WO2016205427A2 - Binding proteins against vegf, pdgf, and/or their receptors - Google Patents

Binding proteins against vegf, pdgf, and/or their receptors Download PDF

Info

Publication number
WO2016205427A2
WO2016205427A2 PCT/US2016/037710 US2016037710W WO2016205427A2 WO 2016205427 A2 WO2016205427 A2 WO 2016205427A2 US 2016037710 W US2016037710 W US 2016037710W WO 2016205427 A2 WO2016205427 A2 WO 2016205427A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cdrs
binding protein
binding
disease
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/037710
Other languages
French (fr)
Other versions
WO2016205427A3 (en
Inventor
Jijie Gu
Diana BOWLEY
Lucia EATON
Feng Dong
Lorenzo Benatuil
Tariq Ghayur
Ravi Chari
Matthew RIESER
Anca Clabbers
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AbbVie Inc
Original Assignee
AbbVie Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by AbbVie Inc filed Critical AbbVie Inc
Publication of WO2016205427A2 publication Critical patent/WO2016205427A2/en
Publication of WO2016205427A3 publication Critical patent/WO2016205427A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the invention relates to antibodies and antigen-binding fragments thereof, as well as multivalent and multispecific binding proteins, that bind vascular endothelial growth factor (VEGF) and/or platelet-derived growth factor (PDGF), as well as their receptors, and methods of making, and using the constructs in the diagnosis, prevention, and/or treatment of acute and chronic inflammatory diseases, cancer, and other disorders.
  • VEGF vascular endothelial growth factor
  • PDGF platelet-derived growth factor
  • Angiogenesis the formation of new blood vessels from pre-existing vasculature, plays a role in the pathogenesis of many diseases, including ocular diseases such as age-related macular degeneration (AMD) or diabetic macular edema (DME).
  • Vascular endothelial growth factor (VEGF) plays a role in the regulation of normal and abnormal angiogenesis (Ferrara et al. (1997) Endocr. Rev.18:4-25).
  • VEGF vascular endothelial growth factor
  • Several anti-VEGF agents are provided in the art, e.g., in U.S. Patent No.7,169,901, which discloses VEGF antibodies for inhibiting VEGF-induced cell proliferation, and U.S. Patent No.7,070,959, which discloses isolated nucleic acid molecules encoding fusion proteins capable of binding VEGF.
  • Targeting VEGF with currently available therapeutics is not effective in all patients or for all diseases associated with inflammation and/or angiogenesis.
  • a currently preferred treatment for wet AMD consists of intravitreal injections of an anti-VEGF agent.
  • anti-VEGF therapy reduces choroidal
  • neovascularization it does not have an effect on regression of the mature vasculature.
  • current agents do not provide an anti-fibrotic effect, so that once scarring of the retina occurs; visual acuity cannot be recovered.
  • Other limitations of the existing treatments regimens include patient discomfort, the need for repeat injections with inherent complications including endophthalmitis, retinal tear and detachment, intraocular hemorrhage, and cataract formation.
  • OCT optical coherence tomography
  • Platelet-derived growth factor is a growth factor involved in the regulation of blood vessels from pre-existing vessel tissue. PDGF binds to receptors on pericytes in newly-forming abnormal blood vessels. This may contribute to neovascularization of abnormal blood vessels by providing a protective perictye coating, for example, during ocular disorders such as wet AMD.
  • Engineered proteins such as antibodies, fragments, and multispecific binding proteins capable of binding two or more antigens, are known in the art. Such multispecific binding proteins can be generated using cell fusion, chemical conjugation, or recombinant DNA techniques. There are a variety of multispecific binding protein structures known in the art and many structures and methods have distinct disadvantages.
  • Bispecific antibodies can also be produced by chemical conjugation of two different mAbs.
  • Other approaches include coupling of two parental antibodies with a hetero-bifunctional crosslinker, production of tandem single-chain Fv molecules, diabodies, bispecific diabodies, single-chain diabodies, and di-diabodies.
  • a multivalent antibody construct comprising two Fab repeats in the heavy chain of an IgG and capable of binding four antigen molecules has been described (see PCT Publication No. WO 01/77342 and Miller et al. (2003) J. Immunol.
  • DVD-Ig binding protein dual variable domain binding proteins
  • DVD-Ig dual variable domain immunoglobulins
  • DVD-Ig molecules are binding proteins that may be used to bind two distinct epitopes on the same molecule or two different molecules simultaneously.
  • DVD-Ig molecules are unique binding proteins comprised of two variable domains fused to N-terminal constant regions. The variable domains may be directly fused to one another or connected via synthetic peptide linkers of assorted length and amino acid composition.
  • DVD-Ig binding proteins may be engineered with intact and functional Fc domains, or otherwise modified constant domains, allowing them to mediate appropriate effector functions and exhibit other desired properties.
  • the DVD-Ig format due to its flexibility of choice of variable domain pair, orientation of two antigen-binding domains, and the length of the linker that joins them, may provide novel therapeutic modalities.
  • VEGF monotherapy has had some success in the art
  • constructs exhibiting better targeting, efficiency, and/or efficacy in binding to VEGF, as well as improved targeting of other pathways involved in inflammation (such as ocular inflammation), e.g., the PDGF pathway.
  • Improved targeting of either of these molecules, alone or in combination may lead to improvements in, e.g., preventing, diagnosing, and/or treating disorders such as angiogenic, inflammatory, and/or ocular disorders.
  • new variable domain sequences can further improve the properties of binding proteins targeting VEGF and/or PDGF, or their cognate receptors.
  • binding proteins capable of binding VEGF and/or PDGF, and/or their cognate receptors.
  • the binding proteins are antibodies to VEGF and/or PDGF, or antigen-binding fragments thereof.
  • the binding proteins are bispecific and capable of binding VEGF and PDGF.
  • the binding proteins comprise one or more sequences from any one of Tables A, 27-30, 38-42, 46-50, or 56-58, or the CDR amino acid residues from those sequences.
  • the bnding proteins are bispecific or multispecific binding proteins capable of binding one or more of VEGF and/or PDGF, and/or their cognate receptors.
  • the binding proteins are dual variable domain immunoglobulins (DVD-Igs or DVD-Ig binding proteins) using the binding protein framework disclosed in U.S. Patent No.7,612,181 (incorporated herein by reference in its entirety).
  • the DVD-Ig binding proteins contain particular first and second polypeptide chains, each comprising first and second variable domains comprising sequences (e.g., sequences selected from those listed in Tables A, 27-30, 38-42, 46-50, or 56-58, or the CDR amino acid residues from those sequences) that form functional binding sites for binding targets such as VEGF and/or PDGF, or their cognate receptors.
  • first and second polypeptide chains each comprising first and second variable domains comprising sequences (e.g., sequences selected from those listed in Tables A, 27-30, 38-42, 46-50, or 56-58, or the CDR amino acid residues from those sequences) that form functional binding sites for binding targets such as VEGF and/or PDGF, or their cognate receptors.
  • the first and second polypeptide chains of the binding protein each independently comprise VD1- (X1)n-VD2-C-X2, wherein VD1 is a first variable domain; VD2 is a second variable domain; C is a constant domain; X1 is a linker; X2 is an Fc region that is either present or absent; n is 0 or 1, and wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site for VEGF, PDGF, or a cognate receptor, and the VD2 domains on the first and second polypeptide chains form a second functional target binding site for VEGF, PDGF, or a cognate receptor.
  • the first polypeptide chain of the binding protein comprises VD1-(X1)n-VD2-C-X2, wherein VD1 is a first heavy chain variable domain; VD2 is a second heavy chain variable domain; C is a heavy chain constant domain; X1 is a linker; X2 is an Fc region; and n is 0 or 1 (i.e., X1 and X2 are either present or absent, depending on whether n is independently chosen to be 0 or 1 for each position); and (b) the second polypeptide chain of the binding protein comprises VD1-(X1)n-VD2-C-X2, wherein VD1 is a first light chain variable domain; VD2 is a second light chain variable domain; C is a light chain constant domain; X1 is a linker; X2 is an Fc region; and n is 0 or 1 for X1 and n is 0 for X2 (i.e., the Fc region is absent on the second poly
  • the VD1 position forms a binding site for VEGF and the VD2 position forms a binding site for PDGF.
  • the CDR and/or variable domains at the VD1 and VD2 positions are antibody variable domains and the constant domains are antibody constant domains. Any of the CDR and/or variable domain and/or first and second polypeptide chain sequences disclosed herein may be incorporated in these DVD-Ig binding protein structures to form binding domains for VEGF and/or PDGF, and/or their cognate receptors.
  • both the first and second binding sites of a DVD-Ig construct disclosed herein target VEGF.
  • both the first and second binding sites target PDGF.
  • the first binding site targets VEGF and the second binding site targets PDGF.
  • the first binding site targets PDGF and the second binding site targets VEGF.
  • an Fc domain is present on one polypeptide chain and absent on the other, or absent on both polypeptide chains.
  • the sequences of the first and second variable domains on each polypeptide chain are independently selected from the sequences in Table A, 27- 30, 38-42, 46-50, or 56-58 to form functional binding sites.
  • the sequences of the first and second variable domains each contain the three complementarity determining regions (i.e., CDRs 1-3) from the selected sequences listed in Tables A, 27-30, 38-42, 46-50, or 56-58, and are arranged in the same order as shown in the Tables, thereby forming functional binding sites (i.e., the binding domains are capable of binding to their target antigen, VEGF or PDGF).
  • the paired variable domain sequences on the first and second polypeptide chains form functional binding sites for binding targets VEGF and/or PDGF using the sequences in the Tables.
  • the binding proteins are capable of binding to VEGF and/or PDGF with improved binding affinity and/or neutralization potency, improved in vivo efficacy, improved expression, and/or improved drug-like properties (e.g., thermal stability, storage stability, solubility, etc.).
  • AMD age-related macular degeneration
  • AMD age-related macular degeneration
  • AMD age-related macular degeneration
  • AMD age-related macular degeneration
  • diabetic retinopathy other angiogenesis-dependent diseases
  • angiogenesis-independent diseases characterized by aberrant VEGF and/or PDGF expression or activity.
  • Fig.1A and Fig.1B are schematic representations of a Dual Variable Domain (DVD) binding protein construct.
  • Fig.2A and Fig.2B show the reactivity of anti-PDGF-BB antibodies and anti- VEGF-A/anti-PDGF-BB DVD-Ig molecules to ECM-associated PDGF-BB.
  • Fig.3 illustrates the inhibition of sprouting from a HUVEC/MSC co-culture sprouting assay by anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules.
  • Fig.4 is a bar graph showing the area of subretinal neovascularization in Rho/huVEGF transgenic mice.
  • Fig.5 is a bar graph showing the area of choroidal neovascularization in Rho/huVEGF transgenic mice.
  • Fig.6 is a bar graph comparing choroidal neovascularization in the untreated eye among the different treatment groups.
  • Fig.7 is a bar graph showing number of partial, total, and undetached eyes in Tet/opsin/VEGF mice.
  • VEGF Vascular endothelial growth factor
  • PEF placenta growth factor
  • VEGF-B vascular endothelial growth factor
  • VEGF-C vascular endothelial growth factor
  • VEGF-D vascular endothelial growth factor
  • VEGF receptor-1 VGF receptor-1
  • VEGFR2 VEGF receptor-2
  • HIF hypoxia-inducible factor
  • the binding proteins disclosed herein can bind one or more of the VEGF family members, including alternate isoforms, and/or can bind one or more of the cognate VEGF receptors.
  • Platelet-derived growth factor is a protein that stimulates growth, survival, and motility of mesenchymal cells and certain other cell types. It has significant functions during embryonal development and in the control of blood vessel formation as an adult. PDGF is composed of a dimeric glycoprotein made up of two A (-AA), two B (-BB) chains, or a combination of the two (-AB). There are five different isoforms of PDGF that moderate cellular responses through two receptors, alpha (PDGFRA) and beta (PDGFRB) (Heldin (2013) Cell Commun. Sig.11:97). PDGF plays an important role in driving the proliferation of
  • the binding proteins disclosed herein can bind one or more of the PDGF isoforms, and/or can bind one or more of the cognate PDGF receptors.
  • binding proteins capable of binding one or more of VEGF, PDGF, and their cognate receptors.
  • the binding protein is an antibody or an antigen-binding fragment thereof.
  • the binding protein is an antibody, a monoclonal antibody, a murine antibody, a human antibody, a humanized antibody, a bispecific antibody, a chimeric antibody, a Fab, a Fab′, a F(ab′) 2 , an ScFv, an SMIP, an affibody, an avimer, a versabody, a nanobody, a fynomab, a domain antibody, or an antigen binding fragment of any of the foregoing.
  • the binding protein comprises antibody heavy chain variable domain sequences and antibody light chain variable domain sequences that are capable of binding one or more of VEGF, PDGF, and their cognate receptors.
  • the binding protein comprises the paired heavy and light chain variable domain sequences of any of the binding sites disclosed in Tables 27-30, 38-42, 46-50, or the CDR sequences from those variable domains. The CDR sequences of the variable domains in the Tables are identified in bold.
  • the binding proteins disclosed herein is bispecific or multispecific.
  • the bispecific or multispecific construct may be monovalent or bivalent.
  • Various bispecific or multispecific constructs are known in the art (see e.g., Spiess et al. (2015) Mol. Immunol.67; 95-106).
  • Bispecific or multispecific constructs include, but are not limited to, an asymmetric bispecific antibody, an asymmetric bispecific IgG4, a CrossMab binding protein, a bispecific antibody, a bispecific binding protein, a multispecific binding protein, a DAF (dual action Fab antibody; two-in-one), a DAF (dual action Fab antibody; four-in-one), a DutaMab, a DT-IgG, a knobs-in-holes binding protein, a Charge pair binding protein, a Fab-arm exchange binding protein, a SEEDbody, a Triomab (Triomab quadroma bispecific or removab bispecific), a LUZ-Y, a Fcab, a ⁇ -body, an iMab (innovative multimer), and an Orthogonal Fab.
  • asymmetric bispecific antibody an asymmetric bispecific IgG4, a CrossMab binding protein
  • a bispecific antibody a
  • the bispecific or multispecific construct is a DVD-Ig binding protein, an IgG(H)- scFv, an scFv-(H)IgG, an IgG(L)-scFv, an scFv-(L)IgG, an IgG(L, H)-Fv, an IgG(H)-V, a V(H)- IgG, an IgG(L)-V, a V(L)-IgG, a KIH IgG-scFab, a 2scFv-IgG, an IgG-2scFv, an scFv4-Ig, a Zybody, or a DVI-IgG (four-in-one).
  • the bispecific or multispecific construct also can be a nanobody (or VHH), a bispecific tandem nanobody, a bispecific trivalent tandem nanobody, a nanobody-HSA, a BiTE (bispecific T-cell engager) binding protein, a Diabody, a DART (dual affinity retargeting) binding protein, a TandAb (tetravalent bispecifc tandem antibody), an scDiabody, an scDiabody-CH3, a Diabody-CH3, a Triple Body, a nanobody (or VHH), a bispecific tandem nanobody, a bispecific trivalent tandem nanobody, a nanobody-HSA, a BiTE (bispecific T-cell engager) binding protein, a Diabody, a DART (dual affinity retargeting) binding protein, a TandAb (tetravalent bispecifc tandem antibody), an scDiabody, an scDiabody-CH3, a Diabody-CH3, a Triple Body, a nanobody (or VHH
  • Miniantibody a Minibody, a TriBi minibody, an scFv-CH3 KIH, a Fab-scFv, an scFv-CH-CL- scFv, a F(ab’)2, a F(ab’)2 scFv2, an scFv-KIH, a Fab-scFv-Fc, a Tetravalent HCAb, an scDiabody-Fc, a Diabody-Fc, a Tandem scFv-Fc, a Fabsc, a bsFc-1/2, a CODV-Ig (cross-over dual variable immunoglobulin), a biclonics antibody or an Intrabody.
  • Bispecific or multispecific constructs also include, for example, a Dock and Lock binding protein, an ImmTAC, an ImmTAC, an ImmTAC, an ImmTAC, an ImmTAC, an ImmTAC, an Imm
  • the bispecific or multispecific construct is a DVD-Ig binding protein, a CrossMab binding protein, a diabody, a tandem single-chain Fv molecule, a bispecific diabody, a single-chain diabody molecule, or a di-diabody.
  • the binding protein is a DVD-Ig binding protein. See, e.g., US Patent No.
  • the bispecific or multispecific construct may comprise one or more binding sites for VEGF, PDGF, and/or their receptors.
  • the bispecific or multispecific construct may comprise binding sites only for VEGF, PDGF, and/or their receptors, or may comprise additional binding sites for other antigen targets.
  • the bispecific or multispecific construct may comprise binding sites for more than one epitope on VEGF, PDGF, and/or their receptors, e.g., using different CDR sets or variable domains from those disclosed herein to form binding sites targeting different epitopes.
  • the binding protein is capable of binding VEGF, and comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO: 34, CDRs 1-3 from
  • the binding protein is capable of binding VEGF, and comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44.
  • Any of said binding proteins capable of binding VEGF may also be capable of binding PDGF, and may comprise any of the PDGF binding sequences as described herein.
  • the binding protein is capable of binding PDGF, and comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs 1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs 1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs 1-3 from SEQ ID NO: 8, CDRs 1- 3 from SEQ ID NO: 9 and CDRs 1-3 from SEQ ID NO: 10, CDRs 1-3 from SEQ ID NO: 11 and CDRs 1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs 1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs 1-3 from SEQ ID NO: 212.
  • the binding protein is capable of binding PDGF, and comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, or SEQ ID NO: 211 and SEQ ID NO: 212.
  • Any of said binding proteins capable of binding PDGF may also be capable of binding VEGF, and may comprise any of the VEGF binding sequences as described herein.
  • the binding protein is a bispecific or multispecific antibody capable of binding one or more of VEGF, PDGF, and their cognate receptors, or another multispecific construct capable of binding the targets.
  • the treatment is with bispecific antibodies that have been produced by quadroma technology (Milstein and Cuello (1983) Nature 305(5934): 537-40), by chemical conjugation of two different monoclonal antibodies (Staerz et al. (1985) Nature 314(6012): 628-31), or by knob-into-hole or similar approaches which introduces mutations in the Fc region (Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90(14): 6444-6448).
  • the multispecific binding protein is a dual variable domain immunoglobulin (DVD-Ig), e.g., as disclosed in U.S. Patent No.7,612,181 (incorporated herein by reference in their entirety).
  • DVD-Ig binding protein comprises one or more binding sites comprising the paired heavy and light chain variable domain sequences of any of the binding sites disclosed in Tables 27-30, 38-42, 46-50, or 56-58, or the CDR sequences from those variable domains.
  • a binding site for VEGF can comprise a paired set of heavy and light chain variable domain sequences from any one of Tables 27 or 38-42, or the CDR regions from those sequences, while the PDGF can comprise the paired heavy and light chain variable domain sequences in Tables 28 or 46-50, or the CDR regions from those sequences.
  • the CDR regions of some of these sequences are shown in Table A and in Table 57.
  • a multispecific binding protein disclosed herein is capable of binding VEGF and PDGF, and allows for fewer injections or a lower concentration of active agent, as compared to combination antibody therapy.
  • the DVD-Ig binding protein comprises first and second polypeptide chains, each independently comprising VD1-(X1)n-VD2-C-X2, wherein: VD1 is a first variable domain; VD2 is a second variable domain; C is a constant domain; X1 is a linker; X2 is an Fc region that is either present or absent; n is independently 0 or 1 on the first and second chains, and wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site.
  • the binding protein is capable of binding one or more of VEGF, PDGF, and their cognate receptors, e.g., using a paired set of sequences from any one of Tables 27-30, 38-42, 46-50, or 56-58.
  • the binding protein comprises VD1 sequences on the first and second polypeptide chains (i.e., a VD1 sequence on the first chain paired with a VD1 sequence on the second chain) that together form a binding domain capable of binding a target selected from VEGF, PDGF, and their cognate receptors.
  • the binding protein is capable of binding VEGF at both the VD1 and VD2 positions.
  • the binding protein is capable of binding PDGF at both the VD1 and VD2 positions. In some embodiments, the binding protein is capable of binding VEGF at the VD1 position and PDGF at the VD2 position. In some embodiments, the binding protein is capable of binding PDGF at the VD1 position and VEGF at the VD2 position.
  • a binding protein comprises the CDRs from a sequence selected from any one of Tables 27-30, 38-42, 46-50, or 56-58
  • the CDRs are arranged in the order specified by the sequence in the Table and separated by suitable framework sequences to form a functional binding site.
  • the paired sequences selected from the Tables that form a functional binding site for a target e.g., a binding site for VEGF and/or PDGF
  • the CDRs from those sequences may be placed in either the VD1 or VD2 positions on the first and second polypeptide chains to form a binding site at either the VD1 or VD2 domain.
  • the binding proteins disclosed herein comprise VD1 and VD2 binding domains that are capable of binding to first and second target antigens.
  • a VD1 domain or a VD2 domain, or a VD1 position or VD2 position may refer to either the variable domain sequence on one polypeptide chain (e.g., a VD1 heavy chain sequence) or to the variable domain sequences on both the first and second polypeptide chain (e.g., a VD1 heavy chain sequence and a VD1 light chain sequence) that together form the functional binding site, as indicated by the context in which it is discussed.
  • a DVD-Ig binding protein can comprise two first and two second polypeptide chains forming four functional binding sites on two arms of the construct.
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO:
  • the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44.
  • a DVD-Ig binding protein is disclosed that is capable of binding VEGF and PDGF, wherein the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs 1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs 1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs 1-3 from SEQ ID NO: 8, CDRs 1-3 from SEQ ID NO: 9 and CDRs 1-3 from SEQ ID NO: 10, CDRs 1-3 from SEQ ID NO: 11 and CDRs 1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs 1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211
  • the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, or SEQ ID NO: 211 and SEQ ID NO: 212.
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO:
  • the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44; and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO:
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
  • the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the binding site for VEGF may be the outer binding domain or VD1 position as described herein, and the binding site for PDGF may be the inner domain or VD2 position as described herein.
  • any of the DVD-Ig binding proteins disclosed herein can comprise one or more of the X1 linkers shown in Table 55.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker.
  • the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker.
  • any of the antibodies, binding proteins, or DVD-Ig binding proteins disclosed herein can comprise a human IgG (e.g., an IgG1) heavy chain constant region on the first polypeptide chain comprising substitutions of leucines at positions 234 and 235 with alanines, and optionally also (or alternatively) a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering.
  • the antibody, binding protein, or DVD-Ig binding protein can also comprise a human kappa or lambda light chain constant region on the second polypeptide chain.
  • the light chain comprises a wild-type human kappa light chain constant region sequence.
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, and comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132).
  • the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
  • the binding protein comprises an IgG1 constant region with substitution of leucines at positions 234 and 235 with alanines, and a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
  • the L234A, L235A, and H435 mutations are present in a DVD-Ig binding protein comprising PR-1610561 (comprising SEQ ID NOs: 131 and 132).
  • the binding protein carrying the constant region mutations has increased ocular duration over an antibody, but is rapidly cleared from systemic circulation (e.g., by altering FcRn recognition), as compared to an antibody or as compared to the same binding protein lacking the constant region mutations.
  • the high ocular duration allows for less frequent administration and/or fewer overall injections while achieving a comparable or improved efficacy as compared to administration of a combination of anti-VEGF and anti-PDGF antibodies or as compared to administration of the binding protein lacking the constant region mutations.
  • the binding protein carrying the constant region mutations has decreased ADCC and CDC effector functions mediated by binding to extracellular matrix-associated VEGF-A and/or PDGF-BB, as compared to administration of the binding protein lacking the constant region mutations.
  • the binding protein carrying the constant region mutations does not bind to one or more Fc-gamma receptors.
  • systemic levels of the binding protein in a patient drops below detectable levels after less than 20, 25, 30, 35, or 40 hours following administration at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mg/kg, or more (or any concentration in between) in an intravenous bolus dose.
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2.
  • the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2.
  • the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
  • the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the binding site for VEGF may be the outer binding domain or VD1 sequence as described herein, and the binding site for PDGF may be the inner domain or VD2 sequence as dscribed herein.
  • the binding proteins can comprise one or more of the X1 linkers shown in Table 55.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker.
  • the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker.
  • the binding protein is capable of binding VEGF and PDGF, and comprises PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
  • the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
  • the DVD-Ig binding protein comprises the first and second polypeptide chains of any of the DVD-Ig binding proteins disclosed in Tables 56-58.
  • the CDR sequences of the variable domains in Tables 56-58 are in bold and the linker sequences are italicized.
  • the DVD-Ig binding protein comprises the first and second polypeptide chains of PR-1563988 (comprising SEQ ID NOs: 45 and 46), PR-1563990
  • PR-1564009 (comprising SEQ ID NOs: 51 and 52), PR-1564010 (comprising SEQ ID NOs: 53 and 54), PR-1564011 (comprising SEQ ID NOs: 55 and 56), PR-1564012 (comprising SEQ ID NOs: 57 and 58), PR-1564013 (comprising SEQ ID NOs: 59 and 60), PR-1565031 (comprising SEQ ID NOs: 76 and 77), PR-1565032 (comprising SEQ ID NOs: 78 and 79), PR-1565035 (comprising SEQ ID NOs: 80 and 81), PR-1572102 (comprising SEQ ID NOs: 88 and 89), PR-1572103 (comprising SEQ ID NOs: 90 and 91), PR-1572104 (comprising SEQ ID NOs: 92 and
  • a binding protein including a DVD-Ig binding protein, antibody, or fragment thereof, is capable of binding VEGF and/or PDGF and has at least about 80%, 90%, 95%, or 99% homology to CDRs 1-3 or to the full variable domains of any of the sequences in Tables 27, 28, 38-42, or 46-50.
  • percent (%) homology defines the percentage of residues in the amino acid sequence variant that are identical after aligning the sequences and introducing gaps and other spacing, e.g., using the BLAST alignment software.
  • the binding protein has an on rate constant (K on ) to one or more targets of at least about 10 2 M -1 s -1 ; at least about 10 3 M -1 s -1 ; at least about 10 4 M -1 s -1 ; at least about 10 5 M -1 s -1 ; or at least about 10 6 M -1 s -1 , as measured by surface plasmon resonance.
  • K on on rate constant
  • the binding protein has an on rate constant (K on ) to one or more targets from about 10 2 M -1 s -1 to about 10 3 M -1 s -1 ; from about 10 3 M -1 s -1 to about 10 4 M -1 s -1 ; from about 10 4 M -1 s -1 to about 10 5 M -1 s -1 ; or from about 10 5 M -1 s -1 to about 10 6 M -1 s -1 , as measured by surface plasmon resonance.
  • K on on rate constant
  • the binding protein has an off rate constant (K off ) for one or more targets of at most about 10 -3 s -1 ; at most about 10 -4 s -1 ; at most about 10 -5 s -1 ; or at most about 10 -6 s -1 , as measured by surface plasmon resonance.
  • the binding protein has an off rate constant (K off ) to one or more targets of about 10 -3 s -1 to about 10 -4 s -1 ; of about 10 -4 s -1 to about 10 -5 s -1 ; or of about 10 -5 s -1 to about 10 -6 s -1 , as measured by surface plasmon resonance.
  • the binding protein has a dissociation constant (K d ) to one or more targets of at most about 10 -7 M; at most about 10 -8 M; at most about 10 -9 M; at most about 10 -10 M; at most about 10 -11 M; at most about 10 -12 M; or at most 10 -13 M.
  • the binding protein has a dissociation constant (K d ) to its targets of about 10 -7 M to about 10 -8 M; of about 10 -8 M to about 10 -9 M; of about 10 -9 M to about 10 -10 M; of about 10 -10 M to about 10 -11 M; of about 10 -11 M to about 10 -12 M; or of about 10 -12 to M about 10 -13 M.
  • the binding protein is a conjugate further comprising an agent.
  • the agent is an immunoadhesion molecule, an imaging agent, a therapeutic agent, or a cytotoxic agent.
  • the imaging agent is a radiolabel, an enzyme, a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, or biotin.
  • the radiolabel is 3 H 14
  • the therapeutic or cytotoxic agent is an anti-metabolite, an alkylating agent, an antibiotic, a growth factor, a cytokine, an anti-angiogenic agent, an anti- mitotic agent, an anthracycline, toxin, or an apoptotic agent, or an immunosuppressive agent.
