ES2441880A1 - Composition containing polypeptides for the treatment of myiasis - Google Patents

Composition containing polypeptides for the treatment of myiasis Download PDF

Info

Publication number
ES2441880A1
ES2441880A1 ES201231063A ES201231063A ES2441880A1 ES 2441880 A1 ES2441880 A1 ES 2441880A1 ES 201231063 A ES201231063 A ES 201231063A ES 201231063 A ES201231063 A ES 201231063A ES 2441880 A1 ES2441880 A1 ES 2441880A1
Authority
ES
Spain
Prior art keywords
sequence
peptide
pharmaceutical composition
veterinary
leu
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
ES201231063A
Other languages
Spanish (es)
Other versions
ES2441880B1 (en
Inventor
Antonio Osuna Carrillo de Albornoz
Gloria Maribel GONZÁLEZ GONZÁLEZ
Argentina YING
Gilberto ESKILDSEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universidad De Panama
Universidad de Granada
DE PANAMA, University of
Original Assignee
Universidad De Panama
Universidad de Granada
DE PANAMA, University of
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universidad De Panama, Universidad de Granada, DE PANAMA, University of filed Critical Universidad De Panama
Priority to ES201231063A priority Critical patent/ES2441880B1/en
Priority to PCT/ES2013/070481 priority patent/WO2014006262A1/en
Publication of ES2441880A1 publication Critical patent/ES2441880A1/en
Application granted granted Critical
Publication of ES2441880B1 publication Critical patent/ES2441880B1/en
Expired - Fee Related legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/45Transferases (2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0003Invertebrate antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to fragments of peptides homologous with those present in the sequence of arginine kinase that can confer protective immunity in mammals against infection by larvae of dipterous insects that can cause myiasis. The invention also relates to compositions containing said peptides for the use thereof as a vaccine against myiasis.

Description

COMPOSICiÓN BASADA EN POLlPÉPTIDOS PARA EL TRATAMIENTO DE MIASIS COMPOSITION BASED ON POLLPEPTIDES FOR THE TREATMENT OF MIASIS

CAMPO DE LA INVENCiÓN FIELD OF THE INVENTION

Esta invención se refiere a composiciones para su uso como vacunas que comprenden fragmentos polipeptídicos para el tratamiento de miasis. This invention relates to compositions for use as vaccines comprising polypeptide fragments for the treatment of myiasis.

ANTECEDENTES DE LA INVENCiÓN BACKGROUND OF THE INVENTION

Los insectos dípteros, y las moscas en particular, transmiten enfermedades que representan un grave peligro para la salud de personas y animales. A una escala global, provocan pérdidas de producción de aves de corral y ganado que se estima que representan miles de millones de dólares. El crecimiento y rendimiento de casi todos los animales de granja se ven adversamente afectados por moscas, especialmente cuando están presentes en números altos. Los animales infectados se vuelven nerviosos y se reduce drásticamente el consumo de alimentos. El resultado: reducciones significativas de producción de carne y leche, calidad de piel deteriorada y graves pérdidas económicas. Diptera insects, and flies in particular, transmit diseases that pose a serious danger to the health of people and animals. On a global scale, they cause production losses of poultry and livestock that are estimated to represent billions of dollars. The growth and yield of almost all farm animals are adversely affected by flies, especially when they are present in high numbers. Infected animals become nervous and food consumption is drastically reduced. The result: significant reductions in meat and milk production, deteriorated skin quality and serious economic losses.

Las moscas que no pican, a menudo se alimentan de secreciones de los ojos, nariz y cualquier herida pequeña de ganado, esto distrae a los animales del pasto, provocando una reducción en crecimiento y productividad. Las moscas que no pican no son vectores biológicos de ningún organismo patológico específico, pero debido a sus hábitos de alimentación y reproducción y la estructura de sus patas y aparato bucal, pueden actuar como vectores mecánicos para una gran gama de patógenos, desde virus hasta helmintos. Flies that do not bite, often feed on secretions of the eyes, nose and any small wound of cattle, this distracts the animals from the grass, causing a reduction in growth and productivity. Flies that do not bite are not biological vectors of any specific pathological organism, but due to their feeding and reproduction habits and the structure of their legs and mouth apparatus, they can act as mechanical vectors for a wide range of pathogens, from viruses to helminths .

Las moscas que pican pueden provocar irritación a animales domésticos, y también son vectores para la transmisión de enfermedades. Sin embargo, debido a que se alimentan de sangre, también pueden provocar anemia e hipersensibilidad. Por tanto algunos consideran que las moscas que pican son un problema incluso más grave en la producción de ganado que las moscas que no pican. Itchy flies can cause irritation to pets, and are also vectors for disease transmission. However, because they feed on blood, they can also cause anemia and hypersensitivity. Therefore some consider that itchy flies are an even more serious problem in livestock production than flies that do not bite.

Sin embargo, algunas moscas que no pican provocan daño significativo por sí mismas en virtud de su propensión para provocar "miasis" en animales propensos. La miasis However, some flies that do not bite cause significant damage on their own by virtue of their propensity to cause "myiasis" in prone animals. Myiasis

es una enfermedad que afecta animales y seres humanos, provocada por larvas de insectos del género dípteros, en particular moscas y entre ellas Dermatobia hominis, comúnmente conocida como tórsalo. It is a disease that affects animals and human beings, caused by larvae of insects of the genus Diptera, in particular flies and among them Dermatobia hominis, commonly known as turtle.

Las condiciones climáticas, tales como temperatura y humedad a niveles encontrados en regiones tropicales y ecuatoriales, particularmente en determinadas estaciones del año, favorecen la proliferación de insectos, en particular insectos dípteros o moscas, en grandes cantidades y por lo tanto de los casos de miasis. Climatic conditions, such as temperature and humidity at levels found in tropical and equatorial regions, particularly in certain seasons of the year, favor the proliferation of insects, particularly diptera or flies, in large quantities and therefore in cases of myiasis .

Existe, por tanto, la necesidad de producir nuevas formulaciones mejoradas útiles en el tratamiento y la prevención de miasis. There is, therefore, the need to produce new improved formulations useful in the treatment and prevention of myiasis.

BREVE DESCRIPCiÓN DE LA INVENCiÓN BRIEF DESCRIPTION OF THE INVENTION

En un primer aspecto, la invención proporciona un péptido que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros capaces de provocar miasis que comprende: In a first aspect, the invention provides a peptide that can generate a protective immune response against infection by larvae of diptera insects capable of causing myiasis comprising:

a) la secuencia de SEO ID NO 1, b) una variante de (a) que es homóloga en al menos el 70% a la SEO ID NO 1, más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el 97%, el 98% o el 99% a la SEO ID NO 1 Y que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros que provocan miasis, o c) un fragmento de (a) o (b) o una mezcla el mismo, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros capaces de provocar miasis. a) the sequence of SEO ID NO 1, b) a variant of (a) that is homologous in at least 70% to SEO ID NO 1, more preferably homologous in at least 80%, 85%, 90 %, 95%, 97%, 98% or 99% to SEO ID NO 1 And that can generate a protective immune response against infection by larvae of diptera insects that cause miasis, or c) a fragment of ( a) or (b) or a mixture thereof, of at least 6 amino acids in length that can generate a protective immune response against infection by larvae of diptera insects capable of causing myiasis.

Un segundo aspecto se refiere a polinucleótidos (de aquí en adelante polinucleótido de A second aspect concerns polynucleotides (hereinafter polynucleotide of

la invención) que tienen una secuencia seleccionada de: a) la secuencia de AON de SEO ID NO 11 o la secuencia complementaria a la misma; b) una secuencia que se hibrida selectivamente con dicha secuencia (a) o un fragmento de la misma; o c) una secuencia que codifica para un polipéptido que tiene la misma secuencia de aminoácidos que la codificada por dicha secuencia (a) o (b). the invention) having a sequence selected from: a) the SEO ID NO 11 AON sequence or the sequence complementary thereto; b) a sequence that selectively hybridizes with said sequence (a) or a fragment thereof; or c) a sequence encoding a polypeptide having the same amino acid sequence as that encoded by said sequence (a) or (b).

Un tercer aspecto de la invención se refiere a anticuerpos o fragmentos de los mismos que pueden unirse a una cualquiera de las secuencias peptídicas mencionadas anteriormente. A third aspect of the invention relates to antibodies or fragments thereof that can bind to any one of the aforementioned peptide sequences.

Un cuarto aspecto de la invención se refiere a una composición veterinaria o farmacéutica (de aquí en adelante "composición farmacéutica") que comprende cualquiera de los péptidos y/o anticuerpos o fragmentos de los mismos mencionados anteriormente. Otra realización se refiere a la composición farmacéutica para su uso en terapia. Otra realización más se refiere a la composición farmacéutica para su uso en el tratamiento o la prevención de la enfermedad miasis provocada por larvas de insectos dípteros capaces de provocar dicha enfermedad. A fourth aspect of the invention relates to a veterinary or pharmaceutical composition (hereinafter "pharmaceutical composition") comprising any of the peptides and / or antibodies or fragments thereof mentioned above. Another embodiment relates to the pharmaceutical composition for use in therapy. Another embodiment relates to the pharmaceutical composition for use in the treatment or prevention of myiasis disease caused by larvae of diptera insects capable of causing said disease.

En una realización preferida de la invención, la composición farmacéutica es una composición útil como vacuna, en la que esta composición de vacuna puede usarse para proteger mamíferos, preferiblemente un ser humano, más preferiblemente un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina, contra la infección producida por larvas de insectos dípteros capaces de provocar miasis. In a preferred embodiment of the invention, the pharmaceutical composition is a composition useful as a vaccine, in which this vaccine composition can be used to protect mammals, preferably a human being, more preferably a mammal belonging to the bovine, caprine biological subfamily, ovine or equine, against infection caused by larvae of diptera insects capable of causing myiasis.

En un aspecto preferido, la invención proporciona una composición de vacuna que comprende cualquiera de los péptidos mencionados anteriormente junto con un vehículo farmacéuticamente aceptable. In a preferred aspect, the invention provides a vaccine composition comprising any of the aforementioned peptides together with a pharmaceutically acceptable carrier.

En otro aspecto preferido, la invención proporciona la composición de vacuna que comprende anticuerpos o fragmentos de los mismos capaces de unirse a una cualquiera de las secuencias peptídicas mencionadas anteriormente junto con un vehículo farmacéuticamente aceptable. In another preferred aspect, the invention provides the vaccine composition comprising antibodies or fragments thereof capable of binding to any one of the aforementioned peptide sequences together with a pharmaceutically acceptable carrier.

En una realización más preferida de la invención, la enfermedad miasis se provoca por larvas de insectos dípteros que pertenecen a una cualquiera de las siguientes familias: Calliphoridae (moscas azules), Oestridae (moscardón), Sarcophagidae (moscas de la carne) o Gasterophilidae. In a more preferred embodiment of the invention, myiasis disease is caused by larvae of diptera insects belonging to any one of the following families: Calliphoridae (blue flies), Oestridae (moscardón), Sarcophagidae (meat flies) or Gasterophilidae.

