hybrid peptides, composition, uses of the hybrid peptide, method for inducing an immune response and kits |
| US11034735B2 (en) | 2017-02-09 | 2021-06-15 | Biotick Pesquisa E Desenvolvimento Tecnológico Ltda. | Hybrid peptide, set of hybrid peptides, composition, uses of the hybrid peptide, method for inducing an immune response and kits |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210205430A1 (en) | 2021-07-08 |
| US12186381B2 (en) | 2025-01-07 |
| US20180296657A1 (en) | 2018-10-18 |
| US10918707B2 (en) | 2021-02-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Cao et al. | Toxoplasma gondii: vaccination with a DNA vaccine encoding T-and B-cell epitopes of SAG1, GRA2, GRA7 and ROP16 elicits protection against acute toxoplasmosis in mice | |
| US12186381B2 (en) | VirB10 for vaccination against gram negative bacteria | |
| CA2900318C (en) | Induction of cross-reactive cellular response against rhinovirus antigens | |
| US20160333056A1 (en) | Mutant fragments of ospa and methods and uses relating thereto | |
| TW201803907A (en) | Biofusion proteins as anti-malaria vaccines | |
| KR20180015185A (en) | Vaccine composition for swine genital respiratory syndrome and porcine circovirus related diseases | |
| Mann et al. | Protection in a gerbil model of amebiasis by oral immunization with Salmonella expressing the galactose/N-acetyl D-galactosamine inhibitable lectin of Entamoeba histolytica | |
| US20250152691A1 (en) | Immunogenic composition for paratuberculosis | |
| JP2025501740A (en) | Use of interferon as an adjuvant in vaccines | |
| Abdian et al. | Evaluation of DNA/DNA and prime-boost vaccination using LPG3 against Leishmania major infection in susceptible BALB/c mice and its antigenic properties in human leishmaniasis | |
| WO2010050903A1 (en) | Chimeric flagellins for vaccines | |
| CA2914555A1 (en) | Single domain antibody display | |
| US20160077093A1 (en) | Methods for detecting ehrlichia infection | |
| US20150079127A1 (en) | Canine babesiosis vaccine antigen | |
| EP1090994B1 (en) | Peptide repeat immunogens | |
| WO2018055331A1 (en) | Thermostable variants of p. falciparum pfrh5 which can be produced in bacterial cells | |
| KR20240109612A (en) | Compositions and methods for expressing antigens in cell membranes | |
| Ul Rehman et al. | Immuno-bioinformatic approach for designing of multi-epitope merozoite surface antigen of Babesia bigemina and evaluation of its immunogenicity in inoculated calves | |
| EP2358389A1 (en) | Vaccines, which combine the antigen and toll-like receptors | |
| ES2346064T3 (en) | VACCINE SUBUNITY OF LAWSONIA INTRACELLULARIS. | |
| JP2000510339A (en) | B. expressed in vivo burgdorferi polypeptide | |
| ES2441880A1 (en) | Composition containing polypeptides for the treatment of myiasis | |
| Coelho et al. | Immune response of calves immunized with cocktail of DNA vaccine encoding complexed outer membrane proteins from Anaplasma marginale | |
| Coelho et al. | Resposta imune de bezerros imunizados com um coquetel de vacina de DNA que codificam proteínas de membrana externa de Anaplasma marginale |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16812384 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15580740 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16812384 Country of ref document: EP Kind code of ref document: A1 |