  • the binding protein is a crystallized binding protein and exists as a crystal.
  • the crystal is a carrier-free pharmaceutical controlled release crystal.
  • the crystallized binding protein has a greater half-life in vivo than the soluble counterpart of the binding protein.
  • the crystallized binding protein retains biological activity.
  • a binding protein disclosed herein can compete for binding to VEGF, PDGF, and/or a cognate receptor with any of the antibodies, binding proteins, or bispecific antibodies disclosed herein.
  • a binding protein disclosed herein can compete for binding with an antibody, binding protein, or bispecific antibody comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50.
  • a binding protein disclosed herein can compete for binding with PR-1610561 (comprising SEQ ID NOs: 131 and 132) or a binding protein comprising the CDRs and/or variable domains of PR-1610561.
  • a binding protein disclosed herein can compete for binding with PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
  • a binding protein disclosed herein can bind to the same epitope of VEGF, PDGF, and/or a cognate receptor as any of the antibodies, binding proteins, or bispecific antibodies disclosed herein.
  • a binding protein disclosed herein can bind to the same epitope of VEGF, PDGF, and/or a cognate receptor bound by an antibody, binding protein, or bispecific antibody comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50.
  • a binding protein disclosed herein can bind to the same epitope as PR-1610561 (comprising SEQ ID NOs: 131 and 132) or a binding protein comprising the CDRs and/or variable domains of PR- 1610561.
  • a binding protein disclosed herein binds to the same epitope as PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
  • competitive binding can be evaluated using a cross- blocking assay, such as the assay described in ANTIBODIES, A LABORATORY MANUAL, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1 st edition 1988, 2 nd edition 2014).
  • a cross- blocking assay such as the assay described in ANTIBODIES, A LABORATORY MANUAL, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1 st edition 1988, 2 nd edition 2014).
  • competitive binding is identified when a test antibody or binding protein reduces binding of a reference antibody or binding protein (e.g., a binding protein comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50) to VEGF, PDGF, and/or a cognate receptor by at least about 50% in the cross-blocking assay (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.5%, or more, or any percentage in between), and/or vice versa.
  • a reference antibody or binding protein e.g., a binding protein comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50
  • competitive binding can be used to sort groups of binding proteins that share similar epitopes, e.g., those that compete for binding can be“binned” as a group of binding proteins that have overlapping or nearby epitopes, while those that do not compete are placed in a separate group of binding proteins that do not have overlapping or nearby epitopes
  • the binding protein described herein is glycosylated.
  • the glycosylation pattern may be a human glycosylation pattern.
  • a pharmaceutical composition comprising a binding protein disclosed herein and a pharmaceutically acceptable carrier is provided.
  • the pharmaceutical composition comprises at least one additional agent such as a therapeutic agent for treating a disorder or a diagnostic agent.
  • the additional agent may be a therapeutic agent, an imaging agent, a cytotoxic agent, an angiogenesis inhibitor (including but not limited to an anti-VEGF antibody or a VEGF-trap), a kinase inhibitor (including but not limited to a KDR and a TIE-2 inhibitor), a co-stimulation molecule blocker (including but not limited to anti-B7.1, anti-B7.2, CTLA4-Ig, anti-CD20), an adhesion molecule blocker (including but not limited to an anti-LFA-1 antibody, an anti-E/L selectin antibody, a small molecule inhibitor), an anti-cytokine antibody or functional fragment thereof (including but not limited to an anti-IL-18, an anti-TNF, and an anti-IL-6/cytokine receptor antibody), methotrexate, cyclosporin, rapamycin, FK506, a detectable label or reporter, a TNF antagonist, an antirheumatic, a muscle relaxant, a narcotic, a non-
  • a binding protein disclosed herein binds to VEGF and comprises CDRs and/or variable domains selected from those identified in Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding protein comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding protein comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding protein is a bispecific or multispecific binding protein, comprising CDRs and/or variable domains selected from Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding protein may further comprise heavy and light chain constant domains selected from Table 3.
  • the binding protein is also capable of binding to PDGF.
  • a binding protein disclosed herein binds to PDGF and comprises CDRs and/or variable domains selected from those identified in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding protein comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding protein comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding protein is a bispecific or multispecific binding protein, comprising CDRs and/or variable domains selected from Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding protein may further comprise heavy and light chain constant domains selected from Table 3.
  • the binding protein is also capable of binding to VEGF.
  • a binding protein disclosed herein binds to VEGF and PDGF, wherein the binding site for VEGF comprises CDRs and/or variable domains selected from those identified in Tables A, 2.4.1-2.4.9, 27, and 38-42 and the binding site for PDGF comprises CDRs and/or variable domains selected from those identified in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding sites for VEGF and PDGF comprises CDRs and/or variable domains selected from any of the variable domains listed in Tables 56-59, 95, and 96.
  • binding proteins disclosed herein comprise binding sites for VEGF and PDGF comprising the paired CDRs and/or variable domains from any one of the bispecific binding proteins selected from Tables 56-59, 95, and 96.
  • the binding proteins are DVD-Ig binding proteins, or any of the other bispecific or multispecific formats disclosed herein.
  • the binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55.
  • the binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
  • a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36
  • the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1- 1.4.7, 28, and 46-50.
  • the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40
  • the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36
  • the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40
  • the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50.
  • the binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55.
  • the binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
  • a binding protein is capable of binding VEGF and PDGF, wherein the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs- 1-3 from SEQ ID NO: 2, and the binding site for VEGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16, and the binding site for VEGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1- 2.4.9, 27, and 38-42.
  • the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2
  • the binding site for VEGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16
  • the binding site for VEGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42.
  • the binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55.
  • the binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
  • a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2.
  • the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36
  • the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
  • the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1- 3 from SEQ ID NO: 40
  • the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
  • the binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55.
  • the binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
  • a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2.
  • the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55.
  • the binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
  • the binding protein is a DVD-Ig binding protein, capable of binding VEGF and PDGF.
  • the heavy chain of the binding protein comprises a DVD-Ig heavy chain variable domain and paired DVD-Ig light chain variable domain selected from Tables 56-59, 95, and 96.
  • the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 131 and SEQ ID NO: 132.
  • the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 88 and SEQ ID NO: 89.
  • the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 94 and SEQ ID NO: 95.
  • the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 141 and SEQ ID NO: 142.
  • the DVD-Ig binding protein described herein may further comprise heavy and light chain constant domains selected from Table 3.
  • a binding protein disclosed herein is a DVD-Ig binding protein, comprising first and second polypeptide chains of SEQ ID NO: 131 and SEQ ID NO: 132.
  • the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 88 and SEQ ID NO: 89.
  • the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 94 and SEQ ID NO: 95.
  • the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 141 and SEQ ID NO: 142.
  • binding protein for use as a human therapeutic agent, e.g., as an anti-inflammatory agent or oncologic agent, may require more than the identification of a binding protein capable of binding to a desired target or targets.
  • the binding proteins disclosed herein exhibit favorable properties in one or more of the following categories (a) the binding kinetics (on-rate, off-rate and affinity) for both the inner and outer antigen-binding domains, (b) potencies in various biochemical and cellular bioassays, (c) in vivo efficacies in relevant tumor models, (d) pharmacokinetic and pharmacodynamics properties, (e) manufacturability, including protein expression level in selected cell lines, scalability, post- translational modification, physicochemical properties such as monomer percentage, solubility, and stability (intrinsic, freeze/thaw, storage stability, etc.), (f) formulation properties, (g) potential immunogenicity risk, (h) toxicological properties, and (i) binding mode and
  • binding proteins disclosed herein exhibit favorable properties in some or each of the categories listed above, including surprisingly high binding affinity at both the VD1 and VD2 positions.
  • a binding protein or binding proteins disclosed herein targeting VEGF and PDGF serve to both reduce choroidal neovascularization and increase regression of mature vasculature, e.g., in ocular conditions such as AMD.
  • a binding protein or binding proteins disclosed herein targeting VEGF and PDGF neutralize VEGF and PDGF simultaneously.
  • the binding protein exhibits one or more of high potency to VEGF and/or PDGF, extended ocular duration, and rapid clearance from systemic circulation.
  • the binding protein is a bispecific and allows for a single injection of an agent to both targets (VEGF and PDGDF), reducing injection
  • the disclosed binding protein exhibits superior in vivo efficacy (e.g., in a preclinical model of choroidal neovascularization or AMD) as compared to existing treatments for AMD (e.g., ElyeaTM and/or LucentisTM).
  • the disclosed binding protein is a DVD-Ig binding protein and exhibits a high ocular duration.
  • the DVD-Ig binding protein may be, e.g., 150-200 kDa in weight or greater, and may provide for a longer ocular duration as compared to lower weight agents such as monoclonal antibodies.
  • the binding protein disclosed herein is a DVD-Ig binding protein and has an ocular half life of at least about 4 days, or at least about 4.6 days, or at least about 5 days, or at least about 6 days, or at least about 6.5 days, or more.
  • the DVD-Ig ocular half life is greater than the half-life of an antibody or other construct having a smaller size, while retaining a more rapid systemic clearance similar to that of the antibody.
  • the DVD-Ig binding protein has an ocular half life of at least about 4 (or at least about 4.6) days after intravitreoius administration at 0.25 mg.
  • the disclosed binding proteins are DVD-Ig binding proteins and exhibit improved drug-like properties, including one or more of high theromstability (e.g., a T onset of greater than 50°, 55°, 60°, 61°, 62°, 63°, 64°, or 65° C), a solubility of at least about 70, 72, 74, 76, 78, or 80 mg/ml, a viscosity at room temperature and at a concentration of 100 mg/ml of about 7.2 centipoise, an effective storage stability in a universal buffer, and/or high freeze-thaw stability.
  • high theromstability e.g., a T onset of greater than 50°, 55°, 60°, 61°, 62°, 63°, 64°, or 65° C
  • solubility of at least about 70, 72, 74, 76, 78, or 80 mg/ml
  • the DVD-Ig binding protein does not exhibit a significant change in monomer percentage at low concentration after storage at 5°C or 40°C for 10, 15, 20, 21, 22, 23, 24, 25, or more days, and/or does not exhibit a significant increase in aggregation at 50-150 mg/ml (or 100 +/-10 mg/ml) after 1, 2, 3, 4, 5, or more freeze/thaw cycles.
  • a binding protein exhibiting particularly favorable properties in some or each of the categories listed above is a DVD-Ig binding protein capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
  • the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36
  • the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the binding protein is capable of binding VEGF and PDGF, and comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132).
  • the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence
  • a binding protein exhibiting particularly favorable properties in some or each of the categories listed above is a DVD-Ig binding protein capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs-1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2.
  • the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2.
  • the binding protein is capable of binding VEGF and PDGF, and comprises PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR- 1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
  • the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
  • the binding protein disclosed herein may exhibit one or more of the following features: enhanced in vivo efficacy in human VEGF transgenic mice, enhanced potency (as measured, e.g., via BIACORE, ELISA, or co-culture sprouting assay), improved expression (e.g., in HEK293 or CHO cells), and improved drug-like properties (e.g., thermal stability, storage stability, solubility, physicochemical properties, and/or pharmacokinetics) as compared to another binding protein or combination of binding proteins targeting VEGF and PDGF.
  • enhanced in vivo efficacy in human VEGF transgenic mice e.g., via BIACORE, ELISA, or co-culture sprouting assay
  • improved expression e.g., in HEK293 or CHO cells
  • drug-like properties e.g., thermal stability, storage stability, solubility, physicochemical properties, and/or pharmacokinetics
  • the disclosure provides a method of making a binding protein that binds PDGF, VEGF, and/or either or both cognate receptors.
  • the method of making a binding protein comprises the steps of a) obtaining a first parent antibody, or antigen binding portion thereof, that binds PDGF, VEGF, or a cognate receptor; b) obtaining a second parent antibody, or antigen binding portion thereof, that binds PDGF, VEGF, or a cognate receptor; c) determining the sequences of the variable domains of the parent antibodies or antigen binding portions thereof; d) preparing construct(s) encoding any of the binding proteins described herein using those variable domain sequences; and e) expressing the polypeptide chains, such that a binding protein that binds PDGF, VEGF, and/or either or both cognate receptors is generated.
  • the VD1 heavy chain variable domain, if present, and light chain variable domain, if present can be from a first parent antibody or antigen binding portion thereof; the VD2 heavy chain variable domain, if present, and light chain variable domain, if present, can be from a second parent antibody or antigen binding portion thereof.
  • the first and second parent antibodies can be the same or different.
  • the first parent antibody or antigen binding portion thereof binds a first antigen
  • the second parent antibody or antigen binding portion thereof binds a second antigen.
  • the first and second antigens are the same antigen.
  • the parent antibodies bind different epitopes on the same antigen.
  • the first and second antigens are different antigens.
  • the first parent antibody or antigen binding portion thereof binds the first antigen with a potency different from the potency with which the second parent antibody or antigen binding portion thereof, binds the second antigen.
  • the first parent antibody or antigen binding portion thereof binds the first antigen with an affinity different from the affinity with which the second parent antibody or antigen binding portion thereof, binds the second antigen.
  • the first parent antibody or antigen binding portion thereof, and the second parent antibody or antigen binding portion thereof are a human antibody, CDR grafted antibody, humanized antibody, and/or affinity matured antibody.
  • The“parent antibody”, which provides at least one antigen binding specificity of the multivalent and or multispecific binding protein, may be one that is internalized (and/or catabolized) by a cell expressing an antigen to which the antibody binds; and/or may be an agonist, cell death-inducing, and/or apoptosis-inducing antibody, and the multivalent and or multispecific binding protein as described herein may display improvement(s) in one or more of these properties.
  • the parent antibody may lack any one or more of these properties, but may acquire one or more of them when constructed as a multivalent binding protein as described herein.
  • different Fc mutants may prevent FcR, FcR-gamma, complement, or C’ binding, or extend half- life.
  • an isolated nucleic acid encoding any one of the binding proteins disclosed herein is also provided.
  • a composition comprising one or more nucleic acids wherein said one or more nucleic acids encode a nucleic acid encoding any one of the binding proteins disclosed herein.
  • the composition may comprise a nucleic acid that encodes a first polypeptide and a nucleic acid that encodes a second polypeptide, wherein said first and second polypeptide together form a binding protein as described herein.
  • a further embodiment provides a vector (e.g., an expression vector) comprising the isolated nucleic acid disclosed herein.
  • a vector e.g.
  • an expression vector that comprises one or more nucleic acids that encode a binding protein as described herein.
  • a composition comprising one or more vectors that encode a binding protein as escribd herein.
  • the composition may comprise a vector that encodes a first polypeptide and a vector that encodes a second polypeptide, wherein said first and second polypeptide together form a binding protein as described herein.
  • the vector is pcDNA; pTT (Durocher et al. (2002) Nucleic Acids Res.30(2):e9; pTT3 (pTT with additional multiple cloning site;
  • the vector is a vector disclosed in U.S. Patent No.8,187,836.
  • a host cell is transformed with the vector disclosed herein.
  • the host cell is a prokaryotic cell, for example, E.coli.
  • the host cell is a eukaryotic cell, for example, a protist cell, an animal cell, a plant cell, or a fungal cell.
  • the host cell is a mammalian cell including, but not limited to, CHO, COS, NS0, SP2, PER.C6, or a fungal cell, such as Saccharomyces cerevisiae, or an insect cell, such as Sf9.
  • two or more binding proteins e.g., with different specificities, are produced in a single recombinant host cell.
  • OligoclonicsTM Manton B.V., The Netherlands
  • a binding proteins disclosed herein can be prepared by culturing any one of the host cells disclosed herein in a culture medium under conditions sufficient to produce the binding protein.
  • compositions for the release of a binding protein wherein the composition comprises a crystallized binding protein, an ingredient, and at least one polymeric carrier.
  • the polymeric carrier is poly (acrylic acid), a poly
  • cyanoacrylate a poly (amino acid), a poly (anhydride), a poly (depsipeptide), a poly (ester), poly (lactic acid), poly (lactic-co-glycolic acid) or PLGA, poly (b-hydroxybutryate), poly
  • caprolactone poly (dioxanone), poly (ethylene glycol), poly ((hydroxypropyl) methacrylamide, poly [(organo)phosphazene], a poly (ortho ester), poly (vinyl alcohol), poly (vinylpyrrolidone), a maleic anhydride- alkyl vinyl ether copolymer, a pluronic polyol, albumin, alginate, cellulose, a cellulose derivative, collagen, fibrin, gelatin, hyaluronic acid, an oligosaccharide, a
  • the ingredient is albumin, sucrose, trehalose, lactitol, gelatin, hydroxypropyl- ⁇ - cyclodextrin, methoxypolyethylene glycol, or polyethylene glycol.
  • the binding proteins provided herein may be produced by any of a number of techniques known in the art. For example, expression from host cells, wherein expression vector(s) encoding the DVD-Ig heavy and DVD-Ig light chains is (are) transfected into a host cell by standard techniques. Although it is possible to express the DVD-Ig binding proteins provided herein in either prokaryotic or eukaryotic host cells, DVD-Ig binding proteins are preferably expressed in eukaryotic cells, for example, mammalian host cells.
  • a recombinant expression vector encoding both the DVD-Ig heavy chain and the DVD-Ig light chain is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection.
  • the DVD-Ig heavy and light chain sequences are each operatively linked to CMV enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes.
  • the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
  • the selected transformant host cells are cultured to allow for expression of the DVD-Ig heavy and light chains and intact DVD-Ig protein is recovered from the culture medium.
  • Standard molecular biology techniques may be used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the DVD-Ig protein from the culture medium.
  • a method of synthesizing a DVD-Ig binding protein by culturing a host cell provided herein in a suitable culture medium until a DVD-Ig binding protein is synthesized is also provided. The method may further comprise isolating the DVD-Ig protein from the culture medium.
  • a feature of a DVD-Ig binding protein is that it can be produced and purified in a similar way to a conventional antibody.
  • the design of the full length DVD-Ig binding protein heavy and light chains provided herein leads to assemble primarily to the desired dual-specific multivalent full length binding proteins.
  • 50%-75% of the binding protein produced by this method is a dual specific tetravalent binding protein (e.g., a DVD-Ig binding protein).
  • 75%-90% of the binding protein produced by this method is a dual specific tetravalent binding protein.
  • 90%-95% of the binding protein produced is a dual specific tetravalent binding protein.
  • at least 50%, at least 75% and at least 90% of the assembled, and expressed dual variable domain immunoglobulin molecules are the desired dual-specific tetravalent protein.
  • the disclosure provides methods of expressing a dual variable domain light chain and a dual variable domain heavy chain in a single cell leading to a primary product of a dual-specific tetravalent full length binding protein, where the primary product is more than 50%, such as more than 75% and more than 90%, of all assembled protein, comprising a dual variable domain light chain and a dual variable domain heavy chain.
  • kits for diagnosing and treating a mammal comprising the step of administering to the mammal, or a sample taken from the mammal, an effective amount of a composition disclosed herein.
  • a binding protein as described herein may be used in a method for therapy or diagnosis.
  • the binding proteins provided herein can be used to detect one or more of those antigens (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), a radioimmunoassay (RIA), or tissue immunohistochemistry.
  • ELISA enzyme linked immunosorbent assays
  • RIA radioimmunoassay
  • tissue immunohistochemistry e.g., tissue immunohistochemistry.
  • the binding protein is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody. Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin.
  • An example of a luminescent material is luminol and examples of suitable radioactive materials include 3 H 14
  • a method for treating a human subject suffering from a disorder in which the target, or targets, capable of being bound by the binding proteins disclosed herein is/are detrimental, comprising administering to the human subject a binding protein disclosed herein such that the activity of the target, or targets, in the human subject is inhibited and one or more symptoms is alleviated or treatment is achieved is provided.
  • treatment comprises reducing, improving, or ameliorating one or more symptom of a disorder. Treatment includes but does not necessarily require curing (i.e., completely eliminating) a disorder or a symptom of a disorder.
  • the binding proteins provided herein can be used to treat humans suffering from diseases such as, for example, those associated with increased angiogenesis and/or inflammation (e.g., ocular inflammation).
  • the binding proteins provided herein or antigen-binding portions thereof are used to treat an autoimmune disorder, asthma, ocular inflammation, Crohn's disease, ulcerative colitis, inflammatory bowel disease (IBD), insulin dependent diabetes mellitus, rheumatoid arthritis, osteoarthritis, systemic lupus erythematosus (SLE), multiple sclerosis, sepsis, a neurodegenerative disease, or an oncological disorder.
  • IBD inflammatory bowel disease
  • SLE systemic lupus erythematosus
  • a binding protein disclosed herein is used to treat an eye disorder (e.g., an angiogenic eye disorder).
  • the eye disorder is a macular degeneration, such as wet macular degeneration, dry macular degeneration, age related macular degeneration (AMD), exudative AMD, dry eye, glaucoma, diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, , iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal neovascularization, vitreal
  • PVR proliferative vitreoretinopathy
  • neovascularization pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, keratoconjunctivitis sicca, blepharitis, keratitis or another inflammatory disease of the eye.
  • DME diabetic macular edema
  • vascular retinopathy retinal degeneration
  • uveitis keratoconjunctivitis sicca
  • blepharitis keratitis or another inflammatory disease of the eye.
  • the binding proteins provided herein are capable of neutralizing the activity of their antigen targets both in vitro and in vivo. Accordingly, such binding proteins can be used to inhibit antigen activity, e.g., in a cell culture containing the antigens, in human subjects or in other mammalian subjects having the antigens with which a binding protein provided herein cross-reacts.
  • a method for reducing antigen activity in a subject suffering from a disease or disorder in which the antigen activity is detrimental is provided.
  • a binding protein provided herein may be administered to a human subject for therapeutic purposes.
  • the binding protein (e.g., the DVD-Ig binding protein) is administered to a patient, e.g., a patient suffering from wet AMD, and can have one or more effects selected from regressing mature vasculature (e.g., via VEGF binding), reducing choroidal neovascularization (e.g., via VEGF binding), allowing access to blood vessels by stripping off pericytes (e.g., via PDGF binding), and/or providing anti-fibrotic effects to reduce visual loss from scarring (e.g., via PDGF binding).
  • the binding protein is multispecific for VEGF and PDGF, and is administered at a reduced number of injections and/or a reduced injection frequency, as compared to a combination antibody therapy.
  • a disorder in which antigen activity is detrimental encompasses diseases and other disorders in which the presence of the antigen in a subject suffering from the disorder has been shown to be or is suspected of being either responsible for the pathophysiology of the disorder or a factor that contributes to a worsening of the disorder. Accordingly, a disorder in which antigen activity is detrimental is a disorder in which reduction of antigen activity is expected to alleviate the symptoms and/or progression of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of the antigen in a biological fluid of a subject suffering from the disorder (e.g., an increase in the concentration of antigen in serum, plasma, synovial fluid, etc., of the subject).
  • Binding proteins disclosed herein can be employed in some embodiments for tissue-specific delivery (target a tissue marker and a disease mediator for enhanced local PK thus higher efficacy and/or lower toxicity), including intracellular delivery (targeting an internalizing receptor and an intracellular molecule), delivering through a biological barrier, such as to the inside of the eye or brain (e.g., targeting transferrin receptor and a CNS disease mediator for crossing the blood-brain barrier).
  • tissue-specific delivery target a tissue marker and a disease mediator for enhanced local PK thus higher efficacy and/or lower toxicity
  • intracellular delivery targeting an internalizing receptor and an intracellular molecule
  • delivering through a biological barrier such as to the inside of the eye or brain (e.g., targeting transferrin receptor and a CNS disease mediator for crossing the blood-brain barrier).
  • the binding proteins may also serve as carrier proteins to deliver an antigen to a specific location via binding to a non- neutralizing epitope of that antigen and also to increase the half-life of the antigen.
  • the binding protein may be designed to either be physically linked to medical devices implanted into patients or target these medical devices (see Burke et al. (2006) Advanced Drug Deliv. Rev. 58(3): 437-446; Hildebrand et al. (2006) Surface and Coatings Technol.200(22-23): 6318-6324; Drug/ device combinations for local drug therapies and infection prophylaxis, Wu (2006) Biomaterials 27(11):2450-2467; Mediation of the cytokine network in the implantation of orthopedic devices, Marques (2005) Biodegradable Systems in Tissue Engineer. Regen. Med. 377-397).
  • diseases that can be treated or diagnosed with the compositions and methods disclosed herein include, but are not limited to, primary and metastatic cancers, including carcinomas of breast, colon, rectum, lung, oropharynx, hypopharynx, esophagus, stomach, pancreas, liver, gallbladder and bile ducts, small intestine, urinary tract (including kidney, bladder and urothelium), female genital tract (including cervix, uterus, and ovaries as well as choriocarcinoma and gestational trophoblastic disease), male genital tract (including prostate, seminal vesicles, testes and germ cell tumors), endocrine glands (including the thyroid, adrenal, and pituitary glands), and skin, as well as hemangiomas, melanomas, sarcomas (including those arising from bone and soft tissues as well as Kaposi’s sarcoma), tumors of the brain,
  • Another embodiment provides for the use of the binding protein in the treatment of a disease or disorder, wherein the disorder is arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis
  • lymphohistiocytosis fetal thymus implant rejection, Friedreich's ataxia, functional peripheral arterial disorders, fungal sepsis, gas gangrene, gastric ulcer, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallerrorden-Spatz disease, hashimoto's thyroiditis, hay fever, heart transplant rejection, hemachromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic
  • thrombocytopenic purpura hemorrhage, hepatitis A, His bundle arryhthmias, HIV infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders, hypersensitity reactions, hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic- pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, Asthenia, infantile spinal muscular atrophy, inflammation of the aorta, influenza a, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia- reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema,
  • meningococcemia metabolic/idiopathic, migraine headache, mitochondrial multi.system disorder, mixed connective tissue disease, monoclonal gammopathy, multiple myeloma, multiple systems degenerations (Mencel Dejerine-Thomas Shy-Drager and Machado-Joseph), myasthenia gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodyplastic syndrome, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic I muscular atrophies , neutropenic fever, non- hodgkins lymphoma, occlusion of the abdominal aorta and its branches, occulsive arterial disorders, okt3 therapy, orchitis/epidydimitis, orchitis/vasectomy reversal procedures, organomegaly, osteopo
  • autoimmune myocarditis hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, ,vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital-associated hemaphagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still’s disease, anaphylaxis, anti-phospholipid antibody syndrome, aplastic anemia, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS
  • any one of the binding proteins disclosed herein can be used to treat a disorder listed above.
  • the binding protein used to treat any of the disorders discussed herein is one or more of the binding proteins listed in Tables 27-30, 38- 42, 46-50, or 55-58.
  • the binding protein used to treat any of the disorders discussed herein is one or more of the binding proteins listed in Tables 56-58.
  • the binding protein is PR-1572102, PR-1572105, PR-1610561, or PR1611292.
  • a binding protein may be used to treat wet AMD that is non-responsive to anti-VEGF monotherapy.
  • a binding protein targeting VEGF and PDGF e.g., PR-1572102, PR- 1572105, or PR-1610561
  • PR-1572102, PR- 1572105, or PR-1610561 may lead to better regression of angiogenesis, thereby providing for a more effective treatment (this does not necessarily mean, however, that such a binding protein would have a reduced administration frequency; whether that is the case is presently unknown).
  • the dual inhibition of both VEGF and PDGF may provide for certain improved treatment outcomes, as compared to anti-VEGF monotherapy.
  • the second agent is an imaging agent, cytotoxic agent, angiogenesis inhibitor, kinase inhibitor, co-stimulation molecule blocker, adhesion molecule blocker, anti-cytokine antibody or functional fragment thereof, methotrexate, cyclosporin, rapamycin, FK506, detectable label or reporter, TNF antagonist, antirheumatic, muscle relaxant, narcotic, non-steroid anti-inflammatory drug (NSAID), analgesic, anesthetic, sedative, local anesthetic, neuromuscular blocker, antimicrobial, antipsoriatic, corticosteriod, anabolic steroid, erythropoietin, immunization, immunoglobulin, immunosuppressive, growth hormone, hormone replacement drug,
  • NSAID non-steroid anti-inflammatory drug
  • radiopharmaceutical antidepressant, antipsychotic, stimulant, asthma medication, beta agonist, inhaled steroid, epinephrine or analog, cytokine, or cytokine antagonist.