En una realización preferida adicional de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Oestridae, preferiblemente al género In a further preferred embodiment of the invention, myiasis is caused by diptera insects belonging to the Oestridae family, preferably to the genus

Oestrus, Dermatobia o Hypoderma; más preferiblemente a las especies Oestrus ovis Linnaeus, Dermatobia hominis, Hypoderma spp (rezno) o Gasterophilus spp. Oestrus, Dermatobia or Hypoderma; more preferably to the species Oestrus ovis Linnaeus, Dermatobia hominis, Hypoderma spp (rezno) or Gasterophilus spp.

En una realización más preferida de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Calliphoridae, preferiblemente al género Cochliomyia, Lucilla o Chrysomya. In a more preferred embodiment of the invention, myiasis is caused by diptera insects belonging to the Calliphoridae family, preferably to the genus Cochliomyia, Lucilla or Chrysomya.

En otra realización de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Calliphoridae, preferiblemente al género Cordylobia o Chrysomya; más preferiblemente, a las especies Cordylobia anthropophaga o Chrysomya bezziana. In another embodiment of the invention, myiasis is caused by diptera insects belonging to the Calliphoridae family, preferably to the genus Cordylobia or Chrysomya; more preferably, to the species Cordylobia anthropophaga or Chrysomya bezziana.

La invención también se refiere a un vector recombinante, tal como un vector de expresión, que comprende un polinucleótido de la invención operativamente unido a una secuencia reguladora, por ejemplo un promotor; una célula huésped que se transforma con un polinucleótido de la invención; y un procedimiento de producción de un polipéptido adecuado para su uso como composición farmacéutica, preferiblemente como vacuna, que comprende mantener una célula huésped transformada con un polinucleótido de la invención en condiciones para proporcionar la expresión del péptido. The invention also relates to a recombinant vector, such as an expression vector, comprising a polynucleotide of the invention operably linked to a regulatory sequence, for example a promoter; a host cell that is transformed with a polynucleotide of the invention; and a method of producing a polypeptide suitable for use as a pharmaceutical composition, preferably as a vaccine, comprising maintaining a host cell transformed with a polynucleotide of the invention under conditions to provide peptide expression.

En un aspecto adicional, la invención proporciona un método de vacunación de un sujeto humano o un animal contra una infección producida por una larva de insecto díptero capaz de provocar miasis, en el que el animal es preferiblemente un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina. In a further aspect, the invention provides a method of vaccination of a human subject or an animal against an infection caused by a diptera larvae capable of causing myiasis, in which the animal is preferably a mammal belonging to the bovine biological subfamily. , goat, sheep or horse.

BREVE DESCRIPCiÓN DE LAS FIGURAS BRIEF DESCRIPTION OF THE FIGURES

Figura 1: Esta figura muestra el número de larvas encontradas en 6 terneros sometidos a prueba, 3 de los cuales se vacunaron con dos dosis intradérmicas de 1 mg/kg de peso de la SEQ ID NO 1 usando montanida como adyuvante. A los 3 animales no vacunados control sólo se les inoculó adyuvante (montanida). Figura 2: Esta figura muestra el título de anticuerpo frente un antígeno total de larvas de Dermatobia medido en un grupo de conejos inmunizados por vía intradérmica con la secuencia antigénica SEQ ID NO 1 usando montanida como adyuvante. Los triángulos representan animales inmunizados y los rombos animales control. El eje de abscisas representa los días transcurridos desde la inmunización y el de ordenadas el logaritmo del título de anticuerpo. Figura 3: Esta figura muestra una alineación de los péptidos identificados como SEO ID NO 1 Y 2 con la isoforma de arginina cinasa de Dermatobia hominis (gi1230938541 gbIAAN11983.11) Figura 4: Esta figura muestra un análisis de inmunotransferencia usando los sueros de animales infectados de manera natural a diferentes diluciones como anticuerpos primarios. Figura 5: Esta figura muestra una alineación de múltiples secuencias entre secuencias peptídicas de SEO ID NO 3 a SEO ID NO 10 con isoforma de arginina cinasa de Dermatobia hominis (gi1230938541 gbIAAN11983.11) Figure 1: This figure shows the number of larvae found in 6 calves tested, 3 of which were vaccinated with two intradermal doses of 1 mg / kg of SEQ ID NO 1 using montanide as adjuvant. The 3 unvaccinated control animals were only inoculated with adjuvant (montanide). Figure 2: This figure shows the antibody titer against a total Dermatobia larval antigen measured in a group of rabbits immunized intradermally with the antigenic sequence SEQ ID NO 1 using montanide as adjuvant. The triangles represent immunized animals and the control animal diamonds. The axis of abscissa represents the days elapsed since immunization and that of ordinates the logarithm of the antibody titer. Figure 3: This figure shows an alignment of the peptides identified as SEO ID NO 1 and 2 with the arginine kinase isoform of Dermatobia hominis (gi1230938541 gbIAAN11983.11) Figure 4: This figure shows an immunoblot analysis using the sera of infected animals naturally at different dilutions as primary antibodies. Figure 5: This figure shows an alignment of multiple sequences between peptide sequences from SEO ID NO 3 to SEO ID NO 10 with arginine kinase isoform of Dermatobia hominis (gi1230938541 gbIAAN11983.11)

DESCRIPCiÓN DElAL LADA DE LA INVENCiÓN DETAILED DESCRIPTION OF THE INVENTION

La arginina quinasa es una enzima crucial para el metabolismo de los insectos y otros invertebrados que se ha propuesto como una diana farmacológica pesticida. En este documento, se presentan fragmentos de péptidos novedosos homólogos a aquellos presentes en la secuencia de la arginina quinasa que pueden conferir inmunidad protectora en mamíferos contra la infección por larvas de insectos dípteros capaces de provocar miasis. Arginine kinase is a crucial enzyme for the metabolism of insects and other invertebrates that has been proposed as a pesticide drug target. In this document, novel peptide fragments homologous to those present in the arginine kinase sequence are presented that can confer protective immunity in mammals against infection by larvae of diptera insects capable of causing myiasis.

Por tanto, un primer aspecto de la presente invención se refiere a péptidos adecuados para conferir inmunidad protectora en mamíferos frente a una infección provocada por larvas de insectos dípteros capaces de provocar miasis (a continuación "péptidos de la invención"), en los que dichos péptidos comprenden una secuencia seleccionada del siguiente grupo: Therefore, a first aspect of the present invention relates to peptides suitable for conferring protective immunity in mammals against an infection caused by larvae of diptera insects capable of causing myiasis (hereinafter "peptides of the invention"), in which said Peptides comprise a sequence selected from the following group:

a) la secuencia de cualquiera de las secuencias SEO ID NO 1 a SEO ID NO 10, b) una variante de (a) que es homóloga en al menos el 70% a una cualquiera de las secuencias de SEO ID NO 1 a SEO ID NO 10, más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el 97%, el 98% o el 99% a una cualquiera de las secuencias de SEO ID NO 1 a SEO ID NO 10 Y que pueda generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis, o c) un fragmento de (a) o (b) o una mezcla de los mismos, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis. a) the sequence of any of the SEO ID NO 1 sequences to SEO ID NO 10, b) a variant of (a) that is at least 70% homologous to any one of the SEO ID NO 1 sequences to SEO ID NO 10, more preferably homologous in at least 80%, 85%, 90%, 95%, 97%, 98% or 99% to any one of the SEO ID sequences NO 1 to SEO ID NO 10 And that can generate a protective immune response in a mammal against infection by larvae of diptera insects capable of causing myiasis, or c) a fragment of (a) or (b) or a mixture thereof, of at least 6 amino acids in length that can generate a protective immune response in a mammal against an infection by larvae of diptera insects capable of causing myiasis.

En un aspecto preferido de la presente invención el péptido se selecciona de una In a preferred aspect of the present invention the peptide is selected from a

cualquiera de las siguientes secuencias: a) la secuencia de SEO ID NO 1 o SEO ID NO 2, b) una variante de (a) que es homóloga en al menos el 70% a una cualquiera de las secuencias SEO ID NO 1 o SEO ID NO 2, más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el 97%, el 98% o el 99 % a una cualquiera de las secuencias SEO ID NO 1 o SEO ID NO 2 y, que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis, o c) un fragmento de (a) o (b) o una mezcla de los mismos, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis. any of the following sequences: a) the SEO ID NO 1 or SEO ID NO 2 sequence, b) a variant of (a) that is at least 70% homologous to any one of the SEO ID NO 1 or SEO sequences ID NO 2, more preferably homologous in at least 80%, 85%, 90%, 95%, 97%, 98% or 99% to any one of the SEO ID NO 1 or SEO ID sequences NO 2 and, which can generate a protective immune response in a mammal against infection by larvae of diptera insects capable of causing myiasis, or c) a fragment of (a) or (b) or a mixture thereof, of at least 6 amino acids in length that can generate a protective immune response in a mammal against an infection by larvae of diptera insects capable of causing myiasis.

En un aspecto más preferido de la presente invención el péptido de la invención se In a more preferred aspect of the present invention the peptide of the invention is

selecciona de una cualquiera de las siguientes secuencias: a) una secuencia que comprende SEO ID NO 1 o una secuencia que consiste esencialmente en SEO ID NO 1 o una secuencia que consiste en SEO ID NO 1 ; b) una variante de (a) que es homóloga en al menos el 70% a SEO ID NO 1, más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el 97%, el 98% o el 99% a SEO ID NO 1 Y que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis, o c) un fragmento de (a) o (b) o una mezcla de los mismos, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis. select from any one of the following sequences: a) a sequence comprising SEO ID NO 1 or a sequence consisting essentially of SEO ID NO 1 or a sequence consisting of SEO ID NO 1; b) a variant of (a) that is homologous in at least 70% to SEO ID NO 1, more preferably homologous in at least 80%, 85%, 90%, 95%, 97%, 98% or 99% to SEO ID NO 1 And that can generate a protective immune response in a mammal against infection by larvae of diptera insects capable of causing myiasis, or c) a fragment of (a) or (b) or a mixture thereof, of at least 6 amino acids in length that can generate a protective immune response in a mammal against infection by larvae of diptera insects capable of causing myiasis.

Los péptidos de la invención se identificaron tal y como se indica en el ejemplo 1, sometiendo un homogenizado de larvas L2 y L3 de Dermatobia hominis a SDS-PAGE al 12% (por duplicado) e inmunotransferencia de tipo Western según la metodología convencional (Towbin et al., 1979) usando los sueros de animales infectados de The peptides of the invention were identified as indicated in Example 1, subjecting a homogenate of L2 and L3 larvae of Dermatobia hominis to 12% SDS-PAGE (in duplicate) and Western blot according to the conventional methodology (Towbin et al., 1979) using sera from infected animals of

manera natural a diferentes diluciones como anticuerpos primarios. Se digirieron las bandas con el potencial inmunogénico más alto, en comparación con los sueros positivos, con tripsina y entonces se analizaron con MALDI TOF EM/EM. naturally at different dilutions as primary antibodies. Bands with the highest immunogenic potential were digested, compared to positive sera, with trypsin and then analyzed with MALDI TOF MS / MS.