  • an anti-idiotype antibody includes any protein or peptide- containing molecule that comprises at least a portion of an immunoglobulin molecule such as, but not limited to, at least one complementarily determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework region, or any portion thereof, that can be incorporated into a binding protein provided herein.
  • CDR complementarily determining region
  • the methods comprise assaying the test sample for the antigen, or fragment thereof, by an immunoassay.
  • the immunoassay (i) employs at least one binding protein and at least one detectable label and (ii) comprises comparing a signal generated by the detectable label as a direct or indirect indication of the presence, amount or concentration of the antigen, or fragment thereof, in the test sample to a signal generated as a direct or indirect indication of the presence, amount or concentration of the antigen, or fragment thereof, in a control or a calibrator.
  • the calibrator is optionally part of a series of calibrators in which each of the calibrators differs from the other calibrators in the series by the concentration of the antigen, or fragment thereof.
  • the method can comprise (i) contacting the test sample with at least one capture agent, which binds to an epitope on the antigen, or fragment thereof, so as to form a capture agent/antigen, or fragment thereof, complex, (ii) contacting the capture agent/antigen, or fragment thereof, complex with at least one detection agent, which comprises a detectable label and binds to an epitope on the antigen, or fragment thereof, that is not bound by the capture agent, to form a capture agent/antigen, or fragment thereof/detection agent complex, and (iii) determining the presence, amount or concentration of the antigen, or fragment thereof, in the test sample based on the signal generated by the detectable label in the capture agent/antigen, or fragment thereof/detection agent complex formed in (ii), wherein at least one capture agent and/or at least
  • the method may comprise (i) contacting the test sample with at least one capture agent, which binds to an epitope on the antigen, or fragment thereof, so as to form a capture agent/antigen, or fragment thereof, complex, and simultaneously or sequentially, in either order, contacting the test sample with detectably labeled antigen, or fragment thereof, which can compete with any antigen, or fragment thereof, in the test sample for binding to the at least one capture agent, wherein any antigen, or fragment thereof, present in the test sample and the detectably labeled antigen compete with each other to form a capture agent/antigen, or fragment thereof, complex and a capture agent/detectably labeled antigen, or fragment thereof, complex, respectively, and (ii) determining the presence, amount or concentration of the antigen, or fragment thereof, in the test sample based on the signal generated by the detectable label in the capture agent/detectably labeled antigen, or fragment thereof, complex formed in (ii), wherein at least one capture agent is the
  • the test sample is from a patient, in which case the method can further comprise diagnosing, prognosticating, or assessing the efficacy of therapeutic/prophylactic treatment of the patient. If the method further comprises assessing the efficacy of therapeutic/prophylactic treatment of the patient, the method optionally further comprises modifying the therapeutic/prophylactic treatment of the patient as needed to improve efficacy.
  • the method can be adapted for use in an automated system or a semi-automated system. Accordingly, the methods described herein also can be used to determine whether or not a subject has or is at risk of developing a given disease, disorder or condition.
  • such a method can comprise the steps of: (a) determining the concentration or amount in a test sample from a subject of analyte, or fragment thereof, (e.g., using the methods described herein, or methods known in the art); and (b) comparing the concentration or amount of analyte, or fragment thereof, determined in step (a) with a predetermined level, wherein, if the concentration or amount of analyte determined in step (a) is favorable with respect to a predetermined level, then the subject is determined not to have or be at risk for a given disease, disorder or condition. However, if the concentration or amount of analyte determined in step (a) is unfavorable with respect to the predetermined level, then the subject is determined to have or be at risk for a given disease, disorder or condition.
  • the method can comprise the steps of: (a) determining the concentration or amount in a test sample from a subject of analyte; (b) determining the concentration or amount in a later test sample from the subject of analyte; and (c) comparing the concentration or amount of analyte as determined in step (b) with the concentration or amount of analyte determined in step (a), wherein if the concentration or amount determined in step (b) is unchanged or is unfavorable when compared to the concentration or amount of analyte determined in step (a), then the disease in the subject is determined to have continued, progressed or worsened.
  • step (b) By comparison, if the concentration or amount of analyte as determined in step (b) is favorable when compared to the concentration or amount of analyte as determined in step (a), then the disease in the subject is determined to have discontinued, regressed or improved.
  • the method further comprises comparing the concentration or amount of analyte as determined in step (b), for example, with a predetermined level. Further, optionally the method comprises treating the subject with one or more pharmaceutical compositions for a period of time if the comparison shows that the concentration or amount of analyte as determined in step (b), for example, is unfavorably altered with respect to the predetermined level.
  • kits for assaying a test sample for VEGF and/or PDGF, or fragment thereof may comprise at least one component for assaying the test sample for an antigen, or fragment thereof, and instructions for assaying the test sample for an antigen, or fragment thereof, wherein the at least one component includes at least one composition comprising the binding protein disclosed herein, wherein the binding protein is optionally detectably labeled.
  • each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH).
  • VH heavy chain variable region
  • CH heavy chain constant region
  • each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
  • the CL is comprised of a single CL domain.
  • the VH and VL can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • CDR regions may be determined by standard methods, e.g., those of Kabat et al.
  • Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass.
  • type e.g., IgG, IgE, IgM, IgD, IgA and IgY
  • class e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2
  • subclass e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2
  • bispecific antibody refers to an antibody that binds one antigen (or epitope) on one of its two binding arms (one pair of HC/LC), and binds a different antigen (or epitope) on its second binding arm (a different pair of HC/LC).
  • a bispecific antibody is a type of bispecific binding protein.
  • a bispecific antibody may have two distinct antigen binding arms (in both specificity and CDR sequences), and may be monovalent for each antigen to which it binds.
  • Bispecific antibodies include those generated by quadroma technology (Milstein and Cuello (1983) Nature 305(5934): 537-40), by chemical conjugation of two different monoclonal antibodies (Staerz et al.
  • affinity matured refers to an antibody or binding protein with one or more alterations in one or more CDR or framework (FR) regions thereof, which may result in an improvement in the affinity for an antigen, compared to a parent antibody or binding protein which does not possess those alteration(s).
  • Exemplary affinity matured antibodies or binding protein will have nanomolar or even picomolar affinities for the target antigen.
  • Affinity matured antibodies or binding protein may be produced by procedures known in the art, e.g., Marks et al. (1992) BioTechnology 10:779-783 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by Barbas et al.
  • CDR-grafted refers to an antibody or binding protein that comprises heavy and light chain variable region sequences in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another antibody or binding protein.
  • the two antibodies or binding protein can be from different species, such as antibodies or binding protein having murine heavy and light chain variable regions in which one or more of the murine CDRs has been replaced with human CDR sequences.
  • the term“humanized” refers to an antibody or binding protein from a non- human species that has been altered to be more“human-like”, i.e., more similar to human germline sequences.
  • One type of humanized antibody or binding protein is a CDR-grafted antibody or binding protein, in which non-human CDR sequences are introduced into human VH and VL sequences to replace the corresponding human CDR sequences.
  • a humanized antibody or binding protein also encompasses a variant, derivative, analog or fragment of an antibody or binding protein that comprises framework region (FR) sequences having substantially (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identity to) the amino acid sequence of a human antibody and at least one CDR having substantially the amino acid sequence of a non-human antibody.
  • FR framework region
  • a humanized antibody or binding protein may comprise substantially all of at least one variable domain (Fab, Fab’, F(ab’) 2, FabC, Fv) in which the sequence of all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and the sequence of all or substantially all of the FR regions are those of a human immunoglobulin.
  • the humanized antibody or binding protein also may include the CH1, hinge, CH2, CH3, and/or CH4 regions of the heavy chain.
  • a humanized antibody or binding protein may also comprise at least a portion of a human immunoglobulin Fc region.
  • a humanized antibody or binding protein only contains a humanized light chain.
  • a humanized antibody or binding protein only contains a humanized heavy chain. In some embodiments, a humanized antibody or binding protein only contains a humanized variable domain of a light chain and/or humanized variable domain of a heavy chain. In some embodiments, a humanized antibody or binding protein contains a humanized light chain as well as at least a variable domain of a heavy chain. In some embodiments, a humanized antibody or binding protein contains a humanized heavy chain as well as at least a variable domain of a light chain.
  • anti-idiotypic antibody refers to an antibody raised against the amino acid sequence of the antigen combining site of another antibody. Anti-idiotypic antibodies may be administered to enhance an immune response against an antigen.
  • biological activity refers to any one or more biological properties of a molecule (whether present naturally as found in vivo, or provided or enabled by recombinant means). Biological properties include, but are not limited to, binding a receptor, inducing cell proliferation, inhibiting cell growth, inducing other cytokines, inducing apoptosis, and enzymatic activity.
  • neutralizing refers to counteracting the biological activity of an antigen when a binding protein specifically binds to the antigen.
  • a neutralizing binding protein binds to an antigen (e.g., VEGF and/or PDGF or their receptors) and reduces the antigen’s biological activity by at least about 20%, about 40%, about 60%, about 80%, about 85%, about 90%, about 95%, or about 100% (or any percentage in between).
  • an antigen e.g., VEGF and/or PDGF or their receptors
  • the term“specificity” refers to the ability of a binding protein to selectively bind an antigen.
  • binding protein refers to the strength of the interaction between a binding protein and an antigen, and is determined by the sequence of the CDRs of the binding protein as well as by the nature of the antigen, such as its size, shape, and/or charge. Binding proteins may be selected for affinities that provide desired therapeutic end-points while minimizing negative side-effects. Affinity may be measured using methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
  • Potency refers to the ability of a binding protein to achieve a desired effect, and is a measurement of its therapeutic efficacy. Potency may be assessed using methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No. 7,612,181).
  • cross-reactivity refers to the ability of a binding protein to bind a target other than that against which it was raised. Generally, a binding protein will bind its target tissue(s)/antigen(s) with an appropriately high affinity, but will display an appropriately low affinity for non-target normal tissues. Methods of assessing cross-reactivity are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
  • binding protein refers the specific in vitro or in vivo actions of a binding protein. Binding proteins may target several classes of antigens and achieve desired therapeutic outcomes through multiple mechanisms of action. Binding proteins may target soluble proteins, cell surface antigens, as well as extracellular protein deposits. Binding proteins may agonize, antagonize, or neutralize the activity of their targets. Binding proteins may assist in the clearance of the targets to which they bind, or may result in cytotoxicity when bound to cells. Portions of two or more antibodies may be incorporated into a multivalent format to achieve distinct functions in a single binding protein molecule.
  • A“stable” binding protein refers to one in which the binding protein retains some level of its physical stability, chemical stability and/or biological activity upon storage. Methods of stabilizing binding proteins and assessing their stability at various temperatures are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No. 7,612,181).
  • solubility refers to the ability of a protein to remain dispersed within an aqueous solution.
  • solubility of a protein in an aqueous formulation depends upon the proper distribution of hydrophobic and hydrophilic amino acid residues, and therefore, solubility can correlate with the production of correctly folded proteins.
  • a person skilled in the art will be able to detect an increase or decrease in solubility of a binding protein using routine HPLC techniques and methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.
  • Binding proteins may be produced using a variety of host cells or may be produced in vitro, and the relative yield per effort determines the“production efficiency.” Factors influencing production efficiency include, but are not limited to, host cell type (prokaryotic or eukaryotic), choice of expression vector, choice of nucleotide sequence, and methods employed. The materials and methods used in binding protein production, as well as the measurement of production efficiency, are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.
  • immunogenicity means the ability of a substance to induce an immune response.
  • Administration of a therapeutic binding protein may result in a certain incidence of an immune response.
  • Potential elements that might induce immunogenicity in a multivalent format may be analyzed during selection of the parental antibodies, and steps to reduce such risk can be taken to optimize the parental antibodies prior to incorporating their sequences into a multivalent binding protein format. Methods of reducing the immunogenicity of antibodies and binding proteins are known to one skilled in the art (U.S. Patent Appl. No.
  • label and“detectable label” refer to a moiety attached to a member of a specific binding pair, such as an antibody/binding protein or its analyte to render a reaction (e.g., binding) between the members of the specific binding pair, detectable.
  • the labeled member of the specific binding pair is referred to as“detectably labeled.”
  • the term“labeled binding protein” refers to a protein with a label incorporated that provides for the identification of the binding protein.
  • the label is a detectable marker that can produce a signal that is detectable by visual or instrumental means, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
  • marked avidin e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods.
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H 14 35
  • chromogens e.g., FITC, rhodamine, lanthanide phosphors
  • enzymatic labels e.g., horseradish peroxidase, luciferase, alkaline phosphatase
  • chemiluminescent markers include biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates.
  • a secondary reporter e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags
  • magnetic agents such as gadolinium chelates.
  • labels commonly employed for immunoassays include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein.
  • the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety.
  • conjugate refers to a binding protein that is chemically linked to a second chemical moiety, such as a therapeutic or cytotoxic agent.
  • agent includes a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials.
  • the therapeutic or cytotoxic agents include, but are not limited to, pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
  • the conjugate antibody may be a detectably labeled antibody used as the detection antibody.
  • crystals refer to a binding protein (e.g., an antibody), or antigen binding portion thereof, that exists in the form of a crystal.
  • Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field. The fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a“plasmid” refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • a viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • Other vectors include RNA vectors. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • Certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as“recombinant expression vectors” (or simply,“expression vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • “plasmid” and“vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
  • expression vectors are also included, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses), which serve equivalent functions.
  • viral vectors e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses
  • a group of pHybE vectors may be used for parental antibody and DVD-binding protein cloning.
  • V1, derived from pJP183; pHybE-hCg1,z,non-a V2; and pJP184, may be used for cloning of antibody and DVD heavy chains with a wild type constant region or modified constant region (e.g., a L234, L235, H435A modified IgG1 constant region).
  • V2 derived from pJP191 (with or without modifications to the Kozak site); pHybE-hCk V3, may be used for cloning of antibody and DVD light chains with a kappa constant region.
  • V4, built with a lambda signal peptide and a kappa constant region, may be used for cloning of DVD light chains with a lambda-kappa hybrid V domain.
  • V5 built with a kappa signal peptide and a lambda constant region, may be used for cloning of DVD light chains with a kappa-lambda hybrid V domain.
  • V7 derived from pJP183; pHybE-hCg1,z,non-a V2, may be used for cloning of antibody and DVD heavy chains with a (234,235 AA) mutant constant region.
  • host cells refer to a cell into which exogenous, e.g., recombinant, DNA has been introduced. Such terms refer not only to the particular subject cell, but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term“host cell” as used herein.
  • host cells include prokaryotic and eukaryotic cells.
  • eukaryotic cells include protist, fungal, plant and animal cells.
  • host cells include but are not limited to the prokaryotic cell line E.
  • transfection encompasses a variety of techniques commonly used for the introduction of exogenous nucleic acid (e.g., DNA) into a host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
  • cytokine refers to a protein released by one cell population that acts on another cell population as an intercellular mediator.
  • the term“cytokine” includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
  • biological sample refers to a quantity of a substance from a living thing or formerly living thing.
  • substances include, but are not limited to, blood, plasma, serum, urine, amniotic fluid, synovial fluid, endothelial cells, leukocytes, monocytes, other cells, organs, tissues, bone marrow, lymph nodes and spleen.
  • a component refers to an element of a composition.
  • a component may be a capture antibody, a detection or conjugate antibody, a control, a calibrator, a series of calibrators, a sensitivity panel, a container, a buffer, a diluent, a salt, an enzyme, a co-factor for an enzyme, a detection reagent, a pretreatment reagent/solution, a substrate (e.g., as a solution), a stop solution, and the like that can be included in a kit for assay of a test sample.
  • a“component” can include a polypeptide or other analyte as above, that is immobilized on a solid support, such as by binding to an anti-analyte (e.g., anti- polypeptide) antibody.
  • Some components can be in solution or lyophilized for reconstitution for use in an assay.
  • Control refers to a composition known to not analyte (“negative control”) or to contain analyte (“positive control”).
  • a positive control can comprise a known concentration of analyte.
  • A“positive control” can be used to establish assay performance characteristics and is a useful indicator of the integrity of reagents (e.g., analytes).
  • Predetermined cutoff and“predetermined level” refer generally to an assay cutoff value that is used to assess diagnostic/prognostic/therapeutic efficacy results by comparing the assay results against the predetermined cutoff/level, where the predetermined cutoff/level already has been linked or associated with various clinical parameters (e.g., severity of disease, progression/nonprogression/improvement, etc.). While the present disclosure may provide exemplary predetermined levels, it is well-known that cutoff values may vary depending on the nature of the immunoassay (e.g., antibodies employed, etc.). It further is well within the ordinary skill of one in the art to adapt the disclosure herein for other immunoassays to obtain
  • Pretreatment reagent e.g., lysis, precipitation and/or solubilization reagent, as used in a diagnostic assay as described herein refers to one that lyses any cells and/or solubilizes any analyte that is/are present in a test sample. Pretreatment is not necessary for all samples, as described further herein.
  • solubilizing the analyte may entail release of the analyte from any endogenous binding proteins present in the sample.
  • a pretreatment reagent may be homogeneous (not requiring a separation step) or heterogeneous (requiring a separation step). With use of a heterogeneous pretreatment reagent there is removal of any precipitated analyte binding proteins from the test sample prior to proceeding to the next step of the assay.
  • “Quality control reagents” in the context of immunoassays and kits described herein, include, but are not limited to, calibrators, controls, and sensitivity panels.
  • A“calibrator” or“standard” typically is used (e.g., one or more, such as a plurality) in order to establish calibration (standard) curves for interpolation of the concentration of an analyte, such as an antibody or an analyte.
  • a single calibrator which is near a predetermined positive/negative cutoff, can be used.
  • Multiple calibrators i.e., more than one calibrator or a varying amount of calibrator(s) can be used in conjunction so as to comprise a“sensitivity panel.”
  • specific binding partner refers to a member of a specific binding pair.
  • a specific binding pair comprises two different molecules that specifically bind to each other through chemical or physical means. Therefore, in addition to antigen and antibody specific binding, other specific binding pairs can include biotin and avidin (or streptavidin), carbohydrates and lectins, complementary nucleotide sequences, effector and receptor molecules, cofactors and enzymes, enzyme inhibitors and enzymes, and the like.
  • specific binding pairs can include members that are analogs of the original specific binding members, for example, an analyte-analog.
  • Immunoreactive specific binding members include antigens, antigen fragments, and antibodies, including monoclonal and polyclonal antibodies as well as complexes, fragments, and variants (including fragments of variants) thereof, whether isolated or recombinantly produced.
  • the term“Fc region” refers to the C-terminal region of an immunoglobulin heavy chain, which may be generated by papain digestion of an intact antibody or binding protein.
  • the Fc region may be a native sequence Fc region or a variant Fc region.
  • the Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain, and optionally comprises a CH4 domain. Replacements of amino acid residues in the Fc portion to alter effector function are known in the art (e.g., U.S. Patent Nos.5,648,260 and 5,624,821).
  • the Fc region mediates several important effector functions, e.g., cytokine induction, antibody dependent cell mediated cytotoxicity (ADCC), phagocytosis, complement dependent cytotoxicity (CDC), and half-life/ clearance rate of antibody or binding protein and antigen-antibody or antigen-binding protein complexes.
  • ADCC antibody dependent cell mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • half-life/ clearance rate of antibody or binding protein and antigen-antibody or antigen-binding protein complexes are desirable for a therapeutic immunoglobulin but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives.
  • the term“antigen-binding portion” of a binding protein refers to one or more fragments of a binding protein that retain the ability to specifically bind to an antigen.
  • the antigen-binding function of a binding protein may be performed by fragments of a full-length binding protein, including bispecific, dual specific, or multi-specific formats; for instance, binding to two or more different antigens.
  • binding fragments encompassed within the term “antigen-binding portion” of an binding protein include (i) an Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) an F(ab’) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody or binding protein, (v) a dAb fragment, which comprises a single variable domain; and (vi) an isolated complementarity determining region (CDR).
  • an Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
  • an F(ab’) 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • single chain Fv single chain Fv
  • single chain antibodies or binding proteins are also intended to be encompassed within the term“antigen-binding portion” of an antibody or binding protein.
  • Other forms of single chain antibodies, such as diabodies are also encompassed.
  • single chain antibodies or binding protein also include“linear” antibodies or binding protein comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions.
  • the term“multivalent binding protein” refers to a binding protein comprising two or more antigen binding sites.
  • the multivalent binding protein is engineered to have three or more antigen binding sites, and may not be a naturally occurring antibody.
  • the term“multispecific binding protein” refers to a binding protein capable of binding two or more related or unrelated targets.
  • the dual variable domain (DVD) binding proteins provided herein comprise two or more antigen binding sites and are tetravalent or multivalent binding proteins.
  • linker refers to an amino acid residue or a polypeptide comprising two or more amino acid residues joined by peptide bonds that are used to link two polypeptides (e.g., two VH or two VL domains).
  • linker polypeptides are well known in the art (see, e.g., Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak et al. (1994) Structure 2:1121-1123).
  • a number of suitable linkers for use in the binding proteins described herein are set out in Table 55.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker.
  • the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker.
  • the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker.
  • Kabat numbering “Kabat definitions” and“Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e., hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody or binding protein, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad. Sci.190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242).
  • the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3.
  • the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
  • the CDR sequences, framework sequences, and or constant region sequences are identified using Kabat numbering.
  • CDR refers to a complementarity determining region within an immunoglobulin variable region sequence. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the heavy and light chain variable regions.
  • CDR set refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al.
  • CDR boundary definitions may not strictly follow one of the herein systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
  • the methods used herein may utilize CDRs defined according to any of these systems, although certain embodiments use Kabat or Chothia defined CDRs.
  • epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics.
  • An antigen or fragment can contain more than one epitope.
  • An epitope may be determined by obtaining an X-ray crystal structure of an antibody:antigen complex and determining which residues on the antigen (e.g., VEGF or PDGF or a receptor) are within a specified distance of residues on the antibody of interest, wherein the specified distance is, 5 ⁇ or less, e.g., 5 ⁇ , 4 ⁇ , 3 ⁇ , 2 ⁇ , 1 ⁇ or less, or any distance in between.
  • the epitope is defined as a stretch of 8 or more contiguous amino acid residues along the antigen sequence in which at least 50%, 70% or 85% of the residues are within the specified distance of the antibody or binding protein in the X-ray crystal structure.
  • a binding protein specifically binds an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or
  • Binding proteins that bind to the same or similar epitopes will likely cross- compete (one prevents the binding or modulating effect of the other). Cross-competition, however, can occur even without partial or complete epitope overlap, e.g., if epitopes are adjacent in three-dimensional space and/or due to steric hindrance.
  • pharmacokinetic(s) refers to the process by which a drug is absorbed, distributed, metabolized, and excreted by an organism.
  • parent monoclonal antibodies with similarly desired pharmacokinetic profiles are selected.
  • the PK profiles of the selected parental monoclonal antibodies can be easily determined in rodents using methods known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181).
  • bioavailability refers to the degree and rate at which a drug is absorbed into a living system or is made available at the site of physiological activity.
  • Bioavailability can be a function of several of the previously described properties, including stability, solubility, immunogenicity and pharmacokinetics, and can be assessed using methods known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181).
  • the term“surface plasmon resonance” refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore® system (BIAcore International AB, a GE Healthcare company, Uppsala, Sweden and Piscataway, NJ). For further descriptions, see Jönsson et al. (1993) Ann. Biol. Clin. 51:19-26.
  • the term“K on ” refers to the on rate constant for association of a binding protein (e.g., an antibody or DVD-Ig) to the antigen to form the, e.g., DVD-Ig/antigen complex.
  • K on also refers to“association rate constant”, or“ka”, as is used interchangeably herein.
  • This value indicating the binding rate of a binding protein to its target antigen or the rate of complex formation between a binding protein, e.g., an antibody, and antigen also is shown by the equation below:
  • Antibody (“Ab”) + Antigen (“Ag”) ⁇ Ab-Ag
  • K off refers to the off rate constant for dissociation, or“dissociation rate constant”, of a binding protein (e.g., an antibody or DVD-Ig) from the, e.g., DVD-Ig/antigen complex as is known in the art.
  • This value indicates the dissociation rate of a binding protein, e.g., an antibody, from its target antigen or separation of Ab-Ag complex over time into free antibody and antigen as shown by the equation below:
  • the terms“K d ” and“equilibrium dissociation constant” may refer to the value obtained in a titration measurement at equilibrium, or by dividing the dissociation rate constant (K off ) by the association rate constant (K on ).
  • the association rate constant, the dissociation rate constant and the equilibrium dissociation constant are used to represent the binding affinity of a binding protein (e.g., an antibody or DVD-Ig) to an antigen.
  • Methods for determining association and dissociation rate constants are well known in the art. Using fluorescence–based techniques offers high sensitivity and the ability to examine samples in physiological buffers at equilibrium.
  • BIAcore® biological interaction analysis
  • KinExA® Kineetic Exclusion Assay
  • variant refers to a polypeptide that differs from a given polypeptide in amino acid sequence by the addition (e.g., insertion), deletion, or conservative substitution of amino acids, but that retains the biological activity of the given polypeptide (e.g., a variant VEGF antibody can compete with anti-VEGF antibody for binding to VEGF).
  • a conservative substitution of an amino acid i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity and degree and distribution of charged regions) is recognized in the art as typically involving a minor change.
  • hydropathic index of amino acids as understood in the art (see, e.g., Kyte et al. (1982) J. Mol. Biol.157: 105-132).
  • the hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes in a protein can be substituted and the protein still retains protein function. In one aspect, amino acids having hydropathic indexes of ⁇ 2 are substituted.
  • the hydrophilicity of amino acids also can be used to reveal substitutions that would result in proteins retaining biological function.
  • hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity (see, e.g., U.S. Patent No.4,554,101).
  • Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity, as is understood in the art.
  • substitutions are performed with amino acids having hydrophilicity values within ⁇ 2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid.
  • amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
  • variant also includes polypeptide or fragment thereof that has been differentially processed, such as by proteolysis, phosphorylation, or other post-translational modification, yet retains its biological activity or antigen reactivity, e.g., the ability to bind to VEGF.
  • variant encompasses fragments of a variant unless otherwise defined.
  • a variant may be about 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%,85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, or 75% identical to the wild type sequence.
  • binding protein molecules provided herein are useful as therapeutic molecules to treat various diseases, e.g., wherein the targets that are recognized by the binding proteins are detrimental. Such binding proteins may bind one or more targets involved in a specific disease.
  • ASD Age-Related Macular Degeneration
  • one or more of the binding proteins disclosed herein that are capable of binding to VEGF and PDGF and/or their cognate receptors (e.g., a
  • any of the binding proteins disclosed herein can be used to treat AMD, or a binding protein comprising the CDR and/or variable domain sequences from any of the binding disclosed herein.
  • the binding protein used to treat AMD is one or more of the binding proteins listed in Tables 27-30, 38-42, 46-50, or 55-58.
  • the binding protein used to treat AMD is one or more of the binding proteins listed in Tables 56-58.
  • the binding protein is PR-1572102, PR-1572105, or PR-1610561.
  • AMD Age-Related Macular Degeneration
  • RPE retinal pigmented epithelium
  • the disease occurs in two forms, the dry or non-exudative AMD form and the wet or exudative form.
  • dry AMD non- neovascular
  • the most common form of macular degeneration, dry AMD is an early stage of the disease and may result from aging and thinning of macular tissues, deposition of pigment in the macula, or a combination of both processes.
  • Dry AMD is diagnosed when yellowish spots known as drusen accumulate in and around the macula. Drusen are thought to be deposits or debris from nearby deteriorating tissue.
  • the onset of dry AMD is usually associated with age-related changes in Bruch’s membrane, a highly specialized matrix for adhesion of retinal pigment epithelial (RPE) cells.
  • RPE retinal pigment epithelial
  • the wet or exudative form of the disease usually results in more severe vision loss.
  • Wet macular degeneration mainly affects central vision, causing "blind spots" in the central line of vision.
  • Approximately 10-15% of dry AMD cases progress to wet AMD.