Los péptidos de la invención fueron finalmente identificados alineando las masas experimentales obtenidas por MALDI TOF EM/EM (huella de péptido) contra la digestión teórica de la base de datos completa usando el motor de búsqueda Mascot (www.matrixscience.com;MatrixScienceUd.• Londres.R.U.).Adicionalmente. los autores de la presente invención confirmaron, tal como se ilustra en el ejemplo 3, que estos péptidos, concretamente la SEO ID NO 1, podían reducir significativamente las lesiones provocadas por Dermatobia hominis en animales infectados y por tanto, que estos péptidos pueden conferir inmunidad en mamíferos contra la enfermedad miasis provocada por larvas de insectos dípteros capaces de provocar miasis, particularmente la enfermedad provocada por larvas de insectos dípteros que pertenecen a la especie Dermatobia hominis. En este sentido, se hace referencia a la figura 1 en la que el número de larvas de insectos dípteros en los animales vacunados en comparación con el grupo control (animales infectados sin vacunar) se ha reducido sig n ificativam ente. The peptides of the invention were finally identified by aligning the experimental masses obtained by MALDI TOF EM / EM (peptide fingerprint) against the theoretical digestion of the entire database using the Mascot search engine (www.matrixscience.com; MatrixScienceUd. • London.RU) .Additionally. The authors of the present invention confirmed, as illustrated in Example 3, that these peptides, specifically SEO ID NO 1, could significantly reduce the lesions caused by Dermatobia hominis in infected animals and therefore, that these peptides can confer immunity in mammals against myiasis disease caused by larvae of diptera insects capable of causing myiasis, particularly the disease caused by larvae of diptera insects belonging to the Dermatobia hominis species. In this regard, reference is made to Figure 1 in which the number of larvae of diptera insects in vaccinated animals compared to the control group (infected animals without vaccinations) has been significantly reduced.

En el contexto de la presente invención, se define enfermedad miasis como una enfermedad animal o humana provocada por larvas de insectos dípteros parásitos que se alimentan del tejido vivo o necrótico del huésped. In the context of the present invention, myiasis disease is defined as an animal or human disease caused by larvae of parasitic diptera insects that feed on the host's living or necrotic tissue.

Los insectos dípteros (larvas de insectos dípteros) que pueden provocar miasis pertenecen a cualquiera de las siguientes familias: Calliphoridae (moscas azules), Oestridae (moscardón), Sarcophagidae (moscas de la carne) o Gasterophilidae. Se consideran que éstas son las cuatro familias principales capaces de provocar miasis en ganado y además, ocasionalmente, en seres humanos. Diptera insects (larvae of diptera insects) that can cause myiasis belong to any of the following families: Calliphoridae (blue flies), Oestridae (moscardón), Sarcophagidae (meat flies) or Gasterophilidae. These are considered to be the four main families capable of causing myiasis in cattle and also, occasionally, in humans.

Tal como ya se mencionó anteriormente, la arginina cinasa es una enzima crucial para el metabolismo de los insectos y otros invertebrados y ciertamente compartida por todas las especies de las familias mencionadas anteriormente de insectos dípteros. Tal como se ilustra en las figuras 3 y 5, todos los péptidos de la invención, preferiblemente las secuencias SEO ID NO 1 a SEO ID NO 10, más preferiblemente la SEO ID NO 1 ó 2, comparten un porcentaje de identidad significativo con determinados fragmentos de la secuencia de aminoácidos de arginina cinasa de D. As previously mentioned, arginine kinase is a crucial enzyme for the metabolism of insects and other invertebrates and certainly shared by all species of the aforementioned families of diptera insects. As illustrated in Figures 3 and 5, all the peptides of the invention, preferably the SEO ID NO 1 to SEO ID NO 10 sequences, more preferably SEO ID NO 1 or 2, share a significant percentage of identity with certain fragments. of the amino acid sequence of arginine kinase of D.

me/anogaster con número de registro de Genebank AAN1983.1; obsérvese que esta secuencia (AAN1983.1) tiene un grado significativo de homología con cualquier otra secuencia de arginina cinasa relacionada. Este resultado establece claramente la utilidad de los péptidos de la invención para conferir inmunidad protectora en mamíferos frente a la infección producida por cualquier larva de insecto díptero que puede provocar miasis, particularmente la miasis provocada por cualquier larva de insecto díptero que pertenece a una cualquiera de las familias mencionadas anteriormente. me / anogaster with Genebank registration number AAN1983.1; Note that this sequence (AAN1983.1) has a significant degree of homology with any other related arginine kinase sequence. This result clearly establishes the usefulness of the peptides of the invention to confer protective immunity in mammals against infection caused by any diptera larvae that can cause myiasis, particularly myiasis caused by any diptera larvae belonging to any one of the families mentioned above.

En una realización particular de la invención, las larvas que pueden producir miasis pertenecen a la familia Oestridae y pertenecen a uno cualquiera del siguiente grupo de géneros: Oestrus, Dermatobia, Hypoderma o Gasterophi/us; más preferiblemente a las especies Oestrus ovis Linnaeus, Dermatobia hominis, Hypoderma spp (rezno) o Gasterophi/us spp. En una realización más preferida la presente invención se refiere a larvas de la especie Dermatobia hominis. In a particular embodiment of the invention, the larvae that can produce myiasis belong to the Oestridae family and belong to any one of the following genus group: Oestrus, Dermatobia, Hypoderma or Gasterophi / us; more preferably to the species Oestrus ovis Linnaeus, Dermatobia hominis, Hypoderma spp (rezno) or Gasterophi / us spp. In a more preferred embodiment the present invention relates to larvae of the Dermatobia hominis species.

En otra realización particular de la presente invención, las larvas que pueden producir miasis pertenecen a la familia Calliphoridae, preferiblemente al género Cordy/obia o Chrysomya; más preferiblemente a las especies Cordy/obia anthropophaga o Chrysomya bezziana. In another particular embodiment of the present invention, the larvae that can produce myiasis belong to the Calliphoridae family, preferably to the genus Cordy / obia or Chrysomya; more preferably to the species Cordy / obia anthropophaga or Chrysomya bezziana.

Un péptido para su uso en la presente invención consiste esencialmente en la secuencia de aminoácidos expuesta en cualquiera de las secuencias SEO ID NO 1 a SEO ID NO 10 o una variante de la misma, o en un fragmento de cualquiera de estas secuencias. Preferiblemente, la secuencia de aminoácidos expuesta es la SEO ID NO 1 o una variante o fragmento de la misma. A peptide for use in the present invention consists essentially of the amino acid sequence set forth in any of the SEO ID NO 1 sequences to SEO ID NO 10 or a variant thereof, or in a fragment of any of these sequences. Preferably, the amino acid sequence set forth is SEO ID NO 1 or a variant or fragment thereof.

En el contexto de la presente invención, se entiende como variante aquella secuencia aminoacidica con un grado de homologia de al menos el 70% de una cualquiera de las SEO ID NO 1 a SEO ID NO 10 capaz de producir inmunidad protectora frente a miasis, particularmente frente a miasis provocada por cualquiera de las larvas mencionadas anteriormente. In the context of the present invention, it is understood as a variant that amino acid sequence with a degree of homology of at least 70% of any one of the SEO ID NO 1 to SEO ID NO 10 capable of producing protective immunity against myiasis, particularly against myiasis caused by any of the larvae mentioned above.

A lo largo de toda la longitud de una cualquiera de las secuencias de SEO ID NO 1 a SEO ID NO 10, una variante será preferiblemente homóloga en al menos el 70% a esa secuencia basándose en la identidad de aminoácidos. Más preferiblemente homóloga en al menos el 85 o el 90% y más preferiblemente al menos el 95, el 97, el 98 o el 99% a una cualquiera de las secuencias de SEQ ID NO 1 a SEO ID NO 10 con respecto a la región entera, basándose en la identidad de aminoácidos. Throughout the entire length of any one of the SEO ID NO 1 to SEO ID NO 10 sequences, a variant will preferably be at least 70% homologous to that sequence based on the amino acid identity. More preferably homologous at least 85 or 90% and more preferably at least 95, 97, 98 or 99% to any one of the sequences of SEQ ID NO 1 to SEO ID NO 10 with respect to the region whole, based on the identity of amino acids.

Los fragmentos de los péptidos de la invención incluyen preferiblemente cualquier región de 6 aminoácidos de longitud de una cualquiera de las secuencias de SEO ID NO 1 a SEO ID NO 10. Las variantes de estas regiones serán preferiblemente homólogas en al menos el 70%, preferiblemente al menos el 80% o el 90% y más preferiblemente el 95% a estas regiones, basándose en la identidad de aminoácidos. Fragments of the peptides of the invention preferably include any region of 6 amino acids in length from any one of the sequences of SEO ID NO 1 to SEO ID NO 10. The variants of these regions will preferably be homologous at least 70%, preferably at least 80% or 90% and more preferably 95% to these regions, based on the identity of amino acids.

Los péptidos de la invención pueden modificarse por ejemplo mediante la adición de residuos de histidina para ayudar a su identificación o purificación o mediante la adición de una secuencia señal para promover su secreción a partir de una célula. The peptides of the invention can be modified for example by the addition of histidine residues to aid in their identification or purification or by the addition of a signal sequence to promote their secretion from a cell.

Un péptido de la invención puede marcarse con un marcador de revelado. A peptide of the invention can be labeled with a developing marker.

El marcador de revelado puede ser cualquier marcador adecuado que permite detectar el péptido. Los marcadores adecuados incluyen radioisótopos, enzimas, anticuerpos, polinucleótidos y ligadores tales como biotina. The development marker can be any suitable marker that allows the peptide to be detected. Suitable markers include radioisotopes, enzymes, antibodies, polynucleotides and linkers such as biotin.

Los péptidos marcados de la invención pueden usarse en ensayos inmunitarios mediados por células o serológicos para la detección de reactividad inmunitaria frente a dichos polipéptidos en animales y seres humanos usando protocolos convencionales. El péptido marcado puede usarse para identificar y/o aislar proteínas "auxiliares" que están implicadas en la unión de los péptidos de la invención. The labeled peptides of the invention can be used in cell-mediated or serological immune assays for the detection of immune reactivity against said polypeptides in animals and humans using conventional protocols. The labeled peptide can be used to identify and / or isolate "auxiliary" proteins that are involved in the binding of the peptides of the invention.

Un péptido o péptido marcado de la invención o fragmento del mismo también puede fijarse a una fase sólida, por ejemplo la superficie de un tira reactiva o pocillo de inmunoensayo. A labeled peptide or peptide of the invention or fragment thereof can also be fixed to a solid phase, for example the surface of a test strip or immunoassay well.

Tales péptidos inmovilizados y/o marcados pueden envasarse en kits en un recipiente adecuado incluyendo opcionalmente reactivos adecuados adicionales, controles o instrucciones y similares. Los kits pueden usarse para identificar componentes que interaccionan con los péptidos. Such immobilized and / or labeled peptides can be packaged in kits in a suitable container optionally including additional suitable reagents, controls or instructions and the like. The kits can be used to identify components that interact with the peptides.

Los péptidos de la invención pueden prepararse por medios sintéticos o de manera recombinante tal como se describe a continuación. The peptides of the invention can be prepared by synthetic means or recombinantly as described below.

Los péptidos de la invención pueden introducirse en una célula mediante expresión in situ del péptido a partir de un vector de expresión recombinante. El vector de expresión lleva opcionalmente un promotor inducible para controlar la expresión del péptido. The peptides of the invention can be introduced into a cell by in situ expression of the peptide from a recombinant expression vector. The expression vector optionally carries an inducible promoter to control peptide expression.