  • Wet AMD is characterized by new blood vessel growth beneath the retina. Clinically, this is referred to as choroidal neovascularization (CNV).
  • CNV choroidal neovascularization
  • Wet AMD accounts for about 10-15% of all cases of AMD. Progression of dry AMD to wet AMD is marked by the development of neovascularization within Bruch’s membrane, as well as in the subretinal space.
  • Wet AMD occurs when abnormal blood vessels behind the retina grow under the macula. These new blood vessels tend to be fragile and often leak blood and fluid.
  • VEGF vascular endothelial growth factor
  • CNV choroidal neovascularization
  • RVO retinal vein occlusion
  • Anti-VEGF agents may reduce choroidal neovascularization (CNV) and leakage, but do not lead to regression of CNV itself. Emerging evidence indicates the important role of pericytes on the maturation of new blood vessels. Anti-PDGF agents can directly block pericyte recruitment and prevent the maturation and stabilization of choroidal neovascularization. If pericytes can be stripped away from new blood vessels, vascular endothelial cells may become more susceptible to VEGF blockade, ultimately leading to a regression of angiogenesis.
  • CNV choroidal neovascularization
  • VEGF stimulates endothelial cell proliferation/growth, increases vascular permeability, and promotes leukocyte activity capable of damaging retinal endothelial cells (Leung et al. (1989) Science 246(4935):1306-9).
  • retinal tissues produce and release angiogenic growth factors such as VEGF that bind to specific receptors located on the endothelial cells of nearby preexisting blood vessels.
  • VEGF VEGF that bind to specific receptors located on the endothelial cells of nearby preexisting blood vessels.
  • Activation of endothelial cells can result in the release of enzymes targeting tight junctions. These enzymes act on the basement membrane surrounding all existing blood vessels and lead to the formation of holes in the membrane. The endothelial cells proliferate and migrate out through these holes toward the diseased tissue.
  • VEGF may serve as a rate-limiting step in angiogenesis.
  • VEGF also increases vascular permeability by leukocyte-mediated endothelial cell injury, formation of fenestrations, and the dissolution of tight junctions. This leads to intra-retinal fluid accumulation and a detrimental effect on visual acuity.
  • VEGF can also cause the release of inflammatory cytokines that further reinforce the cycle of inflammation and angiogenesis.
  • treatments inhibiting VEGF, PDGF, and/or the receptors (in a combination therapy or in one molecule) using the binding proteins disclosed herein may offer improved options for patients with wet AMD, while reducing the number of injections, reducing the safety concerns associated with multiple injections, and reducing cost.
  • Diabetic retinopathy is the most common diabetic eye disease and a leading cause of blindness in American adults. It is caused by changes in the blood vessels of the retina. In some people with diabetic retinopathy, blood vessels may swell and leak fluid. In other people, abnormal new blood vessels grow on the surface of the retina. The retina is the light-sensitive tissue at the back of the eye. A healthy retina is necessary for good vision.
  • Diabetic retinopathy has four stages: (1) Mild Nonproliferative Retinopathy. At this earliest stage, microaneurysms occur. They are small areas of balloon-like swelling in the retina's tiny blood vessels. (2) Moderate Nonproliferative Retinopathy. As the disease progresses, some blood vessels that nourish the retina are blocked. (3) Severe Nonproliferative Retinopathy. Many more blood vessels are blocked, depriving several areas of the retina with their blood supply. These areas of the retina send signals to the body to grow new blood vessels for nourishment. (4) Proliferative Retinopathy. At this advanced stage, the signals sent by the retina for nourishment trigger the growth of new blood vessels. This condition is called proliferative retinopathy.
  • These new blood vessels are abnormal and fragile. They grow along the retina and along the surface of the clear, vitreous gel that fills the inside of the eye. By themselves, these blood vessels do not cause symptoms or vision loss. However, they have thin, fragile walls. If they leak blood, severe vision loss and even blindness can result.
  • Blood vessels damaged from diabetic retinopathy can cause vision loss in two ways: (1) Fragile, abnormal blood vessels can develop and leak blood into the center of the eye, blurring vision. This is proliferative retinopathy and is the fourth and most advanced stage of the disease. (2) Fluid can leak into the center of the macula, the part of the eye where sharp, straight- ahead vision occurs. The fluid makes the macula swell, blurring vision. This condition is called macular edema. It can occur at any stage of diabetic retinopathy, although it is more likely to occur as the disease progresses. About half of the people with proliferative retinopathy also have macular edema.
  • the binding proteins disclosed herein may be used to inhibit VEGF, PDGF, and/or the receptors (in a combination therapy or in one molecule) to treat diabetic retinopathy.
  • other diseases may be treated using the binding proteins disclosed herein, including but not limited to other eye disorders, cancers, fibrosis, renal disease, pathologic angiogenesis, wound healing, bone formation, or other diseases associated with aberrant (e.g., elevated) PDGF and/or VEGF expression.
  • compositions comprising one or more of the binding proteins disclosed herein, either alone or in combination with other prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers.
  • the pharmaceutical compositions comprising binding proteins provided herein are for use in, but not limited to, diagnosing, detecting, or monitoring a disorder, in preventing, treating, managing, or ameliorating a disorder or one or more symptoms thereof, and/or in research.
  • the formulation of pharmaceutical compositions, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
  • Methods of administering a pharmaceutical composition or a prophylactic or therapeutic agent provided herein include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular, intraperitoneal, intravitreous, intravenous and subcutaneous), epidural administration, intratumoral administration, mucosal administration (e.g., intranasal and oral routes) and pulmonary administration (e.g., aerosolized compounds administered with an inhaler or nebulizer).
  • parenteral administration e.g., intradermal, intramuscular, intraperitoneal, intravitreous, intravenous and subcutaneous
  • epidural administration e.g., epidural administration
  • mucosal administration e.g., intranasal and oral routes
  • pulmonary administration e.g., aerosolized compounds administered with an inhaler or nebulizer
  • the methods of administering a pharmaceutical composition or a prophylactic or therapeutic agent provided herein include topical eye drops, gels, or
  • Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • the term“dosage unit form” refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • prophylactically effective amount of a binding protein provided herein is 0.1-20 mg/kg, for example, 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
  • a binding protein provided herein may also be administered with one or more additional therapeutic agents useful in the treatment of various diseases, the additional agent being selected by the skilled artisan for its intended purpose.
  • the additional agent can be a therapeutic agent art-recognized as being useful to treat the disease or condition being treated by the antibody provided herein, such as AMD.
  • the combination can also include more than one additional agent, e.g., two or three additional agents.
  • Combination therapy agents include, but are not limited to imaging agents, cytotoxic agents, angiogenesis inhibitors, kinase inhibitors, tyrosine kinase inhibitors, tyrosine kinase receptor inhibitors, co-stimulation molecule blockers, adhesion molecule blockers, anti- cytokine antibodies or functional fragments thereof, methotrexate, cyclosporin, rapamycin, FK506, detectable labels or reporters, TNF antagonists, antirheumatics, muscle relaxants, narcotics, non-steroid anti-inflammatory drugs (NSAIDs), analgesics, anesthetics, local anesthetics, sedatives, a hyaluronidase enzyme, neuromuscular blockers, antimicrobials, antipsoriatics, corticosteriods, anabolic steroids, erythropoietin, immunizations, immunoglobulins, immunosuppressives, growth hormones
  • the disclosure herein also provides, in various embodiments, diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems.
  • diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems.
  • the methods, kits, and adaptations provided may be employed in the detection, monitoring, and/or treatment of a disease or disorder in an individual. This is further elucidated below.
  • the present disclosure also provides a method for determining the presence, amount or concentration of an analyte, or fragment thereof, in a test sample using at least one binding protein as described herein.
  • Any suitable assay as is known in the art can be used in the method. Examples include, but are not limited to, immunoassays and/or methods employing mass spectrometry.
  • Immunoassays provided by the present disclosure may include sandwich immunoassays, radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
  • sandwich immunoassays radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
  • RIA radioimmunoassay
  • EIA enzyme immunoassay
  • a chemiluminescent microparticle immunoassay in particular one employing the ARCHITECT® automated analyzer (Abbott Laboratories, Abbott Park, IL), is an example of an immunoassay.
  • Methods employing mass spectrometry include, but are not limited to MALDI (matrix-assisted laser desorption/ionization) or by SELDI (surface-enhanced laser desorption/ionization).
  • MALDI matrix-assisted laser desorption/ionization
  • SELDI surface-enhanced laser desorption/ionization
  • kits for assaying a test sample for the presence, amount or concentration of an analyte, or fragment thereof, in a test sample comprises at least one component for assaying the test sample for the analyte, or fragment thereof, and instructions for assaying the test sample for the analyte, or fragment thereof.
  • the at least one component for assaying the test sample for the analyte, or fragment thereof can include a composition comprising a binding protein, as disclosed herein, and/or an anti-analyte binding protein (or a fragment, a variant, or a fragment of a variant thereof), which is optionally immobilized on a solid phase.
  • the kit may comprise a calibrator or control, which may comprise isolated or purified analyte.
  • the kit can comprise at least one component for assaying the test sample for an analyte by immunoassay and/or mass spectrometry.
  • the kit components including the analyte, binding protein, and/or anti-analyte binding protein, or fragments thereof, may be optionally labeled using any art-known detectable label.
  • the materials and methods for the creation provided for in the practice of the present disclosure would be known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181).
  • kits or components thereof, as well as the method of determining the presence, amount or concentration of an analyte in a test sample by an assay, such as an immunoassay as described herein, can be adapted for use in a variety of automated and semi- automated systems (including those wherein the solid phase comprises a microparticle), as described, for example, in U.S. Patent Nos.5,089,424 and 5,006,309, and as commercially marketed, for example, by Abbott Laboratories (Abbott Park, IL) as ARCHITECT®.
  • an assay such as an immunoassay as described herein
  • kits and kit components can be employed in other formats, for example, on electrochemical or other hand-held or point-of-care assay systems.
  • the present disclosure is, for example, applicable to the commercial Abbott Point of Care (i-STAT®, Abbott Laboratories) electrochemical immunoassay system that performs sandwich immunoassays. Immunosensors and their methods of manufacture and operation in single-use test devices are described, for example in, U.S. Patent No.5,063,081, 7,419,821, 7,682,833, 7,723,099, and 9,035,027; and U.S. Publication No.20040018577.
  • Table 1 discloses amino acid and nucleotide sequences encoding VEGF-A from different human isoforms and different species.
  • Table 2 discloses amino acid and nucleotide sequences encoding PDGF-BB from different human isoforms and different species.
  • Table 3 discloses human IgG heavy chain and light chain constant domains, including sequences with the indicated amino acid modifications relative to the wild-type sequence.
  • the constant domains listed in Table 3 can be used with any of the binding proteins disclosed herein.
  • the variable domains of the binding proteins disclosed herein may be attached to constant regions of any immunoglobulin species, isotypes, or mutants.
  • Exemplary modifications in constant domain mutants include those with amino acid mutations intended to increase or reduce constant domain interactions with Fc-gamma receptors, C1q and FcRn, and/or mutations intended to modulate protein stability or valency (full-length and half molecule, heterodimer molecule, etc.).
  • Tables 4 and 5 disclose exemplary heavy and light chain acceptor framework sequences that can be used with any of the CDR sets disclosed herein (i.e., heavy chain acceptor sequences paired with any of the heavy chain CDRs 1-3 disclosed herein, and/or light chain acceptor sequences paired with any of the light chain CDRs 1-3 disclosed herein) to form functional binding sites for PDGF, VEGF, and/or their cognate receptors.
  • Example 1 In vitro Assays Used to Determine the Functional Activity of Anti-VEGF-A Antibodies, Anti-PDGF-BB Antibodies, Anti-VEGFR Antibodies, Anti-PDGFR-B
  • the BIACORE ⁇ surface plasmon resonance assay (Biacore, Inc., Piscataway, NJ) determines the affinity of antibodies with kinetic measurements of on-rate and off-rate constants. Binding of anti-VEGF-A antibodies, anti-PDGF-BB antibodies, anti-VEGFR antibodies, anti-PDGFR-B antibodies, or anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules, to a purified recombinant VEGF-A, PDGF-BB, VEGFR extracellular domain (ECD), PDGFR-B ECD or their Fc fusion proteins was determined by surface plasmon resonance-based measurements with a Biacore® instrument (either a Biacore 2000, Biacore 3000, or Biacore T100; GE
  • HBS-EPB 10 mM HEPES [pH 7.4], 150 mM NaCl, 3 mM EDTA, 0.1 mg/ml BSA and 0.005% surfactant P20
  • approximately 9000 RU of goat anti-human Fc specific polyclonal antibody (Thermo Fisher Scientific Inc., Rockford, IL) diluted in 10 mM sodium acetate (pH 4.5) is directly immobilized across a CM5 research grade biosensor chip using a standard amine coupling kit according to manufacturer's instructions and procedures at 25 ⁇ g/ml. Unreacted moieties on the biosensor surface were blocked with ethanolamine.
  • rate equations derived from the 1:1 Langmuir binding model were fitted simultaneously to multiple antigen injections (using global fit analysis) with the use of Scrubber 2 (BioLogic Software), Biacore Biaevaluation 4.0.1 software or Biacore T100 Evaluation software.
  • Purified antibodies or DVD-Ig molecules were diluted in running buffer for capture across goat anti-human Fc reaction surfaces.
  • Antibodies or DVD-Ig molecules to be captured as a ligand (1 ⁇ g/ml) were injected over reaction matrices at a flow rate of 10 ⁇ l/minute. During the assay, all measurements were referenced against the capture surface alone (i.e., with no captured antibody or DVD-Ig molecule).
  • the association and dissociation rate constants, K on (M -1 s -1 ) and K off (s -1 ) were determined under a continuous flow rate of 80 ⁇ l/minute. Rate constants were derived by making kinetic binding measurements at different antigen concentrations ranging from 1.23– 900 nM, as a 3-fold dilution series, and included buffer-only injections (to be used for double referencing).
  • Chip surface CM5 chip with goat anti human Fc IgG (5000 RU).
  • Running buffer HBS-EP, 0.1 mg/ml BSA
  • DVD-Ig or mAbs were captured at 1 ⁇ g/ml, at 70-200 RU.
  • VEGF/PDGF DVD-Ig molecules The binding of VEGF/PDGF DVD-Ig molecules to recombinant Fc ⁇ Rs captured via 6xHis-tag was assessed using a Biacore T200 (GE Healthcare) instrument.
  • a CM5 chip GE Healthcare, Pittsburgh, PA
  • mouse anti-6xHis antibodies that were directly immobilized on the chip via amine coupling according to the GE Healthcare protocol to the density of 10000RU (all flow cells) was used for experiments.
  • Human Fc ⁇ Rs were captured on flow cells 2, 3 and 4.
  • Flow cell 1 was used as a reference surface.
  • HBS-EP+ was used as the running buffer.
  • Anti VEGF/PDGF DVD-Igs were injected over all the flow cells at a flow rate of 50 ⁇ L/minute for 1-2 minutes at concentrations of 31.25; 62.5, 125, 250, 500, 1000, 2000 and 4000 nM, followed by 1-3 minutes of dissociation.
  • the chip surfaces were regenerated with an injection of 10mM glycine pH 1.5 at a flow rate of 100 ⁇ L/minute over all four flow cells after each cycle.
  • VEGF/PDGF DVD-Igs were directly immobilized on a CM5 chip by amine coupling according to the manufacturer’s (GE Healthcare) protocol to a density of approximately 750 RU.
  • Flow cell 1 where blank immobilization was performed, did not contain DVD-Igs and was used as a reference surface.
  • Human, cynomolgus, mouse, rat and rabbit recombinant FcRns were injected over all the flow cells at a flow rate of 50 ⁇ L/minute for 1 minute at a concentrations range of from 2.7 to 6000 nM (three fold serial dilution), followed by a 2 minute dissociation time.
  • Example 1.3 VEGF-A Binding Activity Determined by Capture ELISA
  • a direct binding ELISA was performed.
  • 96-well high binding neutravidin plates (Thermo Scientific cat#15507) were coated with 0.25 ⁇ g/mL / 6.51E-9 M biotinylated recombinant human VEGF 165 (AP PR- 1361002, 50 ⁇ L/well in D-PBS), and shaken for 1.5 hours at 25°C .
  • supernatant, antibodies, benchmark compounds or DVD-Ig were diluted in 10 % Superblock (Thermo Scientific, cat# 37535 ) and an eight point titration of each sample molecule was performed.
  • Example 1.4 VEGF-A Blocking Activity Determined by Inhibition of VEGF- R2 Interaction with Human VEGF 165
  • hVEGF-R2 hVEGF- R2 (KDR/Flk-1) receptor
  • a competition ELISA was performed.
  • 96-well Costar high binding plates (#3369) were coated with 0.5 ⁇ g/mL / 2.27E-9 M recombinant human VEGF-R2-Fc (R&D Systems cat#357-KD), 50 ⁇ L/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween- 20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535).
  • the pre-incubated sample/ hVEGF 165 complex was added to the coated plate at 50 ⁇ L in duplicate and incubated for 30 minutes at 25 o C with shaking. Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP-40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177).
  • Example 1.5 Mouse VEGF-A Blocking Activity Determined by Inhibition of Mouse VEGF-R2 Interaction with Mouse VEGF 164
  • the mouse VEGF 164 (R&D Systems cat# 493-MV-005) was diluted in 1% Blocker BSA to 20 ng/mL. The diluted sample was added to the mouse VEGF 164 (10 ng/mL / 5.15E-10 M final concentration) and pre-incubated for 45 minutes at 25 o C with shaking. The pre-incubated sample/ mVEGF 164 complex was added to the coated plate at 50 ⁇ L and incubated for 30 minutes at 25 o C with shaking. Following incubation, plates were washed four times with wash buffer.
  • the detection reagent biotinylated goat anti-mVEGF 164 (R&D Systems cat#BAF-493) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates for 1 hour at 25°C with shaking. Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP-40 (Fitzgerald cat# 65r-s104phrp) was diluted in assay diluent and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177).
  • VEGF-R2 KDR/Flk-1 phosphorylation assay
  • Stably transfected VEGFR2-3T3 cells AP were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 ⁇ g/mL geneticin and 10% FBS).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 400 ⁇ g/mL geneticin and 10% FBS
  • Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37 o C, 5% CO 2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37 o C, 5% CO 2 .
  • DMEM 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate
  • MSD anti-VEGFR2-phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD kit cat# K151DJD-2) was blocked with MSD Blocker-A for 1 hour at 25 o C with shaking.
  • anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human VEGF 165 (AP, PR-1350437) (50 ng/ml / 1.3E-9 M final concentration), hVEGF 111 (R&DSystems, cat#5336-VE-10/CF) (50 ng/mL / 1.9E-9 M final concentration) or rabbit VEGF 165 (AbbVie, PR-1563693.0) (50 ng/mL / 1.24E-9 M final concentration) for 30 minutes at 25 o C w i t h s h a k i n g .
  • Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 ⁇ L) for 8 minutes at 37 o C, 5% CO 2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80 o C. Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 ⁇ L) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4 o C. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20).
  • wash buffer TBS, 0.05% Tween-20
  • the cell lysates were transferred to MSD plate (40 ⁇ L ) and incubated for 1 hour at 25 o C with shaking. Following incubation, the MSD plate was washed four times with wash buffer.
  • the anti-phospho-Tyr1054-IgG-sulfotag reagent was diluted in detection solution (K 151 D J D - 2 c o m p o n e n t ) a n d 25 ⁇ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25 o C with shaking.
  • Example 1.7 VEGF-A Blocking Activity Determined by Inhibition of Human VEGF 165 Stimulated VEGFR2-3T3 Cell Proliferation/Survival
  • VEGFR2-3T3 cells were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 0.1% BSA
  • anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human VEGF 165 (AP, PR-1350437) (40 ng/ml / 1.04E-9 M final concentration in assay well) for 1 hour at 25°C with gentle shaking.
  • the pre-incubated samples were then added to the cells (50 ⁇ L ) in triplicate and plates were incubated at 37°C, 5% C02 for 72 hours.
  • Cell survival/proliferation was measured indirectly by assessing ATP levels using an ATPlite kit (Perkin Elmer, Waltham, MA) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF 165 induced proliferation.
  • Data was analyzed and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.8 VEGF-A Blocking Activity Determined by Inhibition of
  • a cell based proliferation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non- essential amino acids, 1mM sodium pyruvate and 0.1% BSA).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non- essential amino acids
  • VEGFR2-3T3 cells were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 0.1% BSA
  • anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant rabbit VEGF 165 (AbbVie, PR-1563693.0) (40 ng/ml / 9.92E-10M final concentration in assay well) for 1 hour at 25°C with gentle shaking.
  • the pre-incubated samples were then added to the cells (50 ⁇ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C0 2 for 72 hours.
  • Example 1.10 VEGF-A Blocking Activity Determined by Inhibition of Human VEGF 165 Stimulated Endothelial Cell Proliferation/Survival
  • hVEGF 165 a cell based proliferation assay was performed.
  • Human microvascular endothelial cells (Lonza, cat#CC-2516) were maintained in EBM-2 (Lonza cat#CC3156) supplemented with EGM-2V singlequots (Lonza cat#3202). The day of the assay, the cells (passage 2– 7) were trypsinized, washed in D-PBS and resuspended at 1E5 cells/mL in assay media (M199, 2 mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 10 mM HEPES and 10% FBS).
  • VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human VEGF 165 (AP, PR-1350437) (5 ng/ml / 1.3E-10 M final concentration in assay well) for 1 hour at 25°C with gentle shaking.
  • VEGF-A Native human VEGF-A was obtained from the supernatant of Y-79 cells (ATCC, cat#HTB-18) grown in the presence of dimethyloxalylglycine (Sigma-Aldrich, cat#D3695). The naturally derived material was quantified using the R&D Systems VEGF Duoset kit (cat#DY293B). 96-well Costar high binding plates (#3369) were coated with 13.3E-8 M antibodies, benchmark compounds or DVD-Ig in D-PBS, shaken for 2 hours at 25°C and stored overnight at 4°C.
  • Detection antibody from the R&D Systems Duoset kit (Part 840163, cat#DY293B) was diluted in assay diluent and added to plates (50 ⁇ L) for 2 hours at 25°C with shaking. Plates were then washed four times with wash buffer.
  • the streptavidin-HRP from the R&D Systems Duoset kit (Part 890803, cat#DY293B) was diluted in assay diluent and added to plates (50 ⁇ L) for 35 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177).
  • Example 1.12 PDGF-BB Binding Activity Determined by Capture ELISA
  • a direct binding ELISA was performed.
  • 96-well high binding neutravidin plates (Thermo Scientific cat#15507) were coated with 0.5 ⁇ g/mL / 1.99E-8 M recombinant human PDGF-BB-biotin (CST cat#8912BF; labeled at AbbVie, 50 ⁇ L/well in D-PBS), shaken for 2 hours at 25°C.
  • supernatants, benchmark compounds or DVD-Ig were diluted in 10% Superblock (Thermo Scientific, cat#37525) and an eight point titration of each sample molecule was performed.
  • Example 1.13 PDGF-BB Blocking Activity Determined by Inhibition of PDGF- R ⁇ Interaction with Human PDGF-BB
  • supernatants, antibodies, benchmark compounds or DVD-Ig were diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and an eight point titration of each sample molecule was performed.
  • the recombinant human PDGF-BB-biotin (CST cat#8912BF; labeled at AbbVie) was diluted in assay diluent at 20 ng/mL.
  • the sample molecule titration was added to the human PDGF-BB-biotin (10 ng/mL / 3.97E-10 M final concentration) and pre-incubated for 45 minutes at 25 ° C with shaking.
  • Detection reagent Streptavidin- polyHRP-40 (Fitzgerald, cat#65r-s104phrp) was diluted in assay diluent and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177).
  • a cell based PDGF-R ⁇ phosphorylation assay was performed.
  • Balb-3T3 cells (ATCC cat# CCL- 163) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, and 10% FCS).
  • Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 20 hours at 37 o C, 5% CO 2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37 o C, 5% CO 2 .
  • DMEM 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate
  • MSD anti-PDGF-R ⁇ phospho-assay plate (Mesoscale PDGF-R ⁇ -Tyr751 phospho-MSD kit cat# K150DVD-2) was blocked with MSD Blocker-A for 1 hour at 25 o C with shaking.
  • anti-PDGF-BB s u p e r n a t a n t s , monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human PDGF-BB (CST, cat#8912BF) (20 ng/ml / 7.94E-10 M final concentration) and rat PDGF-BB (R&D Systems,cat#520-BB) (70 ng/ml / 1.4E-9 M final concentration) for 30 minutes at 25 o C with shaking.
  • CST human PDGF-BB
  • R&D Systems,cat#520-BB rat PDGF-BB
  • Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 ⁇ L) for 8 minutes at 37 o C, 5% CO2. Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice- cold D-PBS. Plates were frozen for 10 minutes at -80 o C. On ice, ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 ⁇ L). Plates were centrifuged at 3000 rpm for 15 minutes at 4 o C. The MSD plate was washed f o u r t i m e s with wash buffer (TBS, 0.05% Tween-20).
  • wash buffer TBS, 0.05% Tween-20
  • the cell lysates were transferred to MSD plate (40 ⁇ L) and incubated 1 hour at 25 o C with shaking. Following incubation, the MSD plate was washed f o u r t i m e s with wash buffer.
  • the anti-phospho-Tyr751-IgG-sulfotag reagent was diluted in detection solution (K150DVD-2 components) and 25 ⁇ l added to foil covered wells for 1 hour at 25 o C with shaking. Plates were washed four times with wash buffer, 150 ⁇ L MSD read buffer
  • Example 1.15 PDGF-BB Blocking Activity Determined by Inhibition of Human PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
  • NIH-3T3 cells ATCC, cat#CRL-1658
  • assay media DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA.
  • Cells were plated at 2,250 cells / well ( 50 ⁇ L ) on black 96-well plates and incubated for 5 hours at 37oC, 5% CO 2 .
  • anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human PDGF-BB (CST, cat#8912BF) (1.67 ng/ml / 6.63E-11 M final concentration) for 1 hour at 25°C with gentle shaking.
  • CST recombinant human PDGF-BB
  • the pre-incubated samples were then added to the cells (50 ⁇ L) in triplicate and plates were incubated at 37°C, 5% CO 2 for 44 hours.
  • Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hPDGF-BB induced proliferation. Data was analyzed and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.16 PDGF-BB Blocking Activity Determined by Inhibition of
  • NIH-3T3 cells ATCC, cat#CRL- 1658
  • assay media DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non- essential amino acids, 1mM sodium pyruvate and 0.1% BSA.
  • Cells were plated at 2,250 cells / well ( 50 ⁇ L ) on black 96-well plates and incubated for 5 hours at 37oC, 5% CO 2 .
  • anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant cynomolgus PDGF-BB (AP, PR-1575400) (4 ng/ml / 1.61E-10 M final concentration in assay well) for 1 hour at 25°C with gentle shaking.
  • Example 1.17 PDGF-BB Blocking Activity Determined by Inhibition of Murine PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
  • NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 0.1% BSA
  • anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant murine PDGF-BB (Abnova, cat#0309-200-58-S) (2 ng/ml / 8.13E-11 M final concentration) for 1 hour at 25°C with gentle shaking.
  • the pre-incubated samples were then added to the cells (50 ⁇ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C0 2 for 44 hours.
  • Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the murine PDGF-BB induced proliferation. Data was analyzed and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.18 PDGF-BB Blocking Activity Determined by Inhibition of Rat PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
  • NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 0.1% BSA
  • anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant rat PDGF-BB (R&D Systems,cat#520-BB) (2 ng/ml / 8.0E-11 M final concentration) for 1 hour at 25°C with gentle shaking.
  • the pre- incubated samples were then added to the cells (50 ⁇ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C0 2 for 44 hours.
  • Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the rat PDGF-BB induced proliferation. Data was analyzed and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • the native form of human PDGF was purified from platelets by a modified protocol from Antoniades et al. (Antoniades et al. (1979) Proc. Natl. Acad. Sci. USA 76(4): 1809- 1813.
  • ten units of platelets Bioreclamation Inc.
  • 12 ml of Platelet Wash Buffer HBSS– Gibco #14175 /0.3%BSA/10 mM EDTA
  • the platelets were then suspended in 25 ml of Buffer A (20 mM NaHPO4, pH 7.4, 80 mM NaCl in a 50 ml tube). From here the platelet wash (50 ml tube) and the suspended platelets were worked up in parallel using the same protocol.
  • a sandwich ELISA was performed.
  • the native human PDGF-BB was isolated and purified from human platelets (AbbVie, PR-1566692). This material was quantified using the R&D Systems PDGF-BB Duoset kit (cat#DY220).
  • 96-well Costar high binding plates (#3369) were coated with 13.3E-8 M antibodies, benchmark compounds or DVD-Ig in D-PBS, shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were blocked with Superblock blocking buffer (Thermo Scientific, cat#37535) followed by four washes with wash buffer (TBS, 0.05% Tween-20).
  • the native human PDGF-BB was serially diluted in assay diluent (1% Blocker BSA; Pierce, cat#37525) for final test concentrations of 2000 ng/mL– 2.74 ng/mL (5.4E-8 M– 7.5E-11 M). The dilutions were added to the plates (50 ⁇ L) and incubated for 2 hours at 25 o C with shaking. Following incubation, plates were washed f o u r t i m e s with wash buffer.
  • Detection antibody from the R&D Systems Duoset kit (Part 840926, cat#DY220) was diluted in assay diluent and added to plates (50 ⁇ L) for 2 hours at 25°C with shaking. Plates were then washed four times with wash buffer.
  • the streptavidin-HRP from the R&D Systems Duoset kit (Part 890803, cat#DY220) was diluted in assay diluent and added to plates (50 ⁇ L) for 35 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177).
  • Example 1.20 hVEGF-A Neutralization Potency of Anti-VEGF-A/Anti-PDGF- BB DVD-Ig Proteins When Pre-incubated with hPDGF-BB
  • a cell based VEGF-R2 (KDR/Flk-1) phosphorylation assay was performed.
  • Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 ⁇ g/mL geneticin and 10% FBS).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 400 ⁇ g/mL geneticin and 10% FBS.
  • Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37 o C, 5% CO 2 Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L- glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37 o C, 5% CO 2 .
  • DMEM 2mM L- glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate
  • MSD anti-VEGFR2- phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD kit, cat#K151DJD-2) was blocked with MSD Blocker-A for 1 hour at 25 o C with shaking.
  • anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human PDGF-BB (CST cat#8912BF) (0.992 ⁇ g/ml / 3.94E-8 M final concentration) for 30 minutes at 25 o C with shaking.
  • recombinant human VEGF 165 (AP, PR-1350437) was added to the samples for a final concentration of human VEGF 165 of 50 ng/ml / 1.3E-9 M and of hPDGF-BB of 0.496 ⁇ g/ml / 1.97E-8 M final concentration for 30 minutes at 25 o C with shaking.
  • Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 ⁇ L) for 8 minutes at 37 o C, 5% CO2.
  • plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80 o C.
  • Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 ⁇ L) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4 o C. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 ⁇ L) and incubated 1 hour at 25 o C with shaking. Following incubation, the MSD plate was washed four times with wash buffer. The anti-phospho- Tyr1054-IgG-sulfotag reagent was diluted in detection solution (K 151 D J D - 2
  • Example 1.21 PDGF Neutralization Potency of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Proteins When Pre-incubated with VEGF
  • NIH-3T3 cells ATCC, cat#CRL-1658
  • assay media DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA.
  • the samples were pre-incubated with recombinant human PDGF- BB in assay media (CST, cat#8912BF) (3.34 ng/ml / 1.33E-10 M final concentration in well) for 1 hour at 25°C with gentle shaking.
  • the final concentrations of ligand in assay wells were h V E G F 165 2.6E-8 M and hPDGF-BB 6.63E-11 M.
  • the pre-incubated samples were added to the cells (50 ⁇ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C0 2 for 44 hours.
  • Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hPDGF-BB induced proliferation in the presence of hVEGF 165 . Data was analyzed and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.22 Human VEGF-R2 Binding Activity of the Ant i -VEGF-R2 Ant ibodies
  • VEGF-R2 KDR/Flk-1
  • a direct binding ELISA was performed.
  • 96-well Costar high binding plates (#3369) were coated with 0.5 ⁇ g/mL / 2.27E-9 M recombinant human VEGF-R2-Fc (R&D Systems cat#357-KD), 50 ⁇ L/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with
  • S uperblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatant, antibodies or benchmark compounds were diluted in 1% Blocker BSA (Thermo Scientific cat#37525) and an eight point titration of each sample molecule was performed. The samples were added to wells and incubated for one hour at 25 o C with shaking. Following incubation, plates were washed four times with wash buffer. The appropriate anti-species-IgG HRP conjugate was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 ⁇ L) for forty-five minutes at 25°C with shaking.
  • Example 1.23 Human VEGF-R2 Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by Inhibition of Human VEGF-R2 Interaction with Human VEGF 165
  • Streptavidin-polyHRP-40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the human VEGF-R2-Fc binding to hVEGF 165 . Data was analyzed using Softmax Pro 4.8 software and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.24 VEGF-A Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by VEGFR2 (Tyr1054) Phosphorylation
  • VEGF-R2 KDR/Flk-1 phosphorylation assay
  • Stably transfected VEGFR2-3T3 cells AP were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 ⁇ g/mL geneticin and 10% FBS).
  • DMEM 2mM L-glutamine
  • penicillin/ 100 ⁇ g/mL streptomycin 0.1 % MEM non-essential amino acids
  • 1mM sodium pyruvate 400 ⁇ g/mL geneticin and 10% FBS
  • Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37 o C, 5% CO 2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37 o C, 5% CO 2 .
  • DMEM 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate
  • MSD anti-VEGR2-phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD #kit cat K151DJD-2) was blocked with MSD Blocked with MSD Blocker-A for 1 hour at 25 o C with shaking.
  • anti-VEGF-R2 supernatant, monoclonal antibodies and benchmark compounds were serially diluted in growth m e d i a and pre-incubated with recombinant human VEGFR2-Fc (R&D Systems, cat#357- KD) (500 ng/ml / 2.27E-9 M final concentration) for 30 minutes at 25 o C with shaking.
  • Recombinant human VEGF 165 (AP, PR-1350437) (50 ng/ml / 1.3E-9 M final concentration) was added to the wells and incubation was continued for 30 minutes at 25 o C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 ⁇ L) for 8 minutes at 37 o C, 5% CO 2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80 o C. Ice-cold lysis buffer (CST cat# 9803S) containing 1 mM PMSF was added to cells (50 ⁇ L) on ice.
  • CST cat# 9803S Ice-cold lysis buffer
  • Example 1.25 Mouse VEGF-R2 Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by Inhibition of Mouse VEGF-R2 Interaction with Mouse VEGF 164
  • a competition ELISA was performed.
  • 96-well Costar high binding plates (#3369) were coated with 1 ⁇ g/mL / 4.55E-9 M recombinant mouse VEGF-R2-Fc (R&D Systems cat#443-KD)(50 ⁇ L/well in D-PBS) shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were washed four times with wash buffer (TBS, 0.05% Tween-20). Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535).
  • hybridoma supernatants and rat IgG were diluted in 1% Blocker BSA (Thermo Scientific cat#37525). The sample was added to the plates (50 ⁇ L) and incubated for 45 minutes at 25 o C with shaking.
  • the mouse VEGF 164 (R&D Systems cat# 493-MV-005) was diluted in 1% Blocker BSA to 20 ng/mL and added to wells for a final concentration of 10 ng/mL / 5.15E-10 M final concentration.
  • Streptavidin-polyHRP- 40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the mouse VEGF-R2-Fc binding to the mVEGF 164 . Data was analyzed using Softmax Pro 4.8 software and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Ant ibodies as Determined by Inhibition of PDGF-R ⁇ Interaction with Human PDGF-BB
  • Streptavidin-polyHRP-40 (Fitzgerald, cat# 65r-s104phrp) was diluted in assay diluent and added to plates (50 ⁇ L) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the human PDGF-R ⁇ -Fc binding to hPDGF-BB. Data was analyzed using Softmax Pro 4.8 software and IC 50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
  • Example 1.28 PDGF-R ⁇ Blocking Activity of the Ant i -PDGF- R ⁇
  • a cell based PDGF-R ⁇ phosphorylation assay was performed.
  • Balb-3T3 cells (ATCC cat# CCL- 163) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 ⁇ g/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, and 10% FCS).
  • Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 20 hours at 37 o C, 5% CO 2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37 o C, 5% CO 2 .
  • DMEM 2mM L-glutamine, 100 units/mL penicillin/100 ⁇ g/mL streptomycin and 1mM sodium pyruvate
  • MSD anti-PDGFR ⁇ -phospho-assay plate (Mesoscale PDGF-R ⁇ -Tyr751 phospho-MSD kit cat# K150DVD-2) was blocked with MSD Blocker-A for 1 hour at 25oC with shaking.
  • supernatants, antibodies or benchmark compounds were serially diluted in growth m e d i a and pre-incubated with 500 ng/mL / 2.98E-9 M hPDGF-R ⁇ (R&D System, cat 385-PR) for 30 minutes at 25oC.
  • Recombinant human PDGF-BB (CST, cat#8912BF) (20 ng/ml / 7.94E- 10 nM final concentration) was added to the wells and incubation was continued for 30 minutes at 25 o C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 ⁇ L) for 8 minutes at 37 o C, 5% CO 2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80 o C. Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 ⁇ L) on ice.
  • MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20).
  • wash buffer TBS, 0.05% Tween-20.
  • the cell lysates were transferred to MSD plate (40 ⁇ L) and incubated 1 hour at 25 o C with shaking. Following incubation, the MSD plate was washed four times with wash buffer.
  • the anti-phospho-Tyr751-IgG-sulfotag reagent was diluted in detection solution (K 150 D V D - 2 c o m p o n e n t s ) a n d 25 ⁇ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25 o C with shaking.
  • Example 1.29 Reactivity of Anti-PDGF-BB Antibodies and Anti-VEGF-A/anti- PDGF-BB DVD-Ig Molecules to ECM-associated PDGF-BB
  • HEK293 Cell Staining PDGFB-RM transient transfected HEK 293 cells and parental HEK293 cells were re-suspended at 1E6 cells/mL in PBS and fixed in 4%
  • HUVEC Staining The anti-VEGF/anti-PDGF DVD-Ig was further assessed for its staining on naturally derived ECM-associated PDGF-BB on HUVEC cells.
  • HUVECs (Lonza, cat#: C2519A lot: 181607) were trypsinized, resuspended at 2E4 cells/mL in culture media (Lonza, EGM2 MV Bulletkit: CC-3202). Cells were plated at 10,000 cells / 500 ⁇ l / well in 8-chamber glass slide and incubated for 16 hours at 37 o C, 5% CO 2 .
  • cells were fixed with 200 ⁇ l 4% paraformaldehyde at RT for 10 minutes, washed with PBS and incubated in blocking buffer (10% goat serum in PBS) for one hour on ice. Cells were washed with PBS 3X and incubated with primary antibodies or DVD-Ig molecules at 33 nM in antibody dilution buffer (5% goat serum in PBS) for one hour on ice.
  • Example 1.30 Inhibition of Sprouting in HUVEC/MSC Co-culture Sprouting Assay by Anti-VEGF-A/anti-PDGF-BB DVD-Ig Molecules
  • Cytodex-3 beads (Sigma-Aldrich, cat# C3275) were coated with HUVEC cells (Lonza) overnight, and then embedded (100 beads/well) with human mesenchymal stem cells (Lonza, 20,000 cells/well) in fibrin gel in 24-well tissue culture plates.
  • a 1:1 mixture of fresh EGM-2 complete media (Lonza) and fibroblast (Lonza) conditioned EGM-2 media were added on top of the fibrin gel along with 2 ng/mL of recombinant human HGF. Medium was replaced every 2-3 days till the end of the experiment.
  • Size exclusion chromatography is used to separate proteins based on size. Proteins are carried in an aqueous mobile phase and through a porous stationary phase resin packed in a column. The retention time in the column is a function of the hydrodynamic size of the protein and the size of the pores in the packed resin bed. Smaller molecules can penetrate into smaller pores in the resin and are retained longer than larger molecules. Samples at 1 mg/ml, or diluted with formulation buffer to this concentration, are injected onto the SEC column at a volume of 10 ⁇ l. Upon elution from the column, the proteins are detected by UV absorbance. The SEC method uses a TSK gel guard (TOSOH Biosciences, Montgomeryville, PA, cat. no.
  • TSK gel G3000SWxL (TOSOH Biosciences, Montgomeryville, PA, cat. no.08541).
  • the mobile phase was 100 mM Na 2 HPO 4 , 100 mM Na 2 SO 4 , pH 6.8.
  • the flow rate is 0.25 ml/minute.
  • the column temperature is room temperature.
  • the autosampler temperature is 2-8oC.
  • the total run time is 55 minutes.
  • the detection is based on UV absorbance at 214 nm
  • the thermal stability of the protein samples was assessed using a differential scanning calorimetry (DSC) instrument.
  • the DSC instrument used was an automated VP-DSC equipment with Capillary Cell (Microcal, GE Healthcare Ltd./Microcal, Buckinghamshire, UK). Unfolding of molecules was studied applying a 1°C/minute scan rate over a 25°C - 95°C temperature range for samples at 1 mg/mL. Additional measurement parameters applied were a fitting period of 16 seconds, a pre-scan wait time of 10 minutes, and measurements were performed in none- feedback mode. For each measurement, 420 ⁇ L of sample or blank buffer was filled into the designated receptacle within the DSC instrument. The thermograms obtained (heat capacity versus temperature) were fitted to a non-two state model to obtain the midpoint temperatures and enthalpies of the different transitions.
  • the antibodies and DVD-Ig molecules were initially obtained as a solution and diluted below 10 mg/ml with the formulation buffer. Each sample was then inserted into a separate dialysis cartridge (Slide-a-lyzer cassette, 10,000 MWCO, 3-12 mL capacity, Thermo Scientific, USA, Cat. No.66810) and dialyzed against 2L of the formulation buffer with continuous stirring via a magnetic stir bar for 18-24 hours. The samples were then retrieved from the cartridge and briefly spun down in a centrifuge and/or passed through 0.45 ⁇ m PVDF filters to remove any precipitation or particles.
  • the antibodies and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their physical stability during storage at 40°C, 25°C, and/or 5°C. Both 25°C (room temperature) and 5°C (storage temperature) are typical temperatures at which the samples would be subjected either during preparation and storage for manufacture or as part of the final drug product presentation. Storage at 40°C is considered an accelerated stability condition which provides an indication of long-term stability prospects.
  • the samples were aliquoted into low volume containers ( ⁇ 0.1 ml), tightly sealed, and placed at the designated temperatures (sometimes in a water bath). The samples were then pulled at periodic intervals and a small portion was removed for analysis by SEC (Example 2.1).
  • the antibody and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their physical stability during freeze/thaw stress. Samples were aliquoted into low volume containers ( ⁇ 1 ml) and tightly sealed. The samples were then placed at -80°C for at least 6 hours and then thawed at 30°C in a water bath. This was repeated three more times. After the second and fourth thaws, a small portion of each sample was removed for analysis by SEC (Example 2.1).
  • DVD-Ig solutions are typically frozen at -80°C for long term storage as well as shipping to remote manufacturing sites. The samples are then thawed in order to complete the drug product manufacturing process. Stability due to freeze-thawing was assessed at low concentration in order to evaluate greater exposure of protein molecules to the denaturing ice- water interfaces. At higher concentrations, proportionally less protein encounters the ice-water interface, instead interacting with other protein molecules.
  • the antibody and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their viscosity at room temperature ( ⁇ 23°C) with a Malvern Viscosizer 200 instrument.
  • the viscosity serves as an indication of the ease of delivery of the sample through a small diameter needle attached to a syringe, a likely drug product presentation. A higher viscosity requires a greater force for delivery, and vice-versa.
  • the intact molecular weights of the three samples shown in Table 8 were acquired. Each sample was diluted to 1 mg/mL with Milli-Q water. 1.0 ⁇ L of the 1 mg/mL sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a C4 MicroTrap column. Table 9 shows the HPLC gradient for intact molecular weight analysis. Buffer A was 0.02% TFA, 0.08% FA in water. Buffer B was 0.02% TFA, 0.08% FA in acetonitrile. The flow rate was 50 ⁇ L/minute. The column temperature was set at 60°C. The mass spectrometer was operated at 5 kvolts spray voltage and the scan range was from 600 to 3200 mass to charge ratio.
  • the deglycosylated intact molecular weights of all three samples were measured by Agilent 6510 Q- Tof LC/MS system after the samples were deglycosylated. 100 ⁇ L of 1 mg/mL sample was mixed with 5 ⁇ L of 10% N-octylglucoside and 2 ⁇ L of PNGase F enzyme. The sample was incubated at 37°C for 18 hours. 1.0 ⁇ g of the deglycosylated sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a C4 MicroTrap for deglycosylated intact molecular weight analysis.
  • Samples were partially digested with Lys-C enzyme, reduced and analyzed by LC/MS. Different oligosaccharide species were quantitated based on the peak intensity detected by mass spectrometry and the relative percentage of different oligosaccharide species was reported. Samples were diluted to 1 mg/mL with Milli-Q water. 100 ⁇ L of each sample was mixed with 2 ⁇ L of 0.005 mg/mL Lys-C enzyme and incubated at 37°C for 30 minutes. 1 ⁇ L of 1 M DTT was added and incubated at 37°C for 30 minutes for reduction.
  • Example 2.9 Charge Heterogeneity By Weak Cation Exchange Chromatography And Imaged Isoelectric Focusing (icIEF)
  • Example 3 Generation of Rat Anti-VEGF-A, Anti-VEGFRII, Rat-Anti-PDGF-BB, Anti- PDGFR-B Monoclonal Antibodies by DNA Immunization and Rat Hybridoma Technology
  • Example 3.1 DNA Immunization, Hybridoma Fusion and Screening
  • a cDNA encoding the soluble human VEGFA-165, soluble human PDGF-BB, human VEGFR-II ECD (extracellular domain) or human PDGFR-BB ECD was cloned into a eukaryotic expression vector (Aldevron GmbH, Freiburg, Germany). Wistar rats were immunized by intradermal application of DNA-coated gold-particles using a hand-held device for particle-bombardment (“gene gun”). Antibody-producing splenocytes or lymph node cells were isolated and fused with fusion partner myeloma cells using polyethylene glycol (PEG) according to standard procedures.
  • PEG polyethylene glycol
  • screening is done with the use of either cells transfected with screening vector encoding GPI anchored human VEGF-A165, human PDGF-BB, human VEGFR-II ECD or human PDGFR-BB ECD proteins, soluble recombinant human VEGF-A165 and human PDGF-BB protein or peptides.
  • screening vector encoding GPI anchored human VEGF-A165, human PDGF-BB, human VEGFR-II ECD or human PDGFR-BB ECD proteins, soluble recombinant human VEGF-A165 and human PDGF-BB protein or peptides.
  • the tables below are the lists of antibodies generated using the rat DNA immunization approach.
  • Anti-VEGF-A antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays. Supernatants were tested for the ability to bind hVEGF 165 (Example 1.3) and block binding of hVEGF 165 to hVEGFR2 in a competition ELISA format (Example 1.4). Select hybridomas were assessed for cross-reactivity by testing for the ability to block human VEGF 111 and rabbit VEGF 165 in a Tyr1054
  • Anti-PDGF-BB antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays. Supernatants were tested for the ability to bind hPDGF-BB (Example 1.12) and block binding of hPDGF-BB to hPDGF-R in a competition ELISA format (Example 1.13). Select hybridomas were assessed for the ability to block human and rat PDGF-BB in a Tyr751 phosphorylation assay (Example 1.14).
  • Candidate rat IgG was then examined for potency in the human, mouse and cynomolgus PDGF-BB-induced cell proliferation assay (Examples 1.15-1.17), reactivity to native hPDGF-BB (Example 1.19) and binding affinity measurement by Biacore analysis (Example 1.1). The data is summarized in Tables 14 and 15 below.
  • Anti-VEGFR2 antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays.
  • the subcloned rat antibodies were tested for the ability to bind hVEGFR2 (Example 1.22), block binding of hVEGF-R2 to hVEGF 165 in a competition ELISA format (Example 1.23), and a hVEGF 165 Tyr1054 phosphorylation assay (Example 1.24).
  • Candidate molecules were then characterized for species cross-reactivity by testing their ability to block binding of mVEGFR2 to mVEGF 164 in a competition ELISA format (Example 1.25). The data is summarized in Table 16 below. Table 16.
  • Anti-PDGF-R ⁇ antibodies derived from rat hybridomas were characterized for binding and function in a panel of assays. The subcloned rat antibodies were tested for the ability to bind hPDGF-R ⁇ (Example 1.26).
  • Candidate IgG was also characterized for the ability to block binding of hPDGF-R ⁇ to hPDGF-BB in a competition ELISA format (Example 1.27) and an hPDGF-BB Tyr751 phosphorylation assay (Example 1.28).
  • Table 17 The data is summarized in Table 17 below. Attorney Docket No.12252.202-304 Table 17. A List of Anti-PDGFR-B Antibodies Generated Using DNA Immunization and Rat Hybridoma Technology
  • RNA + 2 ⁇ l dNTP + 2 ⁇ l Oligo (dT) + DEPC-H 2 O were incubated at 65 °C for 5 minutes, then transferred to ice for at least 1 minute.
  • the sample was then added to the following mixture: 4 ⁇ l of 10X RT buffer + 8 ⁇ l 25 mM MgCl 2 + 4 ⁇ l 0.1 M DTT + 2 ⁇ l RNase OUT and incubated at 42 °C for 2 minutes.
  • cDNA was then used as template for PCR amplification of variable regions of antibodies. PCR was performed using first-strand cDNA, primers from Mouse Ig-Primer Set (Novagen, catalog # 69831-3) and Platinum Super Mix High Fidelity (Invitrogen, catalog # 12532-016).
  • PCR samples were assembled as follows: 22.5 ⁇ l PCR Super Mix + 0.25 ⁇ l reverse primer MuIgG V H 3'-2 + 1 ⁇ l cDNA + 1.25 ⁇ l of one the forward primers (VH-A, VH-B) or 0.5 ⁇ l of one of the forward primers (VH-C, VH-D, VH-E, VH-F).
  • PCR samples were assembled as follows: 22.5 ⁇ l PCR Super Mix + 0.25 ⁇ l reverse primer MuIgKV L -3'-1 + 1 ⁇ l cDNA + 1.25 ⁇ l of one the forward primers (VL-A, VL- B) or 0.5 ⁇ l of one of the forward primers (VL-C, VL-D, VL-E, VL-F, VL-G).
  • PCR products were run on a 1.2% agarose gel, and bands migrating at the expected size (400-500 bp) were excised for DNA extraction.
  • DNA was purified using QIAquick Gel Extraction Kit (Qiagen, catalog # 28704) according to the following protocol: gel slices were weighed.3 volumes of buffer QG to 1 volume of gel were added to each gel slice. Samples were incubated at 50 °C for 10 minutes until gel slices were completely dissolved, mixing every 2-3 minutes. One gel volume of isopropanol was then added to each sample and mixed. Samples were then applied to QIAquick column and centrifuged for 1 minute at 13000 rpm.
  • variable domains of the heavy and light chain of the rat mAbs were cloned in-frame to mutant human IgG1 (L234, 235A) heavy-chain and kappa light-chain constant regions, respectively.
  • the activities of the resulting chimeric antibodies were confirmed in ELISA-based binding and competition assays or Biacore binding assay, and were comparable to their parental rat mAbs.
  • Chimeric anti-VEGF-A antibodies were characterized for binding, function and cross-reactivity in a panel of assays. Potency for all chimeric molecules was characterized in the hVEGF 165 -induced cell proliferation assay (Example 1.7). Binding affinity of these molecules to hVEGF 165 was measured by Biacore analysis (Example 1.1). Select chimeric molecules were tested for the ability to block binding of hVEGF 165 to hVEGF-R2 in a competition ELISA format (Example 1.4) and a hVEGF 111 Tyr1054 phosphorylation assay (Example 1.6).
  • Candidate molecules were then examined for potency in the HMVEC-d hVEGF 165 -induced proliferation assay (Example 1.10) and species cross-reactivity in the rabVEGF 165 -induced cell proliferation assay (Example 1.9). The data is summarized in Tables 22 and 23 below.
  • Chimeric anti-PDGF-BB antibodies were characterized for binding, function and cross-reactivity in a panel of assays.
  • the chimeric molecules were first tested for the ability to bind hPDGF-BB in a direct binding ELISA (Example 1.12). Binding affinity of these molecules to hPDGF-BB was then measured by Biacore analysis (Example 1.1). Functional characterization of these molecules included testing of the ability to block binding of hPDGF-BB to hPDGF-R ⁇ in a competition ELISA format (Example 1.13) and an hPDGFR ⁇ Tyr751 phosphorylation assay (Example 1.14).
  • Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding.
  • Example 6.1.2 Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized PDGF Antibodies
  • IGKV4-1*01 and IGJK4*01 as alternative acceptor sequences for constructing light chain 7.
  • IGKV1-39*01 and IGJK1*01 as alternative acceptor sequences for constructing light chain
  • IGKV4-1*01 and IGJK4*01 as alternative acceptor sequences for constructing light chain 7.
  • IGKV1-39*01 and IGJK1*01 as alternative acceptor sequences for constructing light chain
  • IGHV1-69*01 and IGHJ3*01 for constructing heavy chain acceptor sequences
  • IGKV2-29*02 and IGK2*01 for constructing light chain acceptor sequences
  • the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
  • Example 6.1.4 Generation of Humanized Antibodies To PDGF Containing
  • ⁇ hBDI-5H1-F6VH.1z is a CDR-grafted, humanized BDI-5H1-F6 VH containing IGHV2- 70*01 and IGHJ6 framework sequences.
  • ⁇ hBDI-5H1-F6VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
  • ⁇ hBDI-5H1-F6VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (A44G, K75N, V78A and M82I).
  • ⁇ hBDI-5H1-F6VH.1b is an intermediate design between .1 and .1a and only has two proposed framework back-mutations (A44G and M82I).
  • ⁇ hBDI-5H1-F6VH.1c is based on .1b with additional one CDR germlining change N65T to improve identity to human germline sequence.
  • ⁇ hBDI-5H1-F6VH.2z is a CDR-grafted, humanized BDI-5H1-F6 VH containing IGHV2- 70*04 and IGHJ6 framework sequences.
  • ⁇ hBDI-5H1-F6VH.2 is based on .2z with Q1E change to prevent pyroglutamate
  • hBDI-5H1-F6VH.2a (hBDI-5H1-F6VH.1d) is based on .2 and contains four proposed framework back-mutations (K75N, N76S, V78A and M82I).
  • hBDI-5H1-F6VH.2b (hBDI-5H1-F6VH.v2) is an intermediate design between .2 and .2a and only has two proposed framework back-mutations (V78A and M82I).
  • hBDI-5H1-F6VH.2c (hBDI-5H1-F6VH.v6) is based on .2 and contains three proposed framework back-mutations (K5R, V78A, M82I).
  • ⁇ hBDI-5H1-F6VH.v7 is a humanized BDI-5H1-F6 VH containing IGHV3-66*01 and IGHJ1 framework sequences with ten proposed framework back-mutations (A24F, V37I, V48L, S49A, F67L, R71K, N73T, T77Q, L78A, and M82I).
  • ⁇ hBDI-5H1-F6VL.1 is a CDR-grafted humanized BDI-5H1-F6 VL containing IGLV6- 57*01 and IGJL2*01 framework sequences.
  • ⁇ hBDI-5H1-F6VL.1a is a humanized design based on .1 with 3 proposed framework back-mutations (S43P, T46N and Y87F).
  • ⁇ hBDI-5H1-F6VL.1b is a humanized design based on .1 with 7 proposed framework b ack-mutations ( N1Q, S22P, S43P, T46N, G57E, P59S, Y87F).
  • ⁇ hBDI-5H1-F6VL.1c is an intermediate design between .1 and .1b with 2 back-mutations (N1Q and Y87F).
  • ⁇ hBDI-5H1-F6VL.2 is a CDR-grafted humanized BDI-5H1-F6 VL containing IGKV3- 20*01 and IGJK4*01 framework sequences.