Tales sistemas de cultivo celular en los que se expresan los péptidos de la invención pueden usarse en sistemas de ensayo. Such cell culture systems in which the peptides of the invention are expressed can be used in assay systems.

En un segundo aspecto de la presente invención, los anticuerpos o fragmentos de los mismos que pueden unirse a cualquiera de los péptidos de la invención también pueden usarse para conferir inmunidad protectora en un mamífero frente a la miasis provocada por un insecto díptero. Estos anticuerpos o fragmentos de los mismos pueden obtenerse fácilmente a partir de antisueros. In a second aspect of the present invention, the antibodies or fragments thereof that can bind to any of the peptides of the invention can also be used to confer protective immunity in a mammal against myiasis caused by a diptera insect. These antibodies or fragments thereof can easily be obtained from antisera.

Los antisueros frente a los péptidos de la invención pueden generarse mediante técnicas convencionales, por ejemplo, mediante inyección de cualquiera de los péptidos de la invención en un animal apropiado y recogida y purificación de antisueros de animales. Los anticuerpos que se unen a una cualquiera de las secuencias SEQ ID NO 1 a SEQ ID NO 10 o una variante o fragmento de las mismas según la invención pueden identificarse mediante inmunoensayos convencionales. Los anticuerpos así obtenidos pueden usarse para aislar o purificar péptidos para la incorporación en las composición farmaceuticas de la invención. The antisera against the peptides of the invention can be generated by conventional techniques, for example, by injection of any of the peptides of the invention into an appropriate animal and collection and purification of animal antisera. Antibodies that bind to any one of the sequences SEQ ID NO 1 to SEQ ID NO 10 or a variant or fragment thereof according to the invention can be identified by conventional immunoassays. The antibodies thus obtained can be used to isolate or purify peptides for incorporation into the pharmaceutical compositions of the invention.

A continuación, estos anticuerpos o fragmentos de los mismos se denominarán anticuerpos de la invención. Next, these antibodies or fragments thereof will be referred to as antibodies of the invention.

Polinucleótidos Un polinucleótido de la invención puede hibridarse selectivamente con la secuencia codificante (a continuación "secuencia codificante de la invención") de una cualquiera de las secuencias peptídicas de la invención o con la secuencia complementaria a la secuencia codificante. Polinucleótidos de la invención incluyen variantes de la secuencia codificante de la invención que codifican para los péptidos de la invención debido a la degeneración del código genetico y variantes que son la secuencia codificante de la invención o su complemento a lo largo de una región de al menos 20 Polynucleotides A polynucleotide of the invention can selectively hybridize with the coding sequence (hereinafter "coding sequence of the invention") of any one of the peptide sequences of the invention or with the sequence complementary to the coding sequence. Polynucleotides of the invention include variants of the coding sequence of the invention that encode the peptides of the invention due to the degeneracy of the genetic code and variants that are the coding sequence of the invention or its complement along a region of at least twenty

o más nucleótidos contiguos tal como a lo largo de toda la longitud de la secuencia codificante o su complemento. or more contiguous nucleotides such as along the entire length of the coding sequence or its complement.

También pueden ser polinucleótidos de la invención aquellos que incluyen dentro de ellos nucleótidos sintéticos o modificados. En la técnica se conocen varios tipos diferentes de modificaciones (de polinucleótidos). Estos incluyen estructuras principales de fosforotioato y fosfato de metilo, adición de cadenas de acridina o polilisina a los extremos 3' y/o 5' de la molécula. Para los fines de la presente invención, ha de entenderse que los polinucleótidos descritos en el presente documento pueden modificarse mediante cualquier método disponible en la técnica. Polynucleotides of the invention may also be those that include synthetic or modified nucleotides within them. Several different types of modifications (of polynucleotides) are known in the art. These include major phosphorothioate and methyl phosphate structures, adding acridine or polylysine chains to the 3 'and / or 5' ends of the molecule. For the purposes of the present invention, it is understood that the polynucleotides described herein can be modified by any method available in the art.

Los polinucleótidos de la invención pueden usarse para producir un cebador, por ejemplo un cebador de PCR, un cebador para una reacción de amplificación alternativa, una sonda por ejemplo marcada con un marcador de revelado por medios convencionales usando marcadores radioactivos o no radioactivos, o pueden clonarse los polinucleótidos en vectores. Tales cebadores, sondas y otros fragmentos tendrán al menos 15, preferiblemente al menos 20, por ejemplo al menos 25 ó 30 nucleótidos de longitud y también se abarcan por el término polinucleótidos de la invención tal como se usa en el presente documento. The polynucleotides of the invention can be used to produce a primer, for example a PCR primer, a primer for an alternative amplification reaction, a probe for example labeled with a developing label by conventional means using radioactive or non-radioactive markers, or they can The polynucleotides are cloned into vectors. Such primers, probes and other fragments will be at least 15, preferably at least 20, for example at least 25 or 30 nucleotides in length and are also encompassed by the term polynucleotides of the invention as used herein.

Los polinucleótidos tales como un polinucleótido de ADN y cebadores según la invención pueden producirse de manera recombinante, sintética o por cualquier medio disponible para los expertos en la técnica. También pueden clonarse mediante técnicas convencionales. Normalmente se proporcionan los polinucleótidos en forma aislada y/o purificada. Polynucleotides such as a DNA polynucleotide and primers according to the invention can be produced recombinantly, synthetically or by any means available to those skilled in the art. They can also be cloned by conventional techniques. Typically polynucleotides are provided in isolated and / or purified form.

En general, los cebadores se producirán por medios sintéticos que implican una fabricación por etapas de la secuencia de ácido nucleico deseada de un nucleótido en un nucleótido. In general, the primers will be produced by synthetic means that involve stepwise manufacturing of the desired nucleic acid sequence of a nucleotide in a nucleotide.

Las técnicas para lograr esto, usando técnicas automáticas están fácilmente disponibles en la técnica. The techniques to achieve this, using automatic techniques are readily available in the art.

Los polinucleótidos o cebadores de la invención pueden portar un marcador de revelado. The polynucleotides or primers of the invention can carry a developing marker.

Los marcadores adecuados incluyen radio isótopos, marcadores enzimáticos u otros marcadores proteicos tales como biotina. Tales marcadores pueden añadirse a polinucleótidos o cebadores de la invención y pueden detectarse usando técnicas conocidas en sí mismas. Suitable markers include radio isotopes, enzymatic markers or other protein markers such as biotin. Such markers can be added to polynucleotides or primers of the invention and can be detected using techniques known per se.

Los polinucleótidos de la invención pueden incorporarse en un vector. Puede usarse el vector para replicar el ácido nucleico en una célula huésped compatible. Por tanto, en una realización adicional de la invención se proporciona un método de preparación de polinucleótidos introduciendo un polinucleótido de la invención en un vector que puede replicarse, introduciendo el vector en una célula huésped compatible y haciendo crecer la célula huésped en condiciones en las que provocan replicación del vector. El vector puede recuperarse a partir de la célula huésped. The polynucleotides of the invention can be incorporated into a vector. The vector can be used to replicate the nucleic acid in a compatible host cell. Thus, in a further embodiment of the invention a method of preparing polynucleotides is provided by introducing a polynucleotide of the invention into a vector that can be replicated, introducing the vector into a compatible host cell and growing the host cell under conditions in which cause vector replication. The vector can be recovered from the host cell.

Preferiblemente, un polinucleótido de la invención en un vector está operativamente unido a una secuencia control que puede proporcionar la expresión de la secuencia codificante mediante la célula huésped. Preferably, a polynucleotide of the invention in a vector is operably linked to a control sequence that can provide expression of the coding sequence by the host cell.

El término "operativamente unido" se refiere a una yuxtaposición en la que los componentes descritos están en una relación que permite que funcionen de su manera pretendida. The term "operably linked" refers to a juxtaposition in which the components described are in a relationship that allows them to function in their intended manner.

Una secuencia control "operativamente unida" a una secuencia codificante está ligada de tal manera que la expresión de la secuencia codificante se logra en condiciones compatibles con las secuencias control. A control sequence "operably linked" to a coding sequence is linked in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.

Tales vectores pueden transformarse en una célula huésped adecuada para proporcionar la expresión de un polipéptido o fragmento de polipéptido de la invención. Such vectors can be transformed into a suitable host cell to provide the expression of a polypeptide or polypeptide fragment of the invention.

Por tanto, un aspecto adicional de la invención proporciona un procedimiento para preparar un péptido o fragmento de péptido según la invención, procedimiento que comprende cultivar una célula huésped transformada o transfectada con un vector de expresión tal como se describió anteriormente en condiciones para proporcionar la expresión del polipéptido o fragmento y recuperar el péptido o fragmento expresado. Therefore, a further aspect of the invention provides a method for preparing a peptide or peptide fragment according to the invention, a method comprising culturing a host cell transformed or transfected with an expression vector as described above under conditions to provide expression. of the polypeptide or fragment and recover the expressed peptide or fragment.

Los vectores pueden ser, por ejemplo, vectores de plásmido, virus o fago dotados de un origen de replicación, opcionalmente un promotor para la expresión de dicho polinucleótido y opcionalmente un regulador del promotor. Los vectores pueden contener uno o más genes marcadores seleccionables, por ejemplo un gen de resistencia a ampicilina en el caso de un plásmido bacteriano. The vectors can be, for example, plasmid, virus or phage vectors endowed with an origin of replication, optionally a promoter for the expression of said polynucleotide and optionally a promoter regulator. The vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid.

Una realización adicional de la invención proporciona células huesped transformadas o transfectadas con los polinucleótidos o vectores para la replicación y expresión de polinucleótidos de la invención. Las células se elegirán para ser compatibles con dicho vector y serán preferiblemente bacterianas. Las células huésped también pueden ser células de un animal no humano o una planta transformada con un polinucleótido de la invención. A further embodiment of the invention provides host cells transformed or transfected with polynucleotides or vectors for replication and expression of polynucleotides of the invention. The cells will be chosen to be compatible with said vector and will preferably be bacterial. The host cells can also be cells of a non-human animal or a plant transformed with a polynucleotide of the invention.

Los promotores y otras señales de regulación de expresión pueden seleccionarse para ser compatibles con la célula huésped para la cual se diseña el vector de expresión. Promoters and other expression regulation signals may be selected to be compatible with the host cell for which the expression vector is designed.

Formulación de vacuna y otras formulaciones médicas La presente invención también se refiere a una composición veterinaria o farmacéutica (composición farmacéutica de la invención) que comprende cualquiera de los péptidos, polinucleótidos o anticuerpos de la invención. En particular, la presente invención se refiere a la composición farmacéutica de la invención para su uso en terapia. Más particularmente, se refiere a la composición farmacéutica de la invención para su uso en el tratamiento o la prevención de la enfermedad miasis provocada por larvas de insectos dípteros en mamíferos, preferentemente por moscas, preferiblemente en un ser humano, más preferiblemente en un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina. Más particularmente, contra la miasis provocada por larvas de insectos dípteros que pertenecen a la especie Dermatobia hominis. Vaccine formulation and other medical formulations The present invention also relates to a veterinary or pharmaceutical composition (pharmaceutical composition of the invention) comprising any of the peptides, polynucleotides or antibodies of the invention. In particular, the present invention relates to the pharmaceutical composition of the invention for use in therapy. More particularly, it refers to the pharmaceutical composition of the invention for use in the treatment or prevention of myiasis disease caused by larvae of diptera insects in mammals, preferably by flies, preferably in a human being, more preferably in a mammal that It belongs to the bovine, caprine, sheep or equine biological subfamily. More particularly, against myiasis caused by larvae of diptera insects that belong to the species Dermatobia hominis.

En una realización particular de la presente invención, la composición farmacéutica de la invención comprende un péptido, un anticuerpo o fragmento del mismo que puede unirse a dicho péptido o una secuencia que codifica para dicho péptido, en el que la secuencia peptídica se selecciona de uno cualquiera del siguiente grupo: In a particular embodiment of the present invention, the pharmaceutical composition of the invention comprises a peptide, an antibody or fragment thereof that can be linked to said peptide or a sequence encoding said peptide, wherein the peptide sequence is selected from one any of the following group:

a) la secuencia de SEO ID NO 1, a) the sequence of SEO ID NO 1,

b) una variante de (a) que es homóloga en al menos el 70% a SEO ID NO 1, b) a variant of (a) that is homologous in at least 70% to SEO ID NO 1,

más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el more preferably homologous at least 80%, 85%, 90%, 95%, the

97%, el 98% o el 99% a SEO ID NO 1 Y que puede generar una respuesta 97%, 98% or 99% to SEO ID NO 1 And that can generate an answer

inmunitaria protectora en un mamífero frente a una infección por larvas de protective immune in a mammal against larval infection of

insectos dípteros capaces de provocar miasis, o c) un fragmento de (a) o (b) o una mezcla de los mismos, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora en un mamífero frente a una infección por larvas de insectos dípteros capaces de provocar miasis. Diptera insects capable of causing myiasis, oc) a fragment of (a) or (b) or a mixture thereof, of at least 6 amino acids in length that can generate a protective immune response in a mammal against a larval infection of Diptera insects capable of causing myiasis.

En un aspecto aún más particular de la invención, la composición farmacéutica de la invención comprende un péptido, un anticuerpo o fragmento del mismo que puede unirse a dicho péptido o una secuencia que codifica para dicho péptido, en la que la secuencia peptídica comprende la SEO ID NO 1 o una secuencia que consiste esencialmente en SEO ID NO 1 o una secuencia que consiste en SEO ID NO 1. Obsérvese que SEO ID NO 1 pudo reducir significativamente el número de larvas dípteras en los animales vacunados en comparación con el grupo control tal como se muestra en la figura 1. Por tanto, este péptido es un excelente candidato para una composición veterinaria o farmacéutica, concretamente para una composición de vacuna. In an even more particular aspect of the invention, the pharmaceutical composition of the invention comprises a peptide, an antibody or fragment thereof that can bind to said peptide or a sequence encoding said peptide, in which the peptide sequence comprises SEO ID NO 1 or a sequence consisting essentially of SEO ID NO 1 or a sequence consisting of SEO ID NO 1. Note that SEO ID NO 1 could significantly reduce the number of diptera larvae in vaccinated animals compared to the control group such as shown in Figure 1. Therefore, this peptide is an excellent candidate for a veterinary or pharmaceutical composition, specifically for a vaccine composition.

Estas composiciones farmacéuticas de la invención adoptan la forma de disoluciones, suspensiones, comprimidos, píldoras, cápsulas, formulaciones de liberación sostenida These pharmaceutical compositions of the invention take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations.

o polvos y contienen del 10% al 95% de principio activo, preferiblemente del 25% al 70%. or powders and contain from 10% to 95% of active ingredient, preferably from 25% to 70%.

Adicionalmente, los péptidos, anticuerpos o polinucleótidos de la invención pueden formularse como vacunas (a continuación composición de vacuna de la invención). La composición de vacuna de la invención puede usarse en terapia, particularmente para el tratamiento o la prevención de la enfermedad miasis producida por larvas de insectos dípteros. Additionally, the peptides, antibodies or polynucleotides of the invention can be formulated as vaccines (below vaccine composition of the invention). The vaccine composition of the invention can be used in therapy, particularly for the treatment or prevention of myiasis disease caused by larvae of diptera insects.

Por tanto, un aspecto particular de la presente invención se refiere a una composición de vacuna que comprende cualquiera de los péptidos, anticuerpos o polinucleótidos de la invención para su uso en el tratamiento o la prevención en un mamífero, preferiblemente un ser humano, más preferiblemente un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina, contra la infección de larvas de insectos dípteros capaces de provocar miasis; más particularmente, contra la enfermedad miasis provocada por larvas que pertenecen a la especie Dermatobia hominis. Thus, a particular aspect of the present invention relates to a vaccine composition comprising any of the peptides, antibodies or polynucleotides of the invention for use in the treatment or prevention in a mammal, preferably a human being, more preferably a mammal that belongs to the biological subfamily bovine, caprine, sheep or equine, against the infection of larvae of diptera insects capable of causing myiasis; more particularly, against myiasis disease caused by larvae belonging to the Dermatobia hominis species.

En otro aspecto particular de la invención, la composición de vacuna de la invención comprende un péptido, un anticuerpo o fragmento del mismo que puede unirse a dicho péptido o una secuencia que codifica para dicho péptido, en la que la secuencia peptídica se selecciona de uno cualquiera del siguiente grupo: In another particular aspect of the invention, the vaccine composition of the invention comprises a peptide, an antibody or fragment thereof that can bind to said peptide or a sequence encoding said peptide, wherein the peptide sequence is selected from one any of the following group:

a) la secuencia de SEO ID NO 1, a) the sequence of SEO ID NO 1,

b) una variante de (a) que es homóloga en al menos el 70% a SEO ID NO 1, b) a variant of (a) that is homologous in at least 70% to SEO ID NO 1,

más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el more preferably homologous at least 80%, 85%, 90%, 95%, the

97%, el 98% o el 99% a SEO ID NO 1 Y que puede generar una respuesta 97%, 98% or 99% to SEO ID NO 1 And that can generate an answer

inmunitaria protectora en un mamífero frente a una infección por larvas de protective immune in a mammal against larval infection of

insectos dípteros capaces de provocar miasis, o Diptera insects capable of causing myiasis, or

c) un fragmento de (a) o (b) o una mezcla de los mismos, de al menos 6 c) a fragment of (a) or (b) or a mixture thereof, of at least 6

aminoácidos de longitud que puede generar una respuesta inmunitaria amino acids in length that can generate an immune response

protectora en un mamífero frente a una infección por larvas de insectos protective in a mammal against infection by insect larvae

dípteros capaces de provocar miasis. Diptera capable of causing myiasis.

En un aspecto aún más particular de la invención, la composición de vacuna comprende un péptido, un anticuerpo o fragmento del mismo que puede unirse a dicho péptido o una secuencia que codifica para dicho péptido, en la que la secuencia peptídica es SEO ID NO 1. In an even more particular aspect of the invention, the vaccine composition comprises a peptide, an antibody or fragment thereof that can bind to said peptide or a sequence encoding said peptide, in which the peptide sequence is SEO ID NO 1 .

Normalmente, se preparan las vacunas como producto inyectable, o bien como disoluciones líquidas o bien suspensiones; también pueden prepararse formas sólidas adecuadas para su disolución o suspensión en líquido antes de la inyección. La preparación también puede emulsionarse o la proteína encapsularse en liposomas o en otros vehículos tales como ISCOM adecuados para la inmunización. El principio inmunogénico activo puede mezclarse con un excipiente que es farmacéuticamente aceptable y compatible con el principio activo. Los excipientes adecuados son por ejemplo, agua, solución salina, dextrosa, glicerol, etanol o similares y combinaciones de los mismos. Además, si se desea, la vacuna puede contener cantidades minoritarias de sustancias auxiliares tales como agentes humectantes o emulsionantes, agentes de tamponamiento de pH y/o adyuvantes que potencian la eficacia de la vacuna. Ejemplos de adyuvantes que pueden ser eficaces son montanida, adyuvante de Freund de alúmina, quitoseno, quitina, LPS, muramil dipéptido, liposomas o ISCOM. Otros adyuvantes alternativos a los mencionados anteriormente resultarán evidentes para el experto en la técnica. Normally, vaccines are prepared as an injectable product, either as liquid solutions or suspensions; Solid forms suitable for dissolution or suspension in liquid can also be prepared before injection. The preparation can also be emulsified or the protein encapsulated in liposomes or in other vehicles such as ISCOM suitable for immunization. The active immunogenic principle can be mixed with an excipient that is pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol or the like and combinations thereof. In addition, if desired, the vaccine may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents and / or adjuvants that enhance the efficacy of the vaccine. Examples of adjuvants that may be effective are montanide, alumina Freund's adjuvant, chitosen, chitin, LPS, muramyl dipeptide, liposomes or ISCOM. Other adjuvants alternative to those mentioned above will be apparent to those skilled in the art.

Las vacunas se administran de manera convencional por vía parental mediante inyección, por ejemplo, por vía o bien subcutánea o bien intramuscular. Las formulaciones adicionales que son adecuadas para otros modos de administración incluyen supositorios y en algunos casos formulaciones orales. Vaccines are conventionally administered parentally by injection, for example, either subcutaneously or intramuscularly. Additional formulations that are suitable for other modes of administration include suppositories and in some cases oral formulations.

Cuando se liofiliza la composlclon de vacuna de la invención o la composición farmaceutica de la invención, puede reconstituirse el material liofilizado antes de la administración, por ejemplo como una suspensión. La reconstitución se realiza preferiblemente en tampón. When the vaccine composition of the invention or the pharmaceutical composition of the invention is lyophilized, the lyophilized material can be reconstituted before administration, for example as a suspension. Reconstitution is preferably performed in buffer.

Los péptidos de la invención pueden formularse en la vacuna o composición de la invención como formas neutras o salinas. Las sales farmacéuticamente aceptables incluyen las sales de adición de ácido (formadas con grupos amino libres del péptido) y que se forman con ácidos inorgánicos tales como, por ejemplo, ácidos clorhídrico o fosfórico o ácidos orgánicos tales como acético, oxálico, tartárico y maleico. Las sales formadas con los grupos carboxilo libres también pueden derivarse de bases inorgánicas tales como, por ejemplo, hidróxidos de sodio, de potasio, de amonio, de calcio o férrico, y bases orgánicas tales como isopropilamina, trimetilamina, 2etilaminoetanol, histidina y procaína. The peptides of the invention can be formulated in the vaccine or composition of the invention as neutral or salt forms. Pharmaceutically acceptable salts include acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids or organic acids such as acetic, oxalic, tartaric and maleic acids. The salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium or ferric hydroxides, and organic bases such as isopropylamine, trimethylamine, 2-ethylaminoethanol, histidine and procaine.