  • ⁇ hBDI-5H1-F6VL.2a is a humanized design based on .2 with 10 proposed framework back-mutations (I2F, A43P, L46N, L47V, I58V, G66I, G68S, T69N, F71A, Y87F) and one residue deletion (T10) and two residues insertion (D66a and S66b).
  • ⁇ hBDI-5H1-F6VL.2b is based on .2a only with 2 proposed framework back-mutations (I2F, L47V) and without residues deletion (T10) and insertion (D66a, S66b).
  • ⁇ hBDI-5H1-F6VL.2c is a humanized design on .2 with 6 proposed framework back- mutations (I2F, A43P, L46N, L47V, I58V, Y87F) and without residues deletion (T10) and insertion (D66a, S66b).
  • ⁇ hBDI-5H1-F6VL.v6 is a humanized BDI-5H1-F6 VL containing IGKV4-1*01 and IGJK4*01 framework sequences with eight proposed framework back-mutations (I2F, M4L, L46N, L47V, T69N, D70S, F71A, Y87F).
  • ⁇ hBDI-5H1-F6VL.v7 is a humanized BDI-5H1-F6 VL containing IGKV1-39*01 and IGJK1*01 framework sequences with eight proposed framework back-mutations (I2F, M4L, L46N, L47V, T69N, D70S, F71A, and Y87F).
  • ⁇ hBDI-9E8-E7VH.1z is a CDR-grafted, humanized BDI-9E8-E7 VH containing IGHV2- 70*01 and IGHJ3*01 framework sequences.
  • ⁇ hBDI-9E8-E7VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
  • ⁇ hBDI-9E8-E7VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (A44G, V78A and M82I).
  • ⁇ hBDI-9E8-E7VH.1b is an intermediate design between .1 and .1a and only has two proposed framework back-mutations (A44G and M82I).
  • ⁇ hBDI-9E8-E7VH.1c is based on .1b with additional one CDR germlining change N65T to improve identity to human germline sequence.
  • ⁇ hBDI-9E8-E7VH.v6 is a humanized BDI-9E8-E7 VH containing IGHV2-70*04 and IGHJ6 framework sequences with four proposed framework back-mutations (Q1E, K5R, V78A, and M82I).
  • ⁇ hBDI-9E8-E7VH.v7 is a humanized BDI-9E8-E7 VH containing IGHV3-66*01 and IGHJ1 framework sequences with ten proposed framework back-mutations (A24F, V37I, V48L, S49A, F67L, R71K, N73T, T77Q, L78A, and M82I ).
  • ⁇ hBDI-9E8-E7VL.1 is a CDR-grafted humanized BDI-9E8-E7 VL containing IGLV6- 57*01 and IGJL2*01 framework sequences.
  • ⁇ hBDI-9E8-E7VL.1a is a humanized design based on .1 with three proposed framework back-mutations (S43P, T46N and Y87F).
  • ⁇ hBDI-9E8-E7VL.2 is a CDR-grafted humanized BDI-9E8-E7 VL containing IGKV3- 20*01 and IGJK4*01 framework sequences.
  • ⁇ hBDI-9E8-E7VL.2a is a humanized design based on .2 with 9 proposed framework back-mutations (I2F, A43P, L46N, L47V, I58V, G66I, T69N, F71A, Y87F) and one residue deletion (T10) and two residues insertion (D66a and S66b).
  • ⁇ hBDI-9E8-E7VL.2b is based on .2a only with 2 proposed framework back-mutations (I2F, L47V) and without residues deletion (T10) and insertion (D66a, S66b).
  • ⁇ hBDI-9E8-E7VL.v6 is a humanized BDI-9E8-E7 VL containing IGKV4-1*01 and IGJK4*01 framework sequences with nine proposed framework back-mutations: (I2F, M4L, L46N, L47V, T69N, D70S, F71A, T72S, and Y87F).
  • ⁇ hBDI-9E8-E7VL.v7 is a humanized BDI-9E8-E7 VL containing IGKV1-39*01 and IGJK1*01 framework sequences with eight proposed framework back-mutations: I2F, M4L, L46N, L47V, T69N, D70S, F71A, and T72S.
  • ⁇ hBDI-7H10-D8VH.1z is a CDR-grafted, humanized BDI-7H10-D8 VH containing
  • ⁇ hBDI-7H10-D8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
  • ⁇ hBDI-7H10-D8VH.1a is a humanized design based on .1 and contains five proposed framework back-mutations (M48I, V67A, I69L, E73T and S76N).
  • ⁇ hBDI-7H10-D8VH.1b is an intermediate design between .1 and .1a and only has one proposed framework back-mutation M48I.
  • ⁇ hBDI-7H10-D8VH.1c is based on .1b with two additional CDR germlining changes Y27G and T30S.
  • ⁇ hBDI-7H10-D8VL.1 is a CDR-grafted humanized BDI-7H10-D8 VL containing IGKV2- 29*02 and IGKJ2 framework sequences.
  • ⁇ hBDI-7H10-D8VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations I2V and M4L.
  • ⁇ hBDI-7H10-D8VL.1b is an intermediate design between .1 and .1a with only one
  • ⁇ hBDI-1E1-D5VH.1z is a CDR-grafted, humanized BDI-1E1-D5 VH containing IGHV1- 69*06 and JH6 framework sequences.
  • ⁇ hBDI-1E1-D5VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
  • ⁇ hBDI-1E1-D5VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (M48I, V67A, I69L and S76N).
  • ⁇ hBDI-1E1-D5VH.1b is an intermediate design between .1 and .1a and only has one back- mutations M48I. This design eliminates Carter residue back-mutations.
  • ⁇ hBDI-1E1-D5VL.1 is a CDR-grafted humanized BDI-1E1-D5 VL containing IGKV1D- 13*01 and Jk2 framework sequences.
  • ⁇ hBDI-1E1-D5VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations (V58I and F71Y).
  • ⁇ hBDI-1E1-D5VL.2 is a CDR-grafted humanized BDI-1E1-D5 VL containing IGKV3- 11*01 and Jk2 framework sequences.
  • ⁇ hBDI-1E1-D5VL.2a is a humanized design based on .2 with 2 proposed framework back-mutations (F71Y and V85T).
  • ⁇ hBDI-6A3-A9VH.1 is a CDR-grafted, humanized BDI-6A3-A9 VH containing IGHV3- 7*01 and JH6 framework sequences.
  • ⁇ hBDI-6A3-A9VH.1a is a humanized design based on .1 and contains one proposed
  • ⁇ hBDI-6A3-A9VH.1b is based on .1 with additional two CDR germlining changes S28T and R60V to improve identity to human germline sequence.
  • ⁇ hBDI-6A3-A9VH.2z is a CDR-grafted, humanized BDI-6A3-A9 VH containing IGHV1- 3*01 and JH6 framework sequences.
  • ⁇ hBDI-6A3-A9VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
  • ⁇ hBDI-6A3-A9VH.2a is a humanized design based on .2 and contains seven proposed framework back-mutations R44G, M48V, G49A, V67F, T73N, A78L and M80L.
  • ⁇ hBDI-6A3-A9VH.2b is an intermediate design between .2 and .2a with only three proposed framework back-mutations R44G, M48V and M80L.
  • ⁇ hBDI-6A3-A9VL.1 is a CDR-grafted humanized BDI-6A3-A9 VL containing IGLV6- 57*01 and JL2 framework sequences.
  • ⁇ hBDI-6A3-A9VL.1a is a humanized design based on .1 with 4 proposed framework back-mutations (S43P, T46N, Y49F and Y87F).
  • ⁇ hBDI-6A3-A9VL.1b is an intermediate design between .1 and .1a with only 1 proposed framework back-mutation Y49F.
  • ⁇ hBFU-3E2VH.1b is an intermediate design between .1 and .1a and contains 3 proposed framework back-mutations (W47L, M48I, I69L).
  • ⁇ hBFU-3E2VH.1c is an intermediate design between .1 and .1a and contains 2 proposed framework back-mutations (W47L, M48I.)
  • ⁇ hBFU-3E2VH.1d is a humanized design based on .1 and contains 9 proposed framework back-mutations (R38K, G44S, W47L, M48I, R66K, V67A, I69L, S76N, Y91F)
  • ⁇ hBFU-3E2VL.1 is a CDR-grafted, humanized BFU-3E2 VL containing IGKV3-11*01 and IGKJ4*01 framework sequences.
  • ⁇ hBFU-3E2VL.1a is a humanized design based on .1 and contains 4 proposed framework back-mutations (I2T, A43Q, I58V, Y87F).
  • ⁇ hBFU-3E2VL.1b is an intermediate design between .1 and 1a. It contains 3 proposed framework back-mutations (I2T, I58V, Y87F).
  • ⁇ hBFU-3E2VL.1c is a design based on .1b and contains 1 proposed framework back- mutations: I2T.
  • ⁇ hBFU-3E2VL.2 is a CDR-grafted, humanized BFU-3E2 VL containing IGKV1-13*01 and IGKJ4*01 framework sequences.
  • ⁇ hBFU-3E2VL.2a is a humanized design based on .2 and contains 5 proposed framework back-mutations (I2T, T22S, A43Q, K45R, Y87F).
  • ⁇ hBFU-3E2VL.2b is an intermediate design between .2 and 2a. It contains 3 proposed framework back-mutations (I2T, K45R, Y87F).
  • ⁇ hBFU-3E2VL.2c is a design based on .2b and contains 2 proposed framework back- mutations (I2T, K45R).
  • ⁇ hBFU-11A8VH.1z is a CDR-grafted, humanized BFU-11A8 VH containing IGHV1- 69*01 and IGHJ6*01 framework sequences.
  • ⁇ hBFU-11A8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBFU-11A8VH.1a is a humanized design based on .1 and contains 8 proposed
  • ⁇ hBFU-11A8VH.1b is an intermediate design between .1 and .1a and contains 4 proposed framework back-mutations: W47L, M48I, I69L, S76N.
  • ⁇ hBFU-11A8VH.1c is a design based on .1b and contains 2 proposed framework back- mutations: W47L, M48I.
  • ⁇ hBFU-11A8VL.1 is a CDR-grafted, humanized BFU-11A8 VL containing IGKV3-11*01 and IGKJ4*01 framework sequences.
  • ⁇ hBFU-11A8VL.1a is a humanized design based on .1 and contains 5 proposed
  • ⁇ hBFU-11A8VL.1b is an intermediate design between .1 and 1a. It contains 3 proposed framework back-mutations: I2T, I58V, Y87F.
  • ⁇ hBFU-11A8VL.1c is a design based on .1b and contains 1 proposed framework back- mutations: I2T.
  • ⁇ hBFU-11A8VL.2 is a CDR-grafted, humanized BFU-11A8 VL containing IGKV1-5*01 and IGKJ4*01 framework sequences.
  • ⁇ hBFU-11A8VL.2a is a humanized design based on .2 and contains 5 proposed framework back-mutations: I2T, M4L, T22P, A43Q, Y87F.
  • ⁇ hBFU-11A8VL.2b is an intermediate design between .2 and 2a. It contains 3 proposed framework back-mutations: I2T, M4L, Y87F.
  • ⁇ hBFU-11A8VL.2c is a design based on .2b and contains 1 proposed framework back- mutations: I2T.
  • Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding.
  • Example 6.2.2 Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized VEGF Antibodies
  • IGHV7-4-1*02 and IGHJ3*01 for constructing heavy chain acceptor sequences 2.
  • IGHV1-18*01 and IGHJ3*01 as backup acceptor sequences for constructing heavy chain 3.
  • IGHV5-51*01 and IGHJ3*01 as backup acceptor sequences for constructing heavy chain 4.
  • IGHV3-66*01 and IGHJ1*01 as backup acceptor sequences for constructing heavy chain 5.
  • IGKV1D-13*01 and IGKJ2*01 for constructing light chain acceptor sequences
  • IGHV7-81*01 and IGHJ1*01 for constructing heavy chain acceptor sequences.
  • IGHV1-18*01 and IGHJ1*01 as alternative acceptor sequence for constructing heavy chain
  • IGHV3-7*01 and IGHJ3*01 for constructing heavy chain acceptor sequences.
  • IGHV7-81*01 and IGHJ4*01 for constructing heavy chain acceptor sequences.
  • IGHV1-18*01 and IGHJ4*01 as alternative acceptor sequence for constructing heavy chain
  • IGHV7-81*01 and IGHJ4*01 for constructing heavy chain acceptor sequences.
  • IGHV1-18*01 and IGHJ4*01 as alternative acceptor sequence for constructing heavy chain
  • IGHV1-69*06 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3.
  • IGHV3-11*01 and IGKJ4*01 for constructing light chain acceptor sequences
  • IGHV1-69*06 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3.
  • IGHV1-27*01 and IGKJ2*01 for constructing light chain acceptor sequences
  • IGHV7-4-1*01(0-1) and IGHJ1*01 for constructing heavy chain acceptor sequences 2.
  • the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
  • Example 6.2.4 Generation Of Humanized Antibodies To VEGF Containing Framework Back-Mutations In CDR-Grafted Antibodies
  • ⁇ hBDB-4G8-D4VH.1z is a CDR-grafted, humanized BDB-4G8-D4 VH containing IGHV7-4-1*02 and IGHJ3*01 framework sequences.
  • ⁇ hBDB-4G8-D4VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBDB-4G8-D4VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (V2I, W47Y and Y91F).
  • ⁇ hBDB-4G8-D4VH.1b is an intermediate design between .1 and .1a and only has one back-mutations W47Y.
  • ⁇ hBDB-4G8-D4VH.2z is a CDR-grafted, humanized BDB-4G8-D4 VH containing IGHV1-18*01 and IGHJ3*01 framework sequences.
  • ⁇ hBDB-4G8-D4VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBDB-4G8-D4VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (V2I, W47Y, V67F, M69F, T71L and Y91F).
  • ⁇ hBDB-4G8-D4VH.2b is an intermediate design between .2 and .2a and only has two proposed framework back-mutations (W47Y and T71L).
  • ⁇ hBDB-4G8-D4VH.v3 is a humanized BDB-4G8-D4 VH containing IGHV5-51*01 and IGHJ3*01 framework sequences with thirteen proposed framework back-mutations (V2I, A9T, G24A, R38K, W47Y, Q66R, V67F, I69F, A71L, I75F, S76N, Y79F and Y91F).
  • ⁇ hBDB-4G8-D4VH.v4 is a humanized BDB-4G8-D4 VH containing IGHV3-66*01 and IGHJ1*01 framework sequences with thirteen proposed framework back-mutations (V2I, E6Q, L11V, W47Y, V48M, S49G, I69F, R71L, N73T, N76S, L78A, M82L and Y91F).
  • ⁇ hBDB-4G8-D4VH.v5 is a humanized BDB-4G8-D4 containing IGHV3-66*01 and
  • IGHJ1*01 framework sequences with ten proposed framework back-mutations R38K, W47Y, V48M, S49G, I69F, R71L, N73T, N76S, L78A and Y91F).
  • ⁇ hBDB-4G8-D4VL.1 is a CDR-grafted humanized BDB-4G8-D4 VL containing
  • ⁇ hBDB-4G8-D4VL.1a is a humanized design based on .1 with 3 proposed framework back-mutations (I2T, A43Q and Y87F) and one residue deletion (S10).
  • ⁇ hBDB-4G8-D4VL.1b is an intermediate design between .1 and .1a with only one
  • ⁇ hBDB-4G8-D4VL.1c is a humanized design based on .1b with one residue insertion (S10).
  • ⁇ hBDB-4G8-D4VL.v2 is a humanized BDB-4G8-D4 VL containing IGKV3-11*01 and IGKJ2*01 framework sequences with four proposed framework back-mutations (E1D, I2T, I58V, and Y87F).
  • ⁇ hBDB-4G8-D4VL.v3 is a humanized BDB-4G8-D4 VL design containing IGKV3-15*01 and IGKJ5*01 framework sequences with five proposed framework back-mutations (I2T, M4L, I58V, E70D, and Y87F).
  • ⁇ hBDB-4G8-D4VL.v4 is a humanized BDB-4G8-D4 VL containing IGKV3-15*01 and IGKJ1*01 framework sequences with eleven proposed framework back-mutations (E1D, I2T, A9S, L13A, L21I, R45K, I58V, A60S, G66R, E79Q, and Y87F).
  • ⁇ hBDB-4G8-D4VL.v5 is a humanized BDB-4G8-D4 VL containing IGKV1-39*01 and IGKJ1*01 framework sequences with four proposed framework back-mutations (I2T, M4L, T22S, and Y87F).
  • ⁇ hBEW-9A8-E2VH.1z is a CDR-grafted, humanized BEW-9A8-E2 VH containing IGHV7-81*01 and IGHJ1*01 framework sequences.
  • ⁇ hBEW-9A8-E2VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-9A8-E2VH.1a is a humanized design based on .1 and contains six proposed framework back-mutations (V2I, P38K, W47Y, M71L, Y90F and Y91F).
  • ⁇ hBEW-9A8-E2VH.1b is an intermediate design between .1 and .1a and only has three proposed framework back-mutations (W47Y, M71L and Y90F).
  • ⁇ hBEW-9A8-E2VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
  • ⁇ hBEW-9A8-E2VH.2z is a CDR-grafted, humanized BEW-9A8-E2 VH containing
  • ⁇ hBEW-9A8-E2VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
  • ⁇ hBEW-9A8-E2VH.2a is a humanized design based on .2 and contains eight proposed framework back-mutations (V2I, R38K, W47Y, V67F, M69F, T71L, Y90F and Y91F).
  • ⁇ hBEW-9A8-E2VH.2b is an intermediate design between .2 and .2a and contains three back-mutations (W47Y, M71L and Y90F).
  • hBEW-9A8-E2VH.2c (hBEW-9A8VH.4a) is an intermediate design between .2 and .2a and contains six proposed framework back-mutations (V2I, R38K, W47Y, V67F, M69F, and T71L).
  • ⁇ hBEW-9A8-E2VH.2d (hBEW-9A8VH.4b) is an intermediate design between .2 and .2a contains four proposed framework back-mutations (V2I, V67F, M69F, and T71L).
  • ⁇ hBEW-9A8VH.3z is a CDR-grafted, humanized BEW-9A8 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
  • ⁇ hBEW-9A8VH.3 is based on .3z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-9A8VH.3a is a humanized design based on .3 and contains 3 proposed
  • ⁇ hBEW-9A8VH.3b is an intermediate design between .3 and .3a and contains 1 proposed framework back-mutations: V2I.
  • ⁇ hBEW-9A8VH.3c is a humanized design based on .3 and contains 5 proposed framework back-mutations (V2I, R38K, W47Y, Y90F, Y91F).
  • ⁇ hBEW-9A8-E2VL.1 is a CDR-grafted humanized BEW-9A8-E2 VL containing IGKV6- 21*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9A8-E2VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, S43Q, K49H and Y87F).
  • ⁇ hBEW-9A8-E2VL.1b is an intermediate design between .1 and .1a with only two
  • ⁇ hBEW-9A8-E2VL.1c is based on .1b with one residue deletion of F10.
  • ⁇ hBEW-9A8-E2VL.2 is a CDR-grafted humanized BEW-9A8-E2 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9A8-E2VL.2a is a humanized design based on .2 with five proposed framework back-mutations (I2T, M4L, A43Q, Y49H and Y87F).
  • ⁇ hBEW-9A8-E2VL.2b is an intermediate design between .1 and .1a with only two
  • ⁇ hBEW-9A8-E2VL.2c is based on .2b with one residue deletion of S10.
  • ⁇ hBEW-9A8VL.3 is a CDR-grafted, humanized BEW-9A8 VL containing IGKV3-11*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9A8VL.3a is a humanized design based on .3 and contains 5 proposed framework back-mutations: (I2T, Y49H, I58V, V85T, Y87F).
  • ⁇ hBEW-9A8VL.3b is an intermediate design between .3 and 3a. It contains 2 proposed framework back-mutations: (I2T, Y87F).
  • ⁇ hBEW-9A8VL.3c is a design based on .3b and contains 1 proposed framework back- mutations: I2T.
  • ⁇ hBEW-9A8VL.4 is a CDR-grafted, humanized BEW-9A8 VL containing IGKV1-13*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9A8VL.4a is a humanized design based on .4 and contains 4 proposed framework back-mutations: I2T, T22S, Y49H, Y87F.
  • ⁇ hBEW-9A8VL.4b is an intermediate design between .4 and 4a. It contains 2 proposed framework back-mutations: I2T, Y87F.
  • ⁇ hBEW-9A8VL.4c is a design based on .4b and eliminated Carter residue back-mutations.
  • ⁇ hBEW-6C2-C8VH.1 is a CDR-grafted, humanized BEW-6C2-C8 VH containing
  • ⁇ hBEW-6C2-C8VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations V37I, V48M and R94A.
  • ⁇ hBEW-6C2-C8VH.1b is an intermediate design between .1 and .1a and only has two back-mutations V48M and R94A. This design eliminates Carter residue back-mutations.
  • ⁇ hBEW-6C2-C8VL.1 is a CDR-grafted humanized BEW-6C2-C8 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-6C2-C8VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations (F71Y and Y87F).
  • ⁇ hBEW-6C2-C8VL.2 is a CDR-grafted humanized BEW-6C2-C8 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-6C2-C8VL.2a is a humanized design based on .2 with 4 proposed framework back-mutations (M4L, V58I, F71Y and Y87F).
  • ⁇ hBEW-9D2-E8VH.1z is a CDR-grafted, humanized BEW-9D2-E8 VH containing IGHV7-81*01 and IGHJ4*01 framework sequences.
  • ⁇ hBEW-9D2-E8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-9D2-E8VH.1a is a humanized design based on .1 and contains seven proposed framework back-mutations (V2I, P38K, Q39L, W47Y, M48L, M71L and Y91F).
  • ⁇ hBEW-9D2-E8VH.1b is an intermediate design between .1 and .1a and only has four proposed framework back-mutations ( P38K, W47Y, M48L, M71L).
  • ⁇ BEW-9D2-E8VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
  • ⁇ hBEW-9D2-E8VH.2z is a CDR-grafted, humanized BEW-9D2-E8 VH containing
  • ⁇ hBEW-9D2-E8VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
  • ⁇ hBEW-9D2-E8VH.2a is a humanized design based on .2 and contains ten proposed framework back-mutations (V2I, R38K, Q39L, W47Y, M48L, V67F, M69F, T71L, M80L and Y91F).
  • ⁇ hBEW-9D2-E8VH.2b is an intermediate design between .2 and .2a and only has five proposed framework back-mutations (R38K, W47Y, M48L, T71L and M80L).
  • ⁇ hBEW-9D2-E8VL.1 is a CDR-grafted humanized BEW-9D2-E8 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9D2-E8VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, A43Q, I58V and Y87F).
  • ⁇ hBEW-9D2-E8VL.1b is an intermediate design between .1 and .1a with one proposed framework back-mutation I2V.
  • ⁇ hBEW-9D2-E8VL.2 is a CDR-grafted humanized BEW-9D2-E8 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9D2-E8VL.2a is a humanized design based on .2 with four proposed framework back-mutations (I2T, M4L, A43Q and Y87F).
  • ⁇ hBEW-9D2-E8VL.2b is an intermediate design between .2 and .2a with one proposed framework back-mutation I2V.
  • ⁇ hBEW-9E3-B9VH.1z is a CDR-grafted, humanized BEW-9E3-B9 VH containing IGHV7-81*01 and IGHJ4*01 framework sequences.
  • ⁇ hBEW-9E3-B9VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-9E3-B9VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (V2I, W47Y, M71L and Y91F).
  • ⁇ hBEW-9E3-B9VH.1b is an intermediate design between .1 and .1a and only has two back-mutations (W47Y and M71L).
  • ⁇ hBEW-9E3-B9VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
  • ⁇ hBEW-9E3-B9VH.2z is a CDR-grafted, humanized BEW-9E3-B9 VH containing IGHV1-18*01 and IGHJ4*01 framework sequences.
  • ⁇ hBEW-9E3-B9VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-9E3-B9VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (V2I, W47Y, V67F, M69F, T71L and Y91F).
  • ⁇ hBEW-9E3-B9VH.2b is an intermediate design between .2 and .2a and only has two back-mutations W47Y and T71L.
  • ⁇ hBEW-9E3-B9VL.1 is a CDR-grafted humanized BEW-9E3-B9 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9E3-B9VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, A43Q, I58V and Y87F).
  • ⁇ hBEW-9E3-B9VL.1b is an intermediate design between .1 and .1a with 1 proposed framework back-mutation I2T.
  • ⁇ hBEW-9E3-B9VL.2 is a CDR-grafted humanized BEW-9E3-B9 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
  • ⁇ hBEW-9E3-B9VL.2a is a humanized design based on .1 with four proposed framework back-mutations (I2T, M4L, A43Q and Y87F).
  • ⁇ hBEW-9E3-B9VL.2b is an intermediate design between .1 and .1a with 1 proposed framework back-mutation I2T.
  • ⁇ hBEW-5C3VH.1z is a CDR-grafted, humanized BEW-5C3 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
  • ⁇ hBEW-5C3VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-5C3VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (V2I, R38K, W47Y).
  • ⁇ hBEW-5C3VH.1b is a humanized design based on .1 and contains five proposed
  • ⁇ hBEW-5C3VH.2z is a CDR-grafted, humanized BEW-5C3 VH containing IGHV1- 69*06 and IGHJ1*01 framework sequences.
  • ⁇ hBEW-5C3VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation.
  • ⁇ hBEW-5C3VH.2a is a humanized design based on .2 and contains seven proposed

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Endocrinology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Cardiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Binding proteins that bind one or more of VEGF, PDGF and/or their receptors, including antibodies, CDR-grafted antibodies, humanized antibodies, binding fragments, fusion proteins, and bispecific or multispecific proteins thereof are disclosed. Also disclosed are methods of making and using the binding proteins.

Description

BINDING PROTEINS AGAINST VEGF, PDGF, AND/OR THEIR RECEPTORS
[001] This international application claims priority to U.S. Provisional Application Serial No. 62/175,546, filed June 15, 2015, and U.S. Provisional Application Serial No.
62/291,964, filed February 5, 2016, each of which is incorporated herein by reference in its entirety.
Field
[002] The invention relates to antibodies and antigen-binding fragments thereof, as well as multivalent and multispecific binding proteins, that bind vascular endothelial growth factor (VEGF) and/or platelet-derived growth factor (PDGF), as well as their receptors, and methods of making, and using the constructs in the diagnosis, prevention, and/or treatment of acute and chronic inflammatory diseases, cancer, and other disorders.
Background
[003] Angiogenesis, the formation of new blood vessels from pre-existing vasculature, plays a role in the pathogenesis of many diseases, including ocular diseases such as age-related macular degeneration (AMD) or diabetic macular edema (DME). Vascular endothelial growth factor (VEGF) plays a role in the regulation of normal and abnormal angiogenesis (Ferrara et al. (1997) Endocr. Rev.18:4-25). Several anti-VEGF agents are provided in the art, e.g., in U.S. Patent No.7,169,901, which discloses VEGF antibodies for inhibiting VEGF-induced cell proliferation, and U.S. Patent No.7,070,959, which discloses isolated nucleic acid molecules encoding fusion proteins capable of binding VEGF.
[004] Targeting VEGF with currently available therapeutics is not effective in all patients or for all diseases associated with inflammation and/or angiogenesis. A significant population of non-responders present following anti-VEGF monotherapy, and the disease prevalence will only increase as the aging population increases globally.
[005] A currently preferred treatment for wet AMD consists of intravitreal injections of an anti-VEGF agent. However, athough anti-VEGF therapy reduces choroidal
neovascularization, it does not have an effect on regression of the mature vasculature. Also, current agents do not provide an anti-fibrotic effect, so that once scarring of the retina occurs; visual acuity cannot be recovered. Other limitations of the existing treatments regimens include patient discomfort, the need for repeat injections with inherent complications including endophthalmitis, retinal tear and detachment, intraocular hemorrhage, and cataract formation. There is a substantial time burden on ophthalmologists to provide monthly intravitreal treatment and optical coherence tomography (OCT) measurements on a large volume patients. As a result, there is a significant medical and economic need for an AMD therapeutic with greater efficacy, or that can be delivered less frequently and still achieve optimal efficacy.