Administración de vacuna y otras composiciones farmacéuticas Administration of vaccine and other pharmaceutical compositions

Las vacunas y las composiciones farmacéuticas de la invención se administran de manera compatible con la formulación de dosificación y en tal cantidad que será profilácticamente eficaz. La cantidad de antígeno por dosis que va a administrarse que está generalmente en el intervalo de 10 ug a 1 mg por kg de peso, particularmente para la composición de vacuna de la invención, depende del sujeto que va a tratarse, la capacidad del sistema inmunitario del sujeto para sintetizar anticuerpos, y el grado de protección deseado. Las cantidades precisas de principio activo que se requiere administrar pueden depender del criterio del médico y pueden ser diferentes para cada sujeto. The vaccines and pharmaceutical compositions of the invention are administered in a manner compatible with the dosage formulation and in such an amount that it will be prophylactically effective. The amount of antigen per dose to be administered that is generally in the range of 10 ug to 1 mg per kg of weight, particularly for the vaccine composition of the invention, depends on the subject to be treated, the ability of the immune system of the subject to synthesize antibodies, and the degree of protection desired. The precise amounts of active ingredient that are required to be administered may depend on the physician's criteria and may be different for each subject.

Las vacunas y las composiciones farmacéuticas de la invención pueden administrarse en un programa de dosis única, o preferiblemente en un programa de múltiples dosis. Un programa de múltiples dosis es uno en el que un ciclo principal de vacunación puede ser con 1-10 dosis separadas, seguido por otras dosis administradas a intervalos de tiempo posteriores requeridos para mantener y/o reforzar la respuesta inmunitaria, por ejemplo a de 1 a 4 meses para una segunda dosis y si es necesario una(s) dosis posterior(es) tras varios meses. El régimen de dosificación también se determinará, al menos, en parte mediante la necesidad del individuo y dependerá del criterio del médico. The vaccines and pharmaceutical compositions of the invention can be administered in a single dose schedule, or preferably in a multiple dose schedule. A multiple dose schedule is one in which a main vaccination cycle can be with 1-10 separate doses, followed by other doses administered at subsequent time intervals required to maintain and / or strengthen the immune response, for example at 1 at 4 months for a second dose and if necessary a subsequent dose (s) after several months. The dosage regimen will also be determined, at least, in part by the individual's need and will depend on the physician's criteria.

Los siguientes ejemplos ilustran la invención. The following examples illustrate the invention.

Ejemplos Examples

Ejemplo 1: Reconocimiento serológico de antígenos de Dermatobia Hominis usando inmunotransferencia. Example 1: Serological recognition of Dermatobia Hominis antigens using immunoblot.

Se sometió un homogenizado de larvas L2 y L3 de Dermatobia hominis a SOS-PAGE al 12% (por duplicado) e inmunotransferencia de tipo Western según metodología convencional (Towbin et al., 1979) usando los sueros de animales infectados de manera natural a diferentes diluciones como anticuerpos primarios. Se usaron sueros de animales no infectados como control negativo. Se usó el anticuerpo anti-vaca secundario marcado con peroxidasa a una dilución indicada por la empresa; se llevó a cabo el revelado con tetraclorhidrato de 3'3'-diaminobencidina y H20 2. Se tiñó el segundo gel con azul de Coomassie y se seleccionaron las bandas con el potencial inmunogénico más alto en comparación con los sueros positivos para identificar las proteínas de interés. A homogenate of L2 and L3 larvae of Dermatobia hominis was subjected to 12% SOS-PAGE (in duplicate) and Western blot according to conventional methodology (Towbin et al., 1979) using sera from naturally infected animals to different dilutions as primary antibodies. Serums from uninfected animals were used as a negative control. The peroxidase-labeled secondary anti-cow antibody was used at a dilution indicated by the company; development was carried out with 3'3'-diaminobenzidine tetrahydrochloride and H20 2. The second gel was stained with Coomassie blue and the bands with the highest immunogenic potential were selected compared to positive sera to identify the proteins of interest.

Se sometieron las rodajas de gel que contenían las proteínas de interés a digestión con tripsina y entonces se analizaron mediante EM/EM. Se identificaron las proteínas alineando las masas experimentales obtenidas mediante MALOI (huella de péptido) contra la digestión teórica de la base de datos entera usando el motor de búsqueda Mascot (www.matrixscience.com; Matrix Science Ud., Londres, R.U.). The gel slices containing the proteins of interest were subjected to trypsin digestion and then analyzed by MS / MS. Proteins were identified by aligning the experimental masses obtained by MALOI (peptide fingerprint) against the theoretical digestion of the entire database using the Mascot search engine (www.matrixscience.com; Matrix Science Ud., London, R.U.).

Ejemplo 2: Selección de las secuencias peptídicas SEO ID NO 1 Y SEO ID NO 2 Example 2: Selection of the peptide sequences SEO ID NO 1 AND SEO ID NO 2

Se identificaron los epítopos de antígeno con la herramienta EMBOSS ANTIGENIC (http://liv.bmc.uu.se/cgi-bin/emboss/antigenic). Una vez que se identificaron las secuencias peptídicas (de seq 1 a seq 10), se alinearon con creatinina cinasa AA030974.1 mediante 80S taurus para descartar posibles homologías. Antigen epitopes were identified with the EMBOSS ANTIGENIC tool (http://liv.bmc.uu.se/cgi-bin/emboss/antigenic). Once the peptide sequences (from seq 1 to seq 10) were identified, they were aligned with AA030974.1 creatinine kinase by 80S taurus to rule out possible homologies.

Alineación de Seq. 1 Alignment of Seq. one

Puntuación = 26,5 bits (55), Esperado = 7e-06 Identidades = 10/14 (71%), Positivos = 11/14 (79%), Huecos = 2/14 (14%) Score = 26.5 bits (55), Expected = 7e-06 Identities = 10/14 (71%), Positive = 11/14 (79%), Gaps = 2/14 (14%)

Consulta 1 LGF-LTFCPTNLGT 13 LG+ L T CP NLGT Objeto 277 LGYVLT-CPSNLGT 289 Query 1 LGF-LTFCPTNLGT 13 LG + L T CP NLGT Object 277 LGYVLT-CPSNLGT 289

Alineación de Seq.2 Alignment of Seq. 2

Puntuación = 16,8 bits (32), Esperado = 0,025 Identidades = 5/7 (71 %), Positivos = 5/7 (71 %), Huecos = 0/7 (0%) Score = 16.8 bits (32), Expected = 0.025 Identities = 5/7 (71%), Positive = 5/7 (71%), Gaps = 0/7 (0%)

Consulta 10 SHDDRLG 16 S DRLG Objeto 337 SNADRLG 343 Query 10 SHDDRLG 16 S DRLG Object 337 SNADRLG 343

Puntuación = 11,7 bits (20), Esperado = 1,4 Identidades = 4/9 (44%), Positivos = 6/9 (67%), Huecos = 0/9 (0%) Score = 11.7 bits (20), Expected = 1.4 Identities = 4/9 (44%), Positive = 6/9 (67%), Gaps = 0/9 (0%)

Consulta 8 PFSHDDRLG 16 PF ++ LG Objeto 270 PFMWNEHLG 278 Query 8 PFSHDDRLG 16 PF ++ LG Object 270 PFMWNEHLG 278

Se sintetizaron péptidos sintéticos usando química en fase sólida de Fmoc para usarlos en ensayos de transferencia puntual e inmunizaciones experimentales, en los que demostraron ser antigénicos e inmunogénicos. Synthetic peptides were synthesized using solid phase chemistry of Fmoc for use in point transfer assays and experimental immunizations, in which they proved to be antigenic and immunogenic.

Ejemplo 3: La secuencia peptídica SEO ID NO 1 protege contra infección por miasis provocada por Dermatobia Hominis. Example 3: The SEO ID NO 1 peptide sequence protects against myiasis infection caused by Dermatobia Hominis.

Se inmunizó un grupo de seis terneros con dos inyecciones (1 mg/kg en peso) separadas a lo largo de 20 días con la SEQ ID NO 1 peptídica en 0,5 mi de montan ida. Se disolvieron los péptidos en una disolución de PBS y se formularon con la emulsión agua en aceite de montanida ISA 720 agitando con vórtex (Miles et al., 2005). Se recogieron sueros semanalmente y se evaluaron para determinar los títulos de subclases de IgG y de IgG total. Se inoculó la misma cantidad de adyuvante en un grupo control de ternero. Se mantuvieron todos los animales en su entorno natural, extrayendo sangre cada mes para evaluar el título de inmunoglobulina anti-péptido inoculado. Se evaluó la protección seis meses tras el inicio de la inmunización, contándose el número de lesiones provocadas por Dermatobia en la piel de los animales. En la figura 1 se muestra la reducción en el número de larvas en los animales vacunados en comparación con el grupo control. A group of six calves was immunized with two injections (1 mg / kg by weight) separated over 20 days with peptide SEQ ID NO 1 in 0.5 ml of riding. The peptides were dissolved in a solution of PBS and formulated with the water emulsion of montanide oil ISA 720 by vortexing (Miles et al., 2005). Serums were collected weekly and evaluated to determine the subclass titers of IgG and total IgG. The same amount of adjuvant was inoculated in a calf control group. All animals were kept in their natural environment, drawing blood each month to evaluate the inoculated anti-peptide immunoglobulin titer. Protection was evaluated six months after the start of immunization, counting the number of lesions caused by Dermatobia in the skin of animals. Figure 1 shows the reduction in the number of larvae in vaccinated animals compared to the control group.

Se inmunizó un grupo de conejos en paralelo de la misma manera (dosis, régimen y vía de administración) que los terneros, evaluándose el título de anticuerpo cada quince días frente un antígeno total de larvas de Dermatobia. Los resultados se muestran en la figura 2. A group of rabbits was immunized in parallel in the same manner (dose, regimen and route of administration) as the calves, the antibody titre being evaluated every fifteen days against a total Dermatobia larval antigen. The results are shown in figure 2.

Los resultados indicados anteriormente demuestran que las composiciones farmacéuticas de la invención, particularmente las vacunas, pueden usarse para proteger mamíferos contra infección de insectos dípteros que provocan miasis. The results indicated above demonstrate that the pharmaceutical compositions of the invention, particularly vaccines, can be used to protect mammals against infection of diptera insects that cause myiasis.

10 Un experto en la técnica aprecia fácilmente que la presente invención se adapta bien para llevar a cabo los objetos y obtener los fines y ventajas mencionados, así como aquellos inherentes al mismo. Los ejemplos proporcionados en el presente documento son representativos de realizaciones preferidas, son a modo de ejemplo, y no pretenden ser limitativos del alcance de la invención. A person skilled in the art readily appreciates that the present invention is well adapted to carry out the objects and obtain the mentioned purposes and advantages, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are by way of example, and are not intended to be limiting of the scope of the invention.

Claims (21)

Reivindicaciones  Claims
1. one.
Péptido que comprende: a) la secuencia SEQ ID NO 1; o b) una variante de la secuencia de a) que sea homóloga en al menos el 70% a la SEQ ID Peptide comprising: a) the sequence SEQ ID NO 1; or b) a variant of the sequence of a) that is homologous by at least 70% to SEQ ID
NO 1, basándose en la identidad de la totalidad de los aminoácidos de dicha secuencia, y que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros capaces de provocar miasis. NO 1, based on the identity of all the amino acids of said sequence, and that can generate a protective immune response against infection by Diptera insect larvae capable of causing myiasis.
2. 2.
Péptido de acuerdo con la reivindicación 1, en el que el péptido comprende la SEQ ID NO Peptide according to claim 1, wherein the peptide comprises SEQ ID NO
1. one.
3. 3.
Péptido de acuerdo con la reivindicación 1, en el que el péptido consiste esencialmente en la SEQ ID NO 1. Peptide according to claim 1, wherein the peptide essentially consists of SEQ ID NO 1.
4. Four.
Polinucleótido que comprende una secuencia seleccionada de cualquiera de las siguientes: a) la secuencia SEQ ID NO 11 o su secuencia complementaria; o b) una secuencia que híbrida selectivamente con la secuencia codificante de una cualquiera de las secuencias peptídicas de la reivindicación 1 apartado b). Polynucleotide comprising a sequence selected from any of the following: a) the sequence SEQ ID NO 11 or its complementary sequence; or b) a sequence that selectively hybridizes with the coding sequence of any one of the peptide sequences of claim 1 section b).
5. 5.
Vector de expresión que comprende un polinucleótido según la reivindicación 4, operativamente unido a una secuencia reguladora. Expression vector comprising a polynucleotide according to claim 4, operably linked to a regulatory sequence.
6. 6.
Célula huésped transformada con un polinucleótido de la reivindicación 4. Host cell transformed with a polynucleotide of claim 4.
7. 7.
Procedimiento de producción del péptido de cualquiera de las reivindicaciones 1 a 3, que comprende mantener una célula huésped transformada con un polinucleótido que codifique para un péptido de cualquiera de las reivindicaciones 1 a 3, en condiciones para proporcionar la expresión del péptido. Method of producing the peptide of any one of claims 1 to 3, which comprises maintaining a host cell transformed with a polynucleotide encoding a peptide of any one of claims 1 to 3, under conditions to provide expression of the peptide.
8. 8.
Anticuerpo o fragmento de anticuerpo que se una específicamente al péptido de cualquiera de las reivindicaciones 1 a 3. Antibody or antibody fragment that specifically binds to the peptide of any one of claims 1 to 3.
9. 9.
Composición veterinaria o farmacéutica que comprende el péptido de cualquiera de las reivindicaciones 1 a 3 y/o un anticuerpo o un fragmento del mismo tal y como se define en la reivindicación 8. Veterinary or pharmaceutical composition comprising the peptide of any one of claims 1 to 3 and / or an antibody or a fragment thereof as defined in claim 8.
10. 10.
Composición veterinaria o farmacéutica según la reivindicación 9, para su uso en terapia. Veterinary or pharmaceutical composition according to claim 9, for use in therapy.
11. eleven.
Uso de la composición veterinaria o farmacéutica de la reivindicación 9, para la elaboración de un medicamento para el tratamiento o la prevención en un mamífero de una infección por larvas de insectos dípteros capaces de provocar miasis. Use of the veterinary or pharmaceutical composition of claim 9, for the preparation of a medicament for the treatment or prevention in a mammal of an infection by larvae of diptera insects capable of causing myiasis.
12. 12.
U so de la composición veterinaria o farmacéutica según la reivindicación 11, donde las larvas de insectos dípteros pertenecen a una cualquiera de las siguientes familias: Calliphoridae (moscas azules), Oestridae (tábanos) o Sarcophagidae (moscas de la carne). U or of the veterinary or pharmaceutical composition according to claim 11, wherein the diptera insect larvae belong to any one of the following families: Calliphoridae (blueflies), Oestridae (horseflies) or Sarcophagidae (meatflies).
13. 13.
Uso de la composición veterinaria o farmacéutica según la reivindicación 12, donde las larvas de insectos dípteros pertenecen a la familia Oestridae. Use of the veterinary or pharmaceutical composition according to claim 12, wherein the diptera insect larvae belong to the Oestridae family.
14. 14.
Uso de la composición veterinaria o farmacéutica según la reivindicación 13, donde las larvas de insectos dípteros pertenecen a uno cualquiera de los siguientes géneros: Oestrus, Dermatobia, Hypoderma o Gasterophilinae. Use of the veterinary or pharmaceutical composition according to claim 13, wherein the diptera insect larvae belong to any one of the following genera: Oestrus, Dermatobia, Hypoderma or Gasterophilinae.
5 15. U so de la composición veterinaria o farmacéutica según la reivindicación 14, donde las larvas de insectos dípteros pertenecen a la especie Dermatobia hominis. 15. Use of the veterinary or pharmaceutical composition according to claim 14, wherein the diptera insect larvae belong to the Dermatobia hominis species.
16. Composición veterinaria o farmacéutica según cualquiera de las reivindicaciones 9 a 15, 16. Veterinary or pharmaceutical composition according to any of claims 9 to 15, que además comprende un vehículo farmacéuticamente aceptable. 10 which also comprises a pharmaceutically acceptable vehicle. 10 17. Composición veterinaria o farmacéutica según cualquiera de las reivindicaciones 9 a 15, en la que dicha composición veterinaria o farmacéutica es una vacuna. 17. Veterinary or pharmaceutical composition according to any of claims 9 to 15, wherein said veterinary or pharmaceutical composition is a vaccine. 18. Composición veterinaria o farmacéutica según una cualquiera de las reivindicaciones 11 a 15 15, en la que el mamífero es un ser humano. 18. Veterinary or pharmaceutical composition according to any one of claims 11 to 15, wherein the mammal is a human being. 19. Composición veterinaria o farmacéutica según una cualquiera de las reivindicaciones 11 a 15, en la que el mamífero pertenece a la subfamilia biológica bovina. 19. Veterinary or pharmaceutical composition according to any one of claims 11 to 15, wherein the mammal belongs to the bovine biological subfamily.
40 40
30 30
10 10
o or
Terneros vac Terneros Figura 1 Calves vac Calves Figure 1
OJ'>4 OJ '> 4
0.32 0.32 0.16 0.16 0.1:10 0.1: 10 Figura 2  Figure 2   Identidades= 159/359 (44%), Positivos = 224/359 (62%), Huecos = 17/359 (5%) Identities = 159/359 (44%), Positive = 224/359 (62%), Gaps = 17/359 (5%) arginina-----MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVI54 creatinaMPFGNTHNKHKLNFKAEEEYPDLSKHNN--HMAKALTLEIYKKLRDKETPSGFTLDDVI57 arginine ----- MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVI54 creatineMPFGNTHNKHKLNFKAEEEYPDLSKHNN - HMAKALTLEIYKKLRDKETPSGFTLDDVI57 . * ** * *. . * ** *...*..* **. ** ***. * ** * *. . * ** * ... * .. * **. ** *** ...... ...... argininaQSGLENHDS---GVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTF 110 creatinaQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPllQDRHGGFKPTDKHKTDLNHENLK 116 arginine QSGLENHDS --- GVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTF 110 creatineQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPllQDRHGGFKPTDKHKTDLNHENLK *.*..* ** . . ...*. * .. * **. . ... * * *.**** *******.* ***** **** * * *. **** *******. * ***** **** argininaGNVDPTNEYVISTRVRCGRSMQGYPFNPCL TEAQYKEMESKVSSTLSGLEG ELKGKFYPL 170 creatinaGGDDLDPNYVLSSRVRTGRSI KGY ALPPHCSRGERRAVEKLSVEALNSL TGE FKGKYYPL 176 arginineGNVDPTNEYVISTRVRCGRSMQGYPFNPCL TEAQYKEMESKVSSTLSGLEG ELKGKFYPL 170 creatineGGDDLDPNYVLSSRVRTGRSI KGY ALPPHCSRGERRAVEKLSVEALNSL TGE FKGKYYPL 176 * * .**.*.*** ***..** . * . . ..* .* * **.***.**** *. **. *. *** *** .. **. *. . .. *. * * **. ***. *** ........... ........... argininaTGMEKAVQQQLlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFL VWCNEEDHLR 229 creatinaKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLV WVNEEDHLR 236 arginineTGMEKAVQQQLlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFL VWCNEEDHLR 229 creatineKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLV WVNEEDHLR 236 *. ***********. .* *. * ** ***.*** *.**** ******* *. ***********. . * *. * ** ***. *** *. **** ******* argininaIISMQQGGDLGQIYKRLVTAVNEIEKR----VPFSHDDRLGFL TFCPTNLGTTIRASVH 284 creatinaVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVL TCPSNLG TGLRGGVH 296 arginineIISMQQGGDLGQIYKRLVTAVNEIEKR ---- VPFSHDDRLGFL TFCPTNLGTTIRASVH 284 creatineVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVL TCPSNLG TGLRGGVH 296 .***..**......*. ...**. ** ...**.. **.****.* ** . *** .. ** ...... *. ... ** ** ... ** .. **. ****. * ** . .............. . . ............... arg ininal KVP KLASN KAKLE EV AAKYN LQVRGTRG EHTEAEGGVYD ISN KRRMG L TE F EAVKEMYD 344 creatina VKLAH LSKHPKFEEIL TRLRLQKRGTGGVDT AAVGSVFDVSNADRLGSSEVEQVQLVVD 355 arg ininal KVP KLASN KAKLE EV AAKYN LQVRGTRG EHTEAEGGVYD ISN KRRMG L TE F EAVKEMYD 344 creatine VKLAH LSKHPKFEEIL TRLRLQKRGTGGVDT AAVGSVFDVSNADRLGSSEVEQ5 .*..*... *.**... ** *** * * * * *.*.** *.*.* * * .. * . * .. * ... *. ** ... ** *** * * * * *. *. ** *. *. * * * .. * argininaGITELlKLEKSL--------------356 creatinaGVKLMVEMEKKLEKGQS I DDLI PAQK 381 arginine GITELlKLEKSL -------------- 356 creatine GVKLMVEMEKKLEKGQS I DDLI PAQK 381 Figura 3 Figure 3 Figura 4 Figure 4 Dermatobia -----------------------HPAKNWGDVSVFGNLD---------------------16 AAN11983.1 MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLE N 60 Dermatobia ----------------------- HPAKNWGDVSVFGNLD --------------------- 16 AAN11983.1 MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLE N 60 *.. ** ** * .. ** ** Dermatobia ---------PNGE-------------------FVVSTR----NWGDVSVFGNLDPNGEFV 44 AAN11983.1 HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFGNVDPTNE YV 120 Dermatobia --------- PNGE ------------------- FVVSTR ---- NWGDVSVFGNLDPNGEFV 44 AAN11983.1 HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFGNVDPTNE YV 120 *. * * .. *.**** ***.** *.**. * * .. *. **** ***. ** *. * . . . . . . . . Dermatobia VSTRVR---SLEGYPFNPCLTEAQYKEME------------QKGTFYPLTGMSKDVQQ-87 AAN11983.1 ISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAV QQQ 180 Dermatobia VSTRVR --- SLEGYPFNPCLTEAQYKEME ------------ QKGTFYPLTGMSKDVQQ-87 AAN11983.1 ISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAV QQQ 180 .***** * ***************** ** ******* * ***.. ***** * ***************** ** ******* * ***. . . . . Dermatobia ------------KFLQAANAC------RGIYHNENKTFLVWCNEEDHLR----------118 AAN11983.1 LlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGG DLG 240 Dermatobia ------------ KFLQAANAC ------ RGIYHNENKTFLVWCNEEDHLR ---------- 118 AAN11983.1 LlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGG DLG 240 .******** ******. ************** . ******** ******. ************** Dermatobia ---------------RIPFSHDDRLGFLTFCPTNLGTTLR--------------------143 AAN11983.1 QIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEV 300 Dermatobia --------------- RIPFSHDDRLGFLTFCPTNLGTTLR -------------------- 143 AAN11983.1 QIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEV 300 *.*********************.*.*. *********************. *. . . Dermatobia -------------------------------------------------------AAN11983.1 AAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELlKLEKSL 356 Dermatobia ------------------------------------------------- ------ AAN11983.1 AAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELlKLEKSL 356 Figura 5 Figure 5 sequence listing_sT25 final text Listado De Secuencias sequence listing_sT25 final text Sequence Listing <110> Universidad de Granada <110> University of Granada <120> COMPOSICIÓN BASADA EN POLIPÉPTIDOS PARA EL TRATAMIENTO DE MIASIS <120> POLIPEPTIDE-BASED COMPOSITION FOR THE TREATMENT OF MIASIS <130> 153930 <130> 153930 <160> 12 <160> 12 <170> PatentIn version 3.4 <170> PatentIn version 3.4 <210> 1 <210> 1 <211> 13 <211> 13 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <220> <220> <221> PEPTIDE <221> PEPTIDE <222> (1) .. (13)<222> (1) .. (13) <223> Fragmento antigenico <223> Antigenic fragment <400> 1 <400> 1 Leu Gly Phe Leu Thr Phe cys Pro Thr Asn Leu Gly Thr 1 5 10 Leu Gly Phe Leu Thr Phe cys Pro Thr Asn Leu Gly Thr 1 5 10 <210> 2 <210> 2 <211> 16 <211> 16 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <221> PEPTIDE <221> PEPTIDE <222> (1) .. (16)<222> (1) .. (16) <223> Fragmento antigenico <223> Antigenic fragment <400> 2 <400> 2 Asn Glu Ile Glu Lys Arg val Pro Phe Ser His ASp ASp Arg Leu Gly1 5 10 15 Asn Glu Ile Glu Lys Arg val Pro Phe Ser His ASp ASp Arg Leu Gly1 5 10 15 <210> 3 <210> 3 <211> 26 <211> 26 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 3 <400> 3 His Pro Ala Lys Asn Trp Gly ASp Val Ser val Phe Gly Asn Leu ASp1 5 10 15 His Pro Ala Lys Asn Trp Gly ASp Val Ser val Phe Gly Asn Leu ASp1 5 10 15 Pro Asn Gly Glu Phe val val Ser Thr Arg 20 25 Pro Asn Gly Glu Phe val val Ser Thr Arg 20 25 <210> 4 <210> 4 1 one sequence listing_sT25 final text sequence listing_sT25 final text <211> 24 <211> 24 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 4 <400> 4 Asn Trp Gly ASp val Ser val Phe Gly Asn Leu ASp Pro Asn Gly Gl u 1 5 10 15 Asn Trp Gly ASp val Ser val Phe Gly Asn Leu ASp Pro Asn Gly Gl u 1 5 10 15 Phe val val Ser Thr Arg val Arg20 Phe val val Ser Thr Arg val Arg20 <210> 5 <210> 5 <211> 22 <211> 22 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 5 <400> 5 Ser Leu Glu Gly Tyr Pro Phe Asn Pro cys Leu Thr Glu Ala Gl n Tyr1 5 10 15 Ser Leu Glu Gly Tyr Pro Phe Asn Pro cys Leu Thr Glu Ala Gl n Tyr1 5 10 15 Lys Glu Met Gl u Gl n Lys20 Lys Glu Met Gl u Gl n Lys20 <210> 6 <210> 6 <211> 16 <211> 16 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 6 <400> 6 Gly Thr Phe Tyr Pro Leu Thr Gly Met Ser Lys ASp val Gln Gl n Lys1 5 10 15 Gly Thr Phe Tyr Pro Leu Thr Gly Met Ser Lys ASp val Gln Gl n Lys1 5 10 15 <210> 7 <210> 7 <211> 9 <211> 9 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 7 <400> 7 Phe Leu Gln Ala Ala Asn Ala cys Arg1 5 Phe Leu Gln Ala Wing Asn Ala cys Arg1 5 <210> 8 <210> 8 <211> 8 <211> 8 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence 2 2 sequence listing_sT25 final text sequence listing_sT25 final text <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 8 <400> 8 Gly Ile Tyr His Asn Glu Asn Lys1 5 Gly Ile Tyr His Asn Glu Asn Lys1 5 <210> 9 <210> 9 <211> 13 <211> 13 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 9 <400> 9 Thr Phe Leu val Trp cys Asn Glu Glu ASp His Leu Arg1 5 10 Thr Phe Leu val Trp cys Asn Glu Glu ASp His Leu Arg1 5 10 <210> 10 <210> 10 <211> 25 <211> 25 <212> PRT <212> PRT <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Fragmento antigenico <223> Antigenic fragment <400> 10 <400> 10 Arg Ile Pro Phe Ser His ASp ASp Arg Leu Gly Phe Leu Thr Phe cys1 5 10 15 Arg Ile Pro Phe Ser His ASp ASp Arg Leu Gly Phe Leu Thr Phe cys1 5 10 15 Pro Thr Asn Leu Gly Thr Thr Leu Arg20 25 Pro Thr Asn Leu Gly Thr Thr Leu Arg20 25 <210> 11 <210> 11 <211> 39 <211> 39 <212> DNA <212> DNA <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Secuencia nucleotidica codificante de la SEQ ID No 1 <223> Nucleotide sequence coding for SEQ ID No 1 <400> 11 ctgggcttcc tgaccttctg ccccaccaac ctgggcacc 39 <400> 11 ctgggcttcc tgaccttctg ccccaccaac ctgggcacc 39 <210> 12 <210> 12 <211> 48 <211> 48 <212> DNA <212> DNA <213> Secuencia artificial <213> Artificial sequence <220> <220> <223> Secuencia nucleotidica codificante de la SEQ ID No 2 <223> Nucleotide sequence coding for SEQ ID No 2
ES201231063A 2012-07-06 2012-07-06 COMPOSITION BASED ON POLIPEPTIDES FOR THE TREATMENT OF MIASIS Expired - Fee Related ES2441880B1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
ES201231063A ES2441880B1 (en) 2012-07-06 2012-07-06 COMPOSITION BASED ON POLIPEPTIDES FOR THE TREATMENT OF MIASIS
PCT/ES2013/070481 WO2014006262A1 (en) 2012-07-06 2013-07-06 Composition containing polypeptides for the treatment of myiasis