[006] Platelet-derived growth factor (PDGF) is a growth factor involved in the regulation of blood vessels from pre-existing vessel tissue. PDGF binds to receptors on pericytes in newly-forming abnormal blood vessels. This may contribute to neovascularization of abnormal blood vessels by providing a protective perictye coating, for example, during ocular disorders such as wet AMD.
[007] Engineered proteins, such as antibodies, fragments, and multispecific binding proteins capable of binding two or more antigens, are known in the art. Such multispecific binding proteins can be generated using cell fusion, chemical conjugation, or recombinant DNA techniques. There are a variety of multispecific binding protein structures known in the art and many structures and methods have distinct disadvantages.
[008] Bispecific antibodies have been produced using quadroma technology.
Bispecific antibodies can also be produced by chemical conjugation of two different mAbs. Other approaches include coupling of two parental antibodies with a hetero-bifunctional crosslinker, production of tandem single-chain Fv molecules, diabodies, bispecific diabodies, single-chain diabodies, and di-diabodies. In addition, a multivalent antibody construct comprising two Fab repeats in the heavy chain of an IgG and capable of binding four antigen molecules has been described (see PCT Publication No. WO 01/77342 and Miller et al. (2003) J. Immunol.
170(9):4854-61).
[009] US Patent No.7,612,181 (incorporated herein by reference in its entirety) provides a novel family of binding proteins capable of binding two or more antigens with high affinity, which are called dual variable domain binding proteins (DVD-Ig binding protein) or dual variable domain immunoglobulins (DVD-Ig). DVD-Ig molecules are binding proteins that may be used to bind two distinct epitopes on the same molecule or two different molecules simultaneously. DVD-Ig molecules are unique binding proteins comprised of two variable domains fused to N-terminal constant regions. The variable domains may be directly fused to one another or connected via synthetic peptide linkers of assorted length and amino acid composition. DVD-Ig binding proteins may be engineered with intact and functional Fc domains, or otherwise modified constant domains, allowing them to mediate appropriate effector functions and exhibit other desired properties. The DVD-Ig format, due to its flexibility of choice of variable domain pair, orientation of two antigen-binding domains, and the length of the linker that joins them, may provide novel therapeutic modalities.
[010] Accordingly, while VEGF monotherapy has had some success in the art, there remains a need for constructs exhibiting better targeting, efficiency, and/or efficacy in binding to VEGF, as well as improved targeting of other pathways involved in inflammation (such as ocular inflammation), e.g., the PDGF pathway. Improved targeting of either of these molecules, alone or in combination, may lead to improvements in, e.g., preventing, diagnosing, and/or treating disorders such as angiogenic, inflammatory, and/or ocular disorders. Also, while a variety of structures have been provided in the art, with various advantages and disadvantages, new variable domain sequences can further improve the properties of binding proteins targeting VEGF and/or PDGF, or their cognate receptors.
Summary
[011] Disclosed herein are binding proteins capable of binding VEGF and/or PDGF, and/or their cognate receptors. In some embodiments, the binding proteins are antibodies to VEGF and/or PDGF, or antigen-binding fragments thereof. In some embodiments, the binding proteins are bispecific and capable of binding VEGF and PDGF. In some embodiments, the binding proteins comprise one or more sequences from any one of Tables A, 27-30, 38-42, 46-50, or 56-58, or the CDR amino acid residues from those sequences.
[012] In various embodiments, the bnding proteins are bispecific or multispecific binding proteins capable of binding one or more of VEGF and/or PDGF, and/or their cognate receptors. In some embodiments, the binding proteins are dual variable domain immunoglobulins (DVD-Igs or DVD-Ig binding proteins) using the binding protein framework disclosed in U.S. Patent No.7,612,181 (incorporated herein by reference in its entirety).
[013] In some embodiments, the DVD-Ig binding proteins contain particular first and second polypeptide chains, each comprising first and second variable domains comprising sequences (e.g., sequences selected from those listed in Tables A, 27-30, 38-42, 46-50, or 56-58, or the CDR amino acid residues from those sequences) that form functional binding sites for binding targets such as VEGF and/or PDGF, or their cognate receptors. In some embodiments, the first and second polypeptide chains of the binding protein each independently comprise VD1- (X1)n-VD2-C-X2, wherein VD1 is a first variable domain; VD2 is a second variable domain; C is a constant domain; X1 is a linker; X2 is an Fc region that is either present or absent; n is 0 or 1, and wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site for VEGF, PDGF, or a cognate receptor, and the VD2 domains on the first and second polypeptide chains form a second functional target binding site for VEGF, PDGF, or a cognate receptor. In some embodiments, (a) the first polypeptide chain of the binding protein comprises VD1-(X1)n-VD2-C-X2, wherein VD1 is a first heavy chain variable domain; VD2 is a second heavy chain variable domain; C is a heavy chain constant domain; X1 is a linker; X2 is an Fc region; and n is 0 or 1 (i.e., X1 and X2 are either present or absent, depending on whether n is independently chosen to be 0 or 1 for each position); and (b) the second polypeptide chain of the binding protein comprises VD1-(X1)n-VD2-C-X2, wherein VD1 is a first light chain variable domain; VD2 is a second light chain variable domain; C is a light chain constant domain; X1 is a linker; X2 is an Fc region; and n is 0 or 1 for X1 and n is 0 for X2 (i.e., the Fc region is absent on the second polypeptide chain); and (c) wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site for VEGF, PDGF, or a cognate receptor, and the VD2 domains on the first and second polypeptide chains form a second functional target binding site for VEGF, PDGF, or a cognate receptor. In some embodiments, the VD1 position forms a binding site for VEGF and the VD2 position forms a binding site for PDGF. In some embodiments, the CDR and/or variable domains at the VD1 and VD2 positions are antibody variable domains and the constant domains are antibody constant domains. Any of the CDR and/or variable domain and/or first and second polypeptide chain sequences disclosed herein may be incorporated in these DVD-Ig binding protein structures to form binding domains for VEGF and/or PDGF, and/or their cognate receptors.
[014] In some embodiments, both the first and second binding sites of a DVD-Ig construct disclosed herein target VEGF. In some embodiments, both the first and second binding sites target PDGF. In some embodiments, the first binding site targets VEGF and the second binding site targets PDGF. In some embodiments, the first binding site targets PDGF and the second binding site targets VEGF. In some embodiments, an Fc domain is present on one polypeptide chain and absent on the other, or absent on both polypeptide chains. In some embodiments, the sequences of the first and second variable domains on each polypeptide chain (i.e., the VD1 and VD2 positions) are independently selected from the sequences in Table A, 27- 30, 38-42, 46-50, or 56-58 to form functional binding sites. In some embodiments, the sequences of the first and second variable domains each contain the three complementarity determining regions (i.e., CDRs 1-3) from the selected sequences listed in Tables A, 27-30, 38-42, 46-50, or 56-58, and are arranged in the same order as shown in the Tables, thereby forming functional binding sites (i.e., the binding domains are capable of binding to their target antigen, VEGF or PDGF). In some embodiments, the paired variable domain sequences on the first and second polypeptide chains (i.e., the VD1 sequence on the first chain paired with the VD1 sequence on the second chain and the VD2 sequence on the first chain paired with the VD2 sequence on the second chain) form functional binding sites for binding targets VEGF and/or PDGF using the sequences in the Tables. In some embodiments, the binding proteins are capable of binding to VEGF and/or PDGF with improved binding affinity and/or neutralization potency, improved in vivo efficacy, improved expression, and/or improved drug-like properties (e.g., thermal stability, storage stability, solubility, etc.).
[015] Also disclosed herein are methods of making and using the claimed binding proteins, e.g., in the detection, inhibition, reduction, prevention, and/or treatment of cancers, tumors, fibrosis, renal disease, inflammation, age-related macular degeneration (AMD), wet AMD, diabetic retinopathy, other angiogenesis-dependent diseases, or angiogenesis-independent diseases characterized by aberrant VEGF and/or PDGF expression or activity.
Brief Description of the Drawings
[016] Fig.1A and Fig.1B are schematic representations of a Dual Variable Domain (DVD) binding protein construct.
[017] Fig.2A and Fig.2B show the reactivity of anti-PDGF-BB antibodies and anti- VEGF-A/anti-PDGF-BB DVD-Ig molecules to ECM-associated PDGF-BB.
[018] Fig.3 illustrates the inhibition of sprouting from a HUVEC/MSC co-culture sprouting assay by anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules.
[019] Fig.4 is a bar graph showing the area of subretinal neovascularization in Rho/huVEGF transgenic mice.
[020] Fig.5 is a bar graph showing the area of choroidal neovascularization in Rho/huVEGF transgenic mice.
[021] Fig.6 is a bar graph comparing choroidal neovascularization in the untreated eye among the different treatment groups.
[022] Fig.7 is a bar graph showing number of partial, total, and undetached eyes in Tet/opsin/VEGF mice.
Detailed Description
[023] Vascular endothelial growth factor (VEGF) is a signal protein that regulates physiological angiogenesis during embryogenesis, skeletal growth, and reproductive functions. Aberrant expression of VEGF is implicated in pathological angiogenesis and is associated with tumors, intraocular neovascular disorders, and other diseases. The VEGF family members include VEGF-A, placenta growth factor (PGF), VEGF-B, VEGF-C, and VEGF-D. Multiple isoforms of VEGF-A exist that result from alternative splicing of a single, 8-exon VEGFA gene. The biological effects of VEGF are mediated by various receptors, including two receptor tyrosine kinases, VEGF receptor-1 (VEGFR1) and VEGF receptor-2 (VEGFR2), which differ in their signaling properties. When cells are deficient in oxygen, they produce hypoxia-inducible factor (HIF) which releases VEGF and other mediators triggering a tyrosine kinase pathway leading to angiogenesis (Ferrara et al. (2003) Nat. Med.9:669-676). In various embodiments, the binding proteins disclosed herein can bind one or more of the VEGF family members, including alternate isoforms, and/or can bind one or more of the cognate VEGF receptors. [024] Platelet-derived growth factor (PDGF) is a protein that stimulates growth, survival, and motility of mesenchymal cells and certain other cell types. It has significant functions during embryonal development and in the control of blood vessel formation as an adult. PDGF is composed of a dimeric glycoprotein made up of two A (-AA), two B (-BB) chains, or a combination of the two (-AB). There are five different isoforms of PDGF that moderate cellular responses through two receptors, alpha (PDGFRA) and beta (PDGFRB) (Heldin (2013) Cell Commun. Sig.11:97). PDGF plays an important role in driving the proliferation of
undifferentiated mesenchyme and some progenitor populations. Overactivity or inappropriate PDGF signaling is associated with the development of certain malignant diseases, as well as non- malignant diseases characterized by excessive cell proliferation and other inflammatory disorders. In various embodiments, the binding proteins disclosed herein can bind one or more of the PDGF isoforms, and/or can bind one or more of the cognate PDGF receptors.
Binding Proteins
[025] Disclosed herein are binding proteins capable of binding one or more of VEGF, PDGF, and their cognate receptors. In some embodiments, the binding protein is an antibody or an antigen-binding fragment thereof. In an embodiment, the binding protein is an antibody, a monoclonal antibody, a murine antibody, a human antibody, a humanized antibody, a bispecific antibody, a chimeric antibody, a Fab, a Fab′, a F(ab′)2, an ScFv, an SMIP, an affibody, an avimer, a versabody, a nanobody, a fynomab, a domain antibody, or an antigen binding fragment of any of the foregoing. In an embodiment, the binding protein comprises antibody heavy chain variable domain sequences and antibody light chain variable domain sequences that are capable of binding one or more of VEGF, PDGF, and their cognate receptors. In an embodiment, the binding protein comprises the paired heavy and light chain variable domain sequences of any of the binding sites disclosed in Tables 27-30, 38-42, 46-50, or the CDR sequences from those variable domains. The CDR sequences of the variable domains in the Tables are identified in bold.
[026] In some embodiments, the binding proteins disclosed herein is bispecific or multispecific. The bispecific or multispecific construct may be monovalent or bivalent. Various bispecific or multispecific constructs are known in the art (see e.g., Spiess et al. (2015) Mol. Immunol.67; 95-106). Bispecific or multispecific constructs include, but are not limited to, an asymmetric bispecific antibody, an asymmetric bispecific IgG4, a CrossMab binding protein, a bispecific antibody, a bispecific binding protein, a multispecific binding protein, a DAF (dual action Fab antibody; two-in-one), a DAF (dual action Fab antibody; four-in-one), a DutaMab, a DT-IgG, a knobs-in-holes binding protein, a Charge pair binding protein, a Fab-arm exchange binding protein, a SEEDbody, a Triomab (Triomab quadroma bispecific or removab bispecific), a LUZ-Y, a Fcab, a κλ-body, an iMab (innovative multimer), and an Orthogonal Fab. In some embodiments, the bispecific or multispecific construct is a DVD-Ig binding protein, an IgG(H)- scFv, an scFv-(H)IgG, an IgG(L)-scFv, an scFv-(L)IgG, an IgG(L, H)-Fv, an IgG(H)-V, a V(H)- IgG, an IgG(L)-V, a V(L)-IgG, a KIH IgG-scFab, a 2scFv-IgG, an IgG-2scFv, an scFv4-Ig, a Zybody, or a DVI-IgG (four-in-one). In some embodiments, the bispecific or multispecific construct also can be a nanobody (or VHH), a bispecific tandem nanobody, a bispecific trivalent tandem nanobody, a nanobody-HSA, a BiTE (bispecific T-cell engager) binding protein, a Diabody, a DART (dual affinity retargeting) binding protein, a TandAb (tetravalent bispecifc tandem antibody), an scDiabody, an scDiabody-CH3, a Diabody-CH3, a Triple Body, a
Miniantibody, a Minibody, a TriBi minibody, an scFv-CH3 KIH, a Fab-scFv, an scFv-CH-CL- scFv, a F(ab’)2, a F(ab’)2 scFv2, an scFv-KIH, a Fab-scFv-Fc, a Tetravalent HCAb, an scDiabody-Fc, a Diabody-Fc, a Tandem scFv-Fc, a Fabsc, a bsFc-1/2, a CODV-Ig (cross-over dual variable immunoglobulin), a biclonics antibody or an Intrabody. Bispecific or multispecific constructs also include, for example, a Dock and Lock binding protein, an ImmTAC, an
HSAbody, an scDiabody-HSA, a Tandem scFv-Toxin, an IgG-IgG binding protein, a Cov-X- Body, and an scFv1-PEG-scFv2. In some embodiments, the bispecific or multispecific construct is a DVD-Ig binding protein, a CrossMab binding protein, a diabody, a tandem single-chain Fv molecule, a bispecific diabody, a single-chain diabody molecule, or a di-diabody. In some embodiments, the binding protein is a DVD-Ig binding protein. See, e.g., US Patent No.
7,612,181 (incorporated herein by reference in its entirety). The bispecific or multispecific construct may comprise one or more binding sites for VEGF, PDGF, and/or their receptors. The bispecific or multispecific construct may comprise binding sites only for VEGF, PDGF, and/or their receptors, or may comprise additional binding sites for other antigen targets. The bispecific or multispecific construct may comprise binding sites for more than one epitope on VEGF, PDGF, and/or their receptors, e.g., using different CDR sets or variable domains from those disclosed herein to form binding sites targeting different epitopes.
[027] In various embodiments, the binding protein is capable of binding VEGF, and comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO: 34, CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36, CDRs 1-3 from SEQ ID NO: 37 and CDRs 1-3 from SEQ ID NO: 38, CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40, CDRs 1-3 from SEQ ID NO: 41 and CDRs 1-3 from SEQ ID NO: 42, or CDRs 1-3 from SEQ ID NO: 43 and CDRs 1-3 from SEQ ID NO: 44. In an embodiment, the binding protein is capable of binding VEGF, and comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44. Any of said binding proteins capable of binding VEGF may also be capable of binding PDGF, and may comprise any of the PDGF binding sequences as described herein.
[028] In varous embodiments, the binding protein is capable of binding PDGF, and comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs 1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs 1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs 1-3 from SEQ ID NO: 8, CDRs 1- 3 from SEQ ID NO: 9 and CDRs 1-3 from SEQ ID NO: 10, CDRs 1-3 from SEQ ID NO: 11 and CDRs 1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs 1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs 1-3 from SEQ ID NO: 212. In an embodiment, the binding protein is capable of binding PDGF, and comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, or SEQ ID NO: 211 and SEQ ID NO: 212. Any of said binding proteins capable of binding PDGF may also be capable of binding VEGF, and may comprise any of the VEGF binding sequences as described herein.
[029] In an embodiment, the binding protein is a bispecific or multispecific antibody capable of binding one or more of VEGF, PDGF, and their cognate receptors, or another multispecific construct capable of binding the targets. In certain embodiments, the treatment is with bispecific antibodies that have been produced by quadroma technology (Milstein and Cuello (1983) Nature 305(5934): 537-40), by chemical conjugation of two different monoclonal antibodies (Staerz et al. (1985) Nature 314(6012): 628-31), or by knob-into-hole or similar approaches which introduces mutations in the Fc region (Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90(14): 6444-6448). In some embodiments, the multispecific binding protein is a dual variable domain immunoglobulin (DVD-Ig), e.g., as disclosed in U.S. Patent No.7,612,181 (incorporated herein by reference in their entirety). In an embodiment, the DVD-Ig binding protein comprises one or more binding sites comprising the paired heavy and light chain variable domain sequences of any of the binding sites disclosed in Tables 27-30, 38-42, 46-50, or 56-58, or the CDR sequences from those variable domains. For instance, a binding site for VEGF can comprise a paired set of heavy and light chain variable domain sequences from any one of Tables 27 or 38-42, or the CDR regions from those sequences, while the PDGF can comprise the paired heavy and light chain variable domain sequences in Tables 28 or 46-50, or the CDR regions from those sequences. The CDR regions of some of these sequences are shown in Table A and in Table 57.
[030] In some embodiments, a multispecific binding protein disclosed herein is capable of binding VEGF and PDGF, and allows for fewer injections or a lower concentration of active agent, as compared to combination antibody therapy.
[031] In some embodiments, the DVD-Ig binding protein comprises first and second polypeptide chains, each independently comprising VD1-(X1)n-VD2-C-X2, wherein: VD1 is a first variable domain; VD2 is a second variable domain; C is a constant domain; X1 is a linker; X2 is an Fc region that is either present or absent; n is independently 0 or 1 on the first and second chains, and wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site. In some embodiments, the binding protein is capable of binding one or more of VEGF, PDGF, and their cognate receptors, e.g., using a paired set of sequences from any one of Tables 27-30, 38-42, 46-50, or 56-58. In some embodiments, the binding protein comprises VD1 sequences on the first and second polypeptide chains (i.e., a VD1 sequence on the first chain paired with a VD1 sequence on the second chain) that together form a binding domain capable of binding a target selected from VEGF, PDGF, and their cognate receptors. In some embodiments, the binding protein is capable of binding VEGF at both the VD1 and VD2 positions. In some embodiments, the binding protein is capable of binding PDGF at both the VD1 and VD2 positions. In some embodiments, the binding protein is capable of binding VEGF at the VD1 position and PDGF at the VD2 position. In some embodiments, the binding protein is capable of binding PDGF at the VD1 position and VEGF at the VD2 position.
[032] When a binding protein comprises the CDRs from a sequence selected from any one of Tables 27-30, 38-42, 46-50, or 56-58, the CDRs are arranged in the order specified by the sequence in the Table and separated by suitable framework sequences to form a functional binding site. The paired sequences selected from the Tables that form a functional binding site for a target (e.g., a binding site for VEGF and/or PDGF), or the CDRs from those sequences, may be placed in either the VD1 or VD2 positions on the first and second polypeptide chains to form a binding site at either the VD1 or VD2 domain.
[033] The binding proteins disclosed herein comprise VD1 and VD2 binding domains that are capable of binding to first and second target antigens. As used herein, a VD1 domain or a VD2 domain, or a VD1 position or VD2 position, may refer to either the variable domain sequence on one polypeptide chain (e.g., a VD1 heavy chain sequence) or to the variable domain sequences on both the first and second polypeptide chain (e.g., a VD1 heavy chain sequence and a VD1 light chain sequence) that together form the functional binding site, as indicated by the context in which it is discussed.
[034] In some embodiments, a DVD-Ig binding protein can comprise two first and two second polypeptide chains forming four functional binding sites on two arms of the construct. An example of a four chain structure having two arms, each arm comprising a first and second polypeptide chain and two functional binding sites, is shown in Figure 1.
[035] In an embodiment, the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO: 34, CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36, CDRs 1-3 from SEQ ID NO: 37 and CDRs 1-3 from SEQ ID NO: 38, CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40, CDRs 1-3 from SEQ ID NO: 41 and CDRs 1-3 from SEQ ID NO: 42, or CDRs 1-3 from SEQ ID NO: 43 and CDRs 1-3 from SEQ ID NO: 44. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44.
[036] In an embodiment, a DVD-Ig binding protein is disclosed that is capable of binding VEGF and PDGF, wherein the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs 1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs 1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs 1-3 from SEQ ID NO: 8, CDRs 1-3 from SEQ ID NO: 9 and CDRs 1-3 from SEQ ID NO: 10, CDRs 1-3 from SEQ ID NO: 11 and CDRs 1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs 1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs 1-3 from SEQ ID NO: 212. In an embodiment, the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, or SEQ ID NO: 211 and SEQ ID NO: 212.
[037] In an embodiment, the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, CDRs 1-3 from SEQ ID NO: 19 and CDRs 1-3 from SEQ ID NO: 20, CDRs 1-3 from SEQ ID NO: 21 and CDRs 1-3 from SEQ ID NO: 22, CDRs 1-3 from SEQ ID NO: 23 and CDRs 1-3 from SEQ ID NO: 24, CDRs 1-3 from SEQ ID NO: 25 and CDRs 1-3 from SEQ ID NO: 26, CDRs 1-3 from SEQ ID NO: 27 and CDRs 1-3 from SEQ ID NO: 28, CDRs 1-3 from SEQ ID NO: 29 and CDRs 1-3 from SEQ ID NO: 30, CDRs 1-3 from SEQ ID NO: 31 and CDRs 1-3 from SEQ ID NO: 32, CDRs 1-3 from SEQ ID NO: 33 and CDRs 1-3 from SEQ ID NO: 34, CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36, CDRs 1-3 from SEQ ID NO: 37 and CDRs 1-3 from SEQ ID NO: 38, CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40, CDRs 1-3 from SEQ ID NO: 41 and CDRs 1-3 from SEQ ID NO: 42, or CDRs 1-3 from SEQ ID NO: 43 and CDRs 1-3 from SEQ ID NO: 44; and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs 1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs 1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs 1-3 from SEQ ID NO: 8, CDRs 1-3 from SEQ ID NO: 9 and CDRs 1-3 from SEQ ID NO: 10, CDRs 1-3 from SEQ ID NO: 11 and CDRs 1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs 1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs 1-3 from SEQ ID NO: 212. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, SEQ ID NO: 37 and SEQ ID NO: 38, SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or SEQ ID NO: 43 and SEQ ID NO: 44; and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, or SEQ ID NO: 211 and SEQ ID NO: 212.
[038] In various embodiments, the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36, and the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16. In any of these embodiments, the binding site for VEGF may be the outer binding domain or VD1 position as described herein, and the binding site for PDGF may be the inner domain or VD2 position as described herein. In various embodiments, any of the DVD-Ig binding proteins disclosed herein can comprise one or more of the X1 linkers shown in Table 55. In an embodiment, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker. In an embodiment, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker. In an embodiment, the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker.
[039] In various embodiments, any of the antibodies, binding proteins, or DVD-Ig binding proteins disclosed herein can comprise a human IgG (e.g., an IgG1) heavy chain constant region on the first polypeptide chain comprising substitutions of leucines at positions 234 and 235 with alanines, and optionally also (or alternatively) a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering. In various embodiments, the antibody, binding protein, or DVD-Ig binding protein can also comprise a human kappa or lambda light chain constant region on the second polypeptide chain. In an embodiment, the light chain comprises a wild-type human kappa light chain constant region sequence.
[040] In an embodiment, the DVD-Ig binding protein is capable of binding VEGF and PDGF, and comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132). In an embodiment, the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. In an embodiment, the binding protein comprises an IgG1 constant region with substitution of leucines at positions 234 and 235 with alanines, and a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. In some embodiments, the L234A, L235A, and H435 mutations are present in a DVD-Ig binding protein comprising PR-1610561 (comprising SEQ ID NOs: 131 and 132). In some embodiments, the binding protein carrying the constant region mutations has increased ocular duration over an antibody, but is rapidly cleared from systemic circulation (e.g., by altering FcRn recognition), as compared to an antibody or as compared to the same binding protein lacking the constant region mutations. In some embodiments, the high ocular duration allows for less frequent administration and/or fewer overall injections while achieving a comparable or improved efficacy as compared to administration of a combination of anti-VEGF and anti-PDGF antibodies or as compared to administration of the binding protein lacking the constant region mutations. In some embodiments, the binding protein carrying the constant region mutations has decreased ADCC and CDC effector functions mediated by binding to extracellular matrix-associated VEGF-A and/or PDGF-BB, as compared to administration of the binding protein lacking the constant region mutations. In some embodiments, the binding protein carrying the constant region mutations does not bind to one or more Fc-gamma receptors. In some embodiments, systemic levels of the binding protein in a patient drops below detectable levels after less than 20, 25, 30, 35, or 40 hours following administration at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mg/kg, or more (or any concentration in between) in an intravenous bolus dose.
[041] In an embodiment, the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2. In an embodiment, the DVD-Ig binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40, and the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16. In any of these embodiments, the binding site for VEGF may be the outer binding domain or VD1 sequence as described herein, and the binding site for PDGF may be the inner domain or VD2 sequence as dscribed herein. In various embodiments, the binding proteins can comprise one or more of the X1 linkers shown in Table 55. In an embodiment, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker. In an embodiment, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker. In an embodiment, the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker. In an embodiment, the binding protein is capable of binding VEGF and PDGF, and comprises PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142). In an embodiment, the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
[042] In an embodiment, the DVD-Ig binding protein comprises the first and second polypeptide chains of any of the DVD-Ig binding proteins disclosed in Tables 56-58. The CDR sequences of the variable domains in Tables 56-58 are in bold and the linker sequences are italicized.