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
ES201231063A ES2441880B1 (en) 2012-07-06 2012-07-06 COMPOSITION BASED ON POLIPEPTIDES FOR THE TREATMENT OF MIASIS

Publications (2)

Publication Number Publication Date
ES2441880A1 true ES2441880A1 (en) 2014-02-06
ES2441880B1 ES2441880B1 (en) 2014-11-13

Family

ID=49881403

Family Applications (1)

Application Number Title Priority Date Filing Date
ES201231063A Expired - Fee Related ES2441880B1 (en) 2012-07-06 2012-07-06 COMPOSITION BASED ON POLIPEPTIDES FOR THE TREATMENT OF MIASIS

Country Status (2)

Country Link
ES (1) ES2441880B1 (en)
WO (1) WO2014006262A1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11505581B2 (en) * 2015-05-14 2022-11-22 La Jolla Institute For Allergy And Immunology Antigens and T cell epitopes from cockroach and methods of making and using same

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZW8893A1 (en) * 1992-07-21 1994-06-01 Pitman Moore Inc Vaccines
US20090036653A1 (en) * 2006-04-13 2009-02-05 Peptimmune, Inc. Methods for the directed expansion of epitopes for use as antibody ligands
BRPI0817682A2 (en) * 2007-10-16 2015-04-07 Peptimmune Inc Methods for designing and preparing vaccines comprising sequence-directed polymer compositions via direct epitope expansion
CA2839677A1 (en) * 2010-06-29 2012-01-12 Board Of Regents Of The University Of Nebraska Analogs of c5a and methods of using same

Also Published As

Publication number Publication date
ES2441880B1 (en) 2014-11-13
WO2014006262A1 (en) 2014-01-09

Similar Documents

Publication Publication Date Title
KR102482994B1 (en) Vaccine composition for preventing or treating infection of SARS-CoV-2
JP7083362B2 (en) Senecavirus A immunogenic composition and its method
CN105228644B (en) Prevent the peptide vaccine with immunization therapy alzheimer dementia
EP1928898B1 (en) Fish vaccine
US20220105170A1 (en) African swine fever vaccine
JPH03502687A (en) Respiratory syncytial viruses: vaccines and diagnostics
US11572392B2 (en) Mutant fragments of OspA and methods and uses relating thereto
CZ280743B6 (en) Vaccine containing pc protein for preventing or treating lyme borreliosis, purification process of b burgdorferi protein, diagnostic agent for detecting b burgdorferi antobodies and method of detecting presence of b burgdorferi antibodies in body liquid
CA3233697A1 (en) Recombinant fusion protein derived from hr region of s2 protein of sars-cov-2 and application of recombinant fusion protein
Boulanger et al. Vaccination of goats against the trematode Schistosoma bovis with a recombinant homologous schistosome‐derived glutathione S‐transferase
ES2754374T3 (en) Enzyme-linked immunosorbent assay (ELISA) for the detection of anti-Mycoplasma Hyorhinis IgG in porcine serum
US20210205430A1 (en) Virb10 for vaccination against gram negative bacteria
KR20100139096A (en) Compositions, methods and kits
CN111529700A (en) Echinococcus multilocularis leukamidopeptidase subunit vaccine LAP and preparation method and application thereof
AU772387B2 (en) Peptide repeat immunogens
ES2441880A1 (en) Composition containing polypeptides for the treatment of myiasis
KR100563197B1 (en) Recombinant VP2 Protein Comprising Canine Parvovirus Neutralization Antigen Epitope And Vaccine Composition Comprising The Same
CN115322247A (en) Novel charge mutant antigen of coronavirus receptor binding region and application
RU2742250C2 (en) Optimized polypeptide for a sub-unit vaccine for reovirus of birds
ES2256062T3 (en) PROTEINA LPPQ ANTIGENICA DE MYCOPLASMA MYCOIDES SUBSP.MYCOIDES SC, ITS PREPARATION AND USE.
CN105399802B (en) A-type foot-and-mouth disease gene engineering composite epitope protein and vaccine
Zhigang et al. Phylogenetic Analysis and Biological Characteristics Identification of a Canine Distemper Virus Strain Isolated from a vaccinated Domestic Dog in the Northeast China
WO2023062182A1 (en) Vaccine compositions against bovine viral diarrhea virus
ES2259550B1 (en) VACCINATION PROCEDURE AND STRATEGIES TO POWER THE IMMUNE RESPONSE AGAINST PRICES AFTER VACCINATION, DIAGNOSIS KITS AND PHARMACEUTICAL COMPOSITIONS FOR PROPHYLAXIS AND TREATMENT OF SPONGIFORM ENCEPHALOPATHY.
BR102019021511A2 (en) Production method of toxocara canis recombinant proteins, targeted as a vaccine to control canine toxocariasis

Legal Events

Date Code Title Description
FG2A Definitive protection

Ref document number: 2441880

Country of ref document: ES

Kind code of ref document: B1

Effective date: 20141113

FD2A Announcement of lapse in spain

Effective date: 20210915