[043] In an embodiment, the DVD-Ig binding protein comprises the first and second polypeptide chains of PR-1563988 (comprising SEQ ID NOs: 45 and 46), PR-1563990
(comprising SEQ ID NOs: 47 and 48), PR-1563998 (comprising SEQ ID NOs: 49 and 50), PR- 1564009 (comprising SEQ ID NOs: 51 and 52), PR-1564010 (comprising SEQ ID NOs: 53 and 54), PR-1564011 (comprising SEQ ID NOs: 55 and 56), PR-1564012 (comprising SEQ ID NOs: 57 and 58), PR-1564013 (comprising SEQ ID NOs: 59 and 60), PR-1565031 (comprising SEQ ID NOs: 76 and 77), PR-1565032 (comprising SEQ ID NOs: 78 and 79), PR-1565035 (comprising SEQ ID NOs: 80 and 81), PR-1572102 (comprising SEQ ID NOs: 88 and 89), PR-1572103 (comprising SEQ ID NOs: 90 and 91), PR-1572104 (comprising SEQ ID NOs: 92 and 93), PR- 1572105 (comprising SEQ ID NOs: 94 and 95), PR-1572106 (comprising SEQ ID NOs: 96 and 97), PR-1575832 (comprising SEQ ID NOs: 99 and 100), PR-1575834 (comprising SEQ ID NOs: 101 and 102), PR-1575835 (comprising SEQ ID NOs: 103 and 104), PR-1577165 (comprising SEQ ID NOs: 105 and 106), PR-1577166 (comprising SEQ ID NOs: 107 and 108), PR-1577547 (comprising SEQ ID NOs: 109 and 110), PR-1577548 (comprising SEQ ID NOs: 111 and 112), PR-1577550 (comprising SEQ ID NOs: 113 and 114), PR-1578137 (comprising SEQ ID NOs: 116 and 117), PR-1610560 (comprising SEQ ID NOs: 129 and 130), PR-1610561 (comprising SEQ ID NOs: 131 and 132), PR-1610562 (comprising SEQ ID NOs: 133 and 134), PR-1610563 (comprising SEQ ID NOs: 135 and 136), PR-1611291 (comprising SEQ ID NOs: 139 and 140), PR-1611292 (comprising SEQ ID NOs: 141 and 142), PR-1612489 (comprising SEQ ID NOs: 161 and 162), PR-1612491 (comprising SEQ ID NOs: 163 and 164), PR-1612492 (comprising SEQ ID NOs: 165 and 166), PR-1612495 (comprising SEQ ID NOs: 171 and 172), PR-1612496 (comprising SEQ ID NOs: 173 and 174), PR-1612499 (comprising SEQ ID NOs: 177 and 178), PR-1612500 (comprising SEQ ID NOs: 179 and 180), PR-1612501 (comprising SEQ ID NOs: 181 and 182), PR-1612502 (comprising SEQ ID NOs: 183 and 184), PR-1613183 (comprising SEQ ID NOs: 185 and 186), PR-1613184 (comprising SEQ ID NOs: 187 and 188), PR-1613185 (comprising SEQ ID NOs: 189 and 190), PR-1613190 (comprising SEQ ID NOs: 199 and 200), PR-1565040 (comprising SEQ ID NOs: 209 and 210), PR-1565042 (comprising SEQ ID NOs: XX and YY), PR-1565044 (comprising SEQ ID NOs: 213 and 214), PR-1565051 (comprising SEQ ID NOs: 215 and 216), PR-1565083 (comprising SEQ ID NOs: 217 and 218), PR-1565084 (comprising SEQ ID NOs: 219 and 220), PR-1565085 (comprising SEQ ID NOs: 221 and 222), PR-1565086 (comprising SEQ ID NOs: 223 and 224), PR-1571821 (comprising SEQ ID NOs: 225 and 226), PR-1571823 (comprising SEQ ID NOs: 227 and 228), PR-1575521 (comprising SEQ ID NOs: 229 and 230), PR-1571824 (comprising SEQ ID NOs: 231 and 232), PR-1571825 (comprising SEQ ID NOs: 233 and 234), PR-1571826 (comprising SEQ ID NOs: 235 and 236), PR-1571827 (comprising SEQ ID NOs: 237 and 238), PR-1571828 (comprising SEQ ID NOs: 239 and 240), PR-1571830 (comprising SEQ ID NOs: 241 and 242), PR-1571831 (comprising SEQ ID NOs: 243 and 244), PR-1571832 (comprising SEQ ID NOs: 245 and 246), PR-1571836 (comprising SEQ ID NOs: 247 and 248), PR-1577053 (comprising SEQ ID NOs: 249 and 250), or PR-1577056 (comprising SEQ ID NOs: 251 and 252.
[044] In some embodiments, a binding protein, including a DVD-Ig binding protein, antibody, or fragment thereof, is capable of binding VEGF and/or PDGF and has at least about 80%, 90%, 95%, or 99% homology to CDRs 1-3 or to the full variable domains of any of the sequences in Tables 27, 28, 38-42, or 46-50. As used herein, the term percent (%) homology defines the percentage of residues in the amino acid sequence variant that are identical after aligning the sequences and introducing gaps and other spacing, e.g., using the BLAST alignment software.
[045] In an embodiment, the binding protein has an on rate constant (Kon) to one or more targets of at least about 102M-1s-1; at least about 103M-1s-1; at least about 104M-1s-1; at least about 105M-1s-1; or at least about 106M-1s-1, as measured by surface plasmon resonance. In an embodiment, the binding protein has an on rate constant (Kon) to one or more targets from about 102M-1s-1 to about 103M-1s-1; from about 103M-1s-1 to about 104M-1s-1; from about 104M-1s-1 to about 105M-1s-1; or from about 105M-1s-1 to about 106M-1s-1, as measured by surface plasmon resonance.
[046] In an embodiment, the binding protein has an off rate constant (Koff) for one or more targets of at most about 10-3s-1; at most about 10-4s-1; at most about 10-5s-1; or at most about 10-6s-1, as measured by surface plasmon resonance. In an embodiment, the binding protein has an off rate constant (Koff) to one or more targets of about 10-3s-1 to about 10-4s-1; of about 10-4s-1 to about 10-5s-1; or of about 10-5s-1 to about 10-6s-1, as measured by surface plasmon resonance.
[047] In an embodiment, the binding protein has a dissociation constant (Kd) to one or more targets of at most about 10-7M; at most about 10-8M; at most about 10-9M; at most about 10-10M; at most about 10-11M; at most about 10-12M; or at most 10-13M. In an embodiment, the binding protein has a dissociation constant (Kd) to its targets of about 10-7M to about 10-8M; of about 10-8M to about 10-9M; of about 10-9M to about 10-10M; of about 10-10M to about 10-11M; of about 10-11M to about 10-12M; or of about 10-12 to M about 10-13M. [048] In an embodiment, the binding protein is a conjugate further comprising an agent. In an embodiment, the agent is an immunoadhesion molecule, an imaging agent, a therapeutic agent, or a cytotoxic agent. In an embodiment, the imaging agent is a radiolabel, an enzyme, a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, or biotin. In another embodiment, the radiolabel is 3H 14
, C 35
, S, 90Y, 99Tc, 111In, 125I, 131I, 177Lu, 166Ho, or 153Sm. In yet another embodiment, the therapeutic or cytotoxic agent is an anti-metabolite, an alkylating agent, an antibiotic, a growth factor, a cytokine, an anti-angiogenic agent, an anti- mitotic agent, an anthracycline, toxin, or an apoptotic agent, or an immunosuppressive agent.
[049] In an embodiment, the binding protein is a crystallized binding protein and exists as a crystal. In an embodiment, the crystal is a carrier-free pharmaceutical controlled release crystal. In another embodiment, the crystallized binding protein has a greater half-life in vivo than the soluble counterpart of the binding protein. In yet another embodiment, the crystallized binding protein retains biological activity.
[050] In certain embodiments, a binding protein disclosed herein can compete for binding to VEGF, PDGF, and/or a cognate receptor with any of the antibodies, binding proteins, or bispecific antibodies disclosed herein. In certain embodiments, a binding protein disclosed herein can compete for binding with an antibody, binding protein, or bispecific antibody comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50. In certain embodiments, a binding protein disclosed herein can compete for binding with PR-1610561 (comprising SEQ ID NOs: 131 and 132) or a binding protein comprising the CDRs and/or variable domains of PR-1610561. In certain embodiments, a binding protein disclosed herein can compete for binding with PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
[051] According to certain embodiments, a binding protein disclosed herein can bind to the same epitope of VEGF, PDGF, and/or a cognate receptor as any of the antibodies, binding proteins, or bispecific antibodies disclosed herein. In certain embodiments, a binding protein disclosed herein can bind to the same epitope of VEGF, PDGF, and/or a cognate receptor bound by an antibody, binding protein, or bispecific antibody comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50. In certain embodiments, a binding protein disclosed herein can bind to the same epitope as PR-1610561 (comprising SEQ ID NOs: 131 and 132) or a binding protein comprising the CDRs and/or variable domains of PR- 1610561. In certain embodiments, a binding protein disclosed herein binds to the same epitope as PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142). [052] In certain embodiments, competitive binding can be evaluated using a cross- blocking assay, such as the assay described in ANTIBODIES, A LABORATORY MANUAL, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1st edition 1988, 2nd edition 2014). In some embodiments, competitive binding is identified when a test antibody or binding protein reduces binding of a reference antibody or binding protein (e.g., a binding protein comprising CDRs and/or variable domains selected from those identified in Tables 27, 28, 38-42, or 46-50) to VEGF, PDGF, and/or a cognate receptor by at least about 50% in the cross-blocking assay (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.5%, or more, or any percentage in between), and/or vice versa. In some embodiments, competitive binding can be due to shared or similar (e.g., partially overlapping) epitopes, or due to steric hindrance where antibodies or binding proteins bind at nearby epitopes. See, e.g., Tzartos, Methods in Molecular Biology, vol.66, Epitope Mapping Protocols, pages 55-66, Humana Press Inc. (1998). In some embodiments, competitive binding can be used to sort groups of binding proteins that share similar epitopes, e.g., those that compete for binding can be“binned” as a group of binding proteins that have overlapping or nearby epitopes, while those that do not compete are placed in a separate group of binding proteins that do not have overlapping or nearby epitopes
[053] In an embodiment, the binding protein described herein is glycosylated. For example, the glycosylation pattern may be a human glycosylation pattern.
[054] In various embodiments, a pharmaceutical composition comprising a binding protein disclosed herein and a pharmaceutically acceptable carrier is provided. In a further embodiment, the pharmaceutical composition comprises at least one additional agent such as a therapeutic agent for treating a disorder or a diagnostic agent. For example, the additional agent may be a therapeutic agent, an imaging agent, a cytotoxic agent, an angiogenesis inhibitor (including but not limited to an anti-VEGF antibody or a VEGF-trap), a kinase inhibitor (including but not limited to a KDR and a TIE-2 inhibitor), a co-stimulation molecule blocker (including but not limited to anti-B7.1, anti-B7.2, CTLA4-Ig, anti-CD20), an adhesion molecule blocker (including but not limited to an anti-LFA-1 antibody, an anti-E/L selectin antibody, a small molecule inhibitor), an anti-cytokine antibody or functional fragment thereof (including but not limited to an anti-IL-18, an anti-TNF, and an anti-IL-6/cytokine receptor antibody), methotrexate, cyclosporin, rapamycin, FK506, a detectable label or reporter, a TNF antagonist, an antirheumatic, a muscle relaxant, a narcotic, a non-steroid anti-inflammatory drug (NSAID), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial, an antipsoriatic, a corticosteriod, an anabolic steroid, an erythropoietin, an immunoglobulin, an immunosuppressive, a growth hormone, a hormone replacement drug, a radiopharmaceutical, an antidepressant, an antipsychotic, a stimulant, an asthma medication, a beta agonist, an inhaled steroid, an epinephrine or analog, a cytokine, or a cytokine antagonist. [055] In various embodiments, a binding protein disclosed herein binds to VEGF and comprises CDRs and/or variable domains selected from those identified in Tables A, 2.4.1-2.4.9, 27, and 38-42. In some embodiments, the binding protein comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 2.4.1-2.4.9, 27, and 38-42. In some embodiments, the binding protein comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42. In some embodiments, the binding protein is a bispecific or multispecific binding protein, comprising CDRs and/or variable domains selected from Tables A, 2.4.1-2.4.9, 27, and 38-42. The binding protein may further comprise heavy and light chain constant domains selected from Table 3. In some embodiments, the binding protein is also capable of binding to PDGF.
[056] In some embodiments, a binding protein disclosed herein binds to PDGF and comprises CDRs and/or variable domains selected from those identified in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding protein comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding protein comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding protein is a bispecific or multispecific binding protein, comprising CDRs and/or variable domains selected from Tables A, 1.4.1-1.4.7, 28, and 46-50. The binding protein may further comprise heavy and light chain constant domains selected from Table 3. In some embodiments, the binding protein is also capable of binding to VEGF.
[057] In some embodiments, a binding protein disclosed herein binds to VEGF and PDGF, wherein the binding site for VEGF comprises CDRs and/or variable domains selected from those identified in Tables A, 2.4.1-2.4.9, 27, and 38-42 and the binding site for PDGF comprises CDRs and/or variable domains selected from those identified in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding sites for VEGF and PDGF comprises CDRs and/or variable domains selected from any of the variable domains listed in Tables 56-59, 95, and 96. In some embodiments, binding proteins disclosed herein comprise binding sites for VEGF and PDGF comprising the paired CDRs and/or variable domains from any one of the bispecific binding proteins selected from Tables 56-59, 95, and 96. In some embodiments, the binding proteins are DVD-Ig binding proteins, or any of the other bispecific or multispecific formats disclosed herein. The binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55. The binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3. [058] In some embodiments, a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1- 1.4.7, 28, and 46-50. In some embodiments, the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40, and the binding site for PDGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36, and the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50. In some embodiments, the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40, and the binding site for PDGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 1.4.1-1.4.7, 28, and 46-50. The binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55. The binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
[059] In some embodiments, a binding protein is capable of binding VEGF and PDGF, wherein the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs- 1-3 from SEQ ID NO: 2, and the binding site for VEGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1-2.4.9, 27, and 38-42. In some embodiments, the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16, and the binding site for VEGF comprises a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1- 2.4.9, 27, and 38-42. In some embodiments, the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2, and the binding site for VEGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42. In some embodiments, the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16, and the binding site for VEGF comprises a heavy chain variable domain and paired light chain variable domain selected from any of the variable domains listed in Tables A, 2.4.1-2.4.9, 27, and 38-42. The binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55. The binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
[060] In some embodiments, a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs- 1-3 from SEQ ID NO: 18, and the binding site PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2. In some embodiments, the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16. In some embodiments, the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 39 and CDRs-1- 3 from SEQ ID NO: 40, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16. The binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55. The binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
[061] In some embodiments, a binding protein is capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2. In some embodiments, the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36, and the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16. In some embodiments, the binding site for VEGF comprises SEQ ID NO: 39 and SEQ ID NO: 40, and the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16. The binding protein described herein may further comprise one or more linkers between the VEGF and PDGF binding sites, wherein the linkers comprise sequences that are selected from Table 55. The binding protein described herein may also comprise heavy and light chain constant domains selected from Table 3.
[062] In some embodiments, the binding protein is a DVD-Ig binding protein, capable of binding VEGF and PDGF. In some embodiment, the heavy chain of the binding protein comprises a DVD-Ig heavy chain variable domain and paired DVD-Ig light chain variable domain selected from Tables 56-59, 95, and 96. In some embodiments, the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 131 and SEQ ID NO: 132. In some embodiments, the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 88 and SEQ ID NO: 89. In some embodiments, the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 94 and SEQ ID NO: 95. In some embodiments, the binding protein comprises DVD-Ig heavy and light chain variable domains of SEQ ID NO: 141 and SEQ ID NO: 142. The DVD-Ig binding protein described herein may further comprise heavy and light chain constant domains selected from Table 3.
[063] In certain embodiments, a binding protein disclosed herein is a DVD-Ig binding protein, comprising first and second polypeptide chains of SEQ ID NO: 131 and SEQ ID NO: 132. In some embodiments, the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 88 and SEQ ID NO: 89. In some embodiments, the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 94 and SEQ ID NO: 95. In some embodiments, the DVD-Ig binding protein comprises first and second polypeptide chains of SEQ ID NO: 141 and SEQ ID NO: 142.
Binding Protein Properties
[064] The development and production of a binding protein for use as a human therapeutic agent, e.g., as an anti-inflammatory agent or oncologic agent, may require more than the identification of a binding protein capable of binding to a desired target or targets. The binding proteins disclosed herein exhibit favorable properties in one or more of the following categories (a) the binding kinetics (on-rate, off-rate and affinity) for both the inner and outer antigen-binding domains, (b) potencies in various biochemical and cellular bioassays, (c) in vivo efficacies in relevant tumor models, (d) pharmacokinetic and pharmacodynamics properties, (e) manufacturability, including protein expression level in selected cell lines, scalability, post- translational modification, physicochemical properties such as monomer percentage, solubility, and stability (intrinsic, freeze/thaw, storage stability, etc.), (f) formulation properties, (g) potential immunogenicity risk, (h) toxicological properties, and (i) binding mode and valency. Binding mode and valency may affect binding properties and cellular potencies of a molecule.
[065] The binding proteins disclosed herein exhibit favorable properties in some or each of the categories listed above, including surprisingly high binding affinity at both the VD1 and VD2 positions.
[066] In some embodiments a binding protein or binding proteins disclosed herein targeting VEGF and PDGF serve to both reduce choroidal neovascularization and increase regression of mature vasculature, e.g., in ocular conditions such as AMD. In some embodiments a binding protein or binding proteins disclosed herein targeting VEGF and PDGF neutralize VEGF and PDGF simultaneously. In some embodiments, the binding protein exhibits one or more of high potency to VEGF and/or PDGF, extended ocular duration, and rapid clearance from systemic circulation. In some embodiments, the binding protein is a bispecific and allows for a single injection of an agent to both targets (VEGF and PDGDF), reducing injection
volume/frequency while still retaining the drug-like products of a traditional antibody. [067] In some embodiments, the disclosed binding protein exhibits superior in vivo efficacy (e.g., in a preclinical model of choroidal neovascularization or AMD) as compared to existing treatments for AMD (e.g., Elyea™ and/or Lucentis™). In some embodiments, the disclosed binding protein is a DVD-Ig binding protein and exhibits a high ocular duration. In some embodiments, the DVD-Ig binding protein may be, e.g., 150-200 kDa in weight or greater, and may provide for a longer ocular duration as compared to lower weight agents such as monoclonal antibodies. In some embodiments, the binding protein disclosed herein is a DVD-Ig binding protein and has an ocular half life of at least about 4 days, or at least about 4.6 days, or at least about 5 days, or at least about 6 days, or at least about 6.5 days, or more. In some embodiments, the DVD-Ig ocular half life is greater than the half-life of an antibody or other construct having a smaller size, while retaining a more rapid systemic clearance similar to that of the antibody. In some embodiments, the DVD-Ig binding protein has an ocular half life of at least about 4 (or at least about 4.6) days after intravitreoius administration at 0.25 mg.
[068] In some embodiments, the disclosed binding proteins are DVD-Ig binding proteins and exhibit improved drug-like properties, including one or more of high theromstability (e.g., a Tonset of greater than 50°, 55°, 60°, 61°, 62°, 63°, 64°, or 65° C), a solubility of at least about 70, 72, 74, 76, 78, or 80 mg/ml, a viscosity at room temperature and at a concentration of 100 mg/ml of about 7.2 centipoise, an effective storage stability in a universal buffer, and/or high freeze-thaw stability. In some embodiments, the DVD-Ig binding protein does not exhibit a significant change in monomer percentage at low concentration after storage at 5°C or 40°C for 10, 15, 20, 21, 22, 23, 24, 25, or more days, and/or does not exhibit a significant increase in aggregation at 50-150 mg/ml (or 100 +/-10 mg/ml) after 1, 2, 3, 4, 5, or more freeze/thaw cycles.
[069] In certain embodiments, a binding protein exhibiting particularly favorable properties in some or each of the categories listed above is a DVD-Ig binding protein capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 35 and SEQ ID NO: 36, and the binding site for PDGF comprises SEQ ID NO: 15 and SEQ ID NO: 16. In an embodiment, the binding protein is capable of binding VEGF and PDGF, and comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132). In an embodiment, the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence
[070] In certain embodiments, a binding protein exhibiting particularly favorable properties in some or each of the categories listed above is a DVD-Ig binding protein capable of binding VEGF and PDGF, wherein the binding site for VEGF comprises CDRs 1-3 from SEQ ID NO: 17 and CDRs-1-3 from SEQ ID NO: 18, and the binding site for PDGF comprises CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2. In an embodiment, the binding site for VEGF comprises SEQ ID NO: 17 and SEQ ID NO: 18, and the binding site for PDGF comprises SEQ ID NO: 1 and SEQ ID NO: 2. In an embodiment, the binding protein is capable of binding VEGF and PDGF, and comprises PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR- 1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142). In an embodiment, the binding protein comprises a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence.
[071] For instance, in some embodiments, the binding protein disclosed herein (e.g., PR-1610561, PR-1572102, PR-1572105, or PR1611292) may exhibit one or more of the following features: enhanced in vivo efficacy in human VEGF transgenic mice, enhanced potency (as measured, e.g., via BIACORE, ELISA, or co-culture sprouting assay), improved expression (e.g., in HEK293 or CHO cells), and improved drug-like properties (e.g., thermal stability, storage stability, solubility, physicochemical properties, and/or pharmacokinetics) as compared to another binding protein or combination of binding proteins targeting VEGF and PDGF.
Preparation of Binding Proteins
[072] In another aspect, the disclosure provides a method of making a binding protein that binds PDGF, VEGF, and/or either or both cognate receptors. In an embodiment, the method of making a binding protein comprises the steps of a) obtaining a first parent antibody, or antigen binding portion thereof, that binds PDGF, VEGF, or a cognate receptor; b) obtaining a second parent antibody, or antigen binding portion thereof, that binds PDGF, VEGF, or a cognate receptor; c) determining the sequences of the variable domains of the parent antibodies or antigen binding portions thereof; d) preparing construct(s) encoding any of the binding proteins described herein using those variable domain sequences; and e) expressing the polypeptide chains, such that a binding protein that binds PDGF, VEGF, and/or either or both cognate receptors is generated. [073] In any of the embodiments herein, the VD1 heavy chain variable domain, if present, and light chain variable domain, if present, can be from a first parent antibody or antigen binding portion thereof; the VD2 heavy chain variable domain, if present, and light chain variable domain, if present, can be from a second parent antibody or antigen binding portion thereof. The first and second parent antibodies can be the same or different.
[074] In one embodiment, the first parent antibody or antigen binding portion thereof, binds a first antigen, and the second parent antibody or antigen binding portion thereof, binds a second antigen. In an embodiment, the first and second antigens are the same antigen. In another embodiment, the parent antibodies bind different epitopes on the same antigen. In another embodiment, the first and second antigens are different antigens. In another embodiment, the first parent antibody or antigen binding portion thereof, binds the first antigen with a potency different from the potency with which the second parent antibody or antigen binding portion thereof, binds the second antigen. In yet another embodiment, the first parent antibody or antigen binding portion thereof, binds the first antigen with an affinity different from the affinity with which the second parent antibody or antigen binding portion thereof, binds the second antigen.
[075] In another embodiment, the first parent antibody or antigen binding portion thereof, and the second parent antibody or antigen binding portion thereof, are a human antibody, CDR grafted antibody, humanized antibody, and/or affinity matured antibody. The“parent antibody”, which provides at least one antigen binding specificity of the multivalent and or multispecific binding protein, may be one that is internalized (and/or catabolized) by a cell expressing an antigen to which the antibody binds; and/or may be an agonist, cell death-inducing, and/or apoptosis-inducing antibody, and the multivalent and or multispecific binding protein as described herein may display improvement(s) in one or more of these properties. Moreover, the parent antibody may lack any one or more of these properties, but may acquire one or more of them when constructed as a multivalent binding protein as described herein. For example, different Fc mutants may prevent FcR, FcR-gamma, complement, or C’ binding, or extend half- life.
[076] In various embodiments, an isolated nucleic acid encoding any one of the binding proteins disclosed herein is also provided. Also provided is a composition comprising one or more nucleic acids wherein said one or more nucleic acids encode a nucleic acid encoding any one of the binding proteins disclosed herein. For example, the composition may comprise a nucleic acid that encodes a first polypeptide and a nucleic acid that encodes a second polypeptide, wherein said first and second polypeptide together form a binding protein as described herein. A further embodiment provides a vector (e.g., an expression vector) comprising the isolated nucleic acid disclosed herein. Also provided is a vector (e.g. an expression vector) that comprises one or more nucleic acids that encode a binding protein as described herein. Also provided is a composition comprising one or more vectors that encode a binding protein as escribd herein. For example, the composition may comprise a vector that encodes a first polypeptide and a vector that encodes a second polypeptide, wherein said first and second polypeptide together form a binding protein as described herein. In some embodiments, the vector is pcDNA; pTT (Durocher et al. (2002) Nucleic Acids Res.30(2):e9; pTT3 (pTT with additional multiple cloning site;
pEFBOS (Mizushima and Nagata (1990) Nucleic Acids Res.18:17); pBV; pJV; pcDNA3.1 TOPO; pEF6 TOPO; pBOS; pHybE; or pBJ. In an embodiment, the vector is a vector disclosed in U.S. Patent No.8,187,836.
[077] In another aspect, a host cell is transformed with the vector disclosed herein. In an embodiment, the host cell is a prokaryotic cell, for example, E.coli. In another embodiment, the host cell is a eukaryotic cell, for example, a protist cell, an animal cell, a plant cell, or a fungal cell. In an embodiment, the host cell is a mammalian cell including, but not limited to, CHO, COS, NS0, SP2, PER.C6, or a fungal cell, such as Saccharomyces cerevisiae, or an insect cell, such as Sf9. In an embodiment, two or more binding proteins, e.g., with different specificities, are produced in a single recombinant host cell. For example, the expression of a mixture of antibodies has been called Oligoclonics™ (Merus B.V., The Netherlands) disclosed in U.S. Patent Nos.7,262,028 and 7,429,486.
[078] In various embodiments, a binding proteins disclosed herein can be prepared by culturing any one of the host cells disclosed herein in a culture medium under conditions sufficient to produce the binding protein.
[079] One embodiment provides a composition for the release of a binding protein wherein the composition comprises a crystallized binding protein, an ingredient, and at least one polymeric carrier. In an embodiment, the polymeric carrier is poly (acrylic acid), a poly
(cyanoacrylate), a poly (amino acid), a poly (anhydride), a poly (depsipeptide), a poly (ester), poly (lactic acid), poly (lactic-co-glycolic acid) or PLGA, poly (b-hydroxybutryate), poly
(caprolactone), poly (dioxanone), poly (ethylene glycol), poly ((hydroxypropyl) methacrylamide, poly [(organo)phosphazene], a poly (ortho ester), poly (vinyl alcohol), poly (vinylpyrrolidone), a maleic anhydride- alkyl vinyl ether copolymer, a pluronic polyol, albumin, alginate, cellulose, a cellulose derivative, collagen, fibrin, gelatin, hyaluronic acid, an oligosaccharide, a
glycaminoglycan, a sulfated polysaccharide, or blends and copolymers thereof. In an embodiment, the ingredient is albumin, sucrose, trehalose, lactitol, gelatin, hydroxypropyl-β- cyclodextrin, methoxypolyethylene glycol, or polyethylene glycol.
[080] The binding proteins provided herein, such as DVD-Ig binding proteins, may be produced by any of a number of techniques known in the art. For example, expression from host cells, wherein expression vector(s) encoding the DVD-Ig heavy and DVD-Ig light chains is (are) transfected into a host cell by standard techniques. Although it is possible to express the DVD-Ig binding proteins provided herein in either prokaryotic or eukaryotic host cells, DVD-Ig binding proteins are preferably expressed in eukaryotic cells, for example, mammalian host cells.
[081] In an exemplary system for recombinant expression of DVD-Ig proteins, a recombinant expression vector encoding both the DVD-Ig heavy chain and the DVD-Ig light chain is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection. Within the recombinant expression vector, the DVD-Ig heavy and light chain sequences are each operatively linked to CMV enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes. The recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification. The selected transformant host cells are cultured to allow for expression of the DVD-Ig heavy and light chains and intact DVD-Ig protein is recovered from the culture medium. Standard molecular biology techniques may be used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the DVD-Ig protein from the culture medium. In some embodiments, a method of synthesizing a DVD-Ig binding protein by culturing a host cell provided herein in a suitable culture medium until a DVD-Ig binding protein is synthesized is also provided. The method may further comprise isolating the DVD-Ig protein from the culture medium.
[082] A feature of a DVD-Ig binding protein is that it can be produced and purified in a similar way to a conventional antibody. The design of the full length DVD-Ig binding protein heavy and light chains provided herein leads to assemble primarily to the desired dual-specific multivalent full length binding proteins. In an embodiment, 50%-75% of the binding protein produced by this method is a dual specific tetravalent binding protein (e.g., a DVD-Ig binding protein). In another embodiment, 75%-90% of the binding protein produced by this method is a dual specific tetravalent binding protein. In another embodiment, 90%-95% of the binding protein produced is a dual specific tetravalent binding protein. In some embodiments, at least 50%, at least 75% and at least 90% of the assembled, and expressed dual variable domain immunoglobulin molecules are the desired dual-specific tetravalent protein.
[083] In various embodiments, the disclosure provides methods of expressing a dual variable domain light chain and a dual variable domain heavy chain in a single cell leading to a primary product of a dual-specific tetravalent full length binding protein, where the primary product is more than 50%, such as more than 75% and more than 90%, of all assembled protein, comprising a dual variable domain light chain and a dual variable domain heavy chain. Therapeutic and Diagnostic Uses
[084] Also disclosed herein, in various embodiments, are methods for diagnosing and treating a mammal (e.g., a human) comprising the step of administering to the mammal, or a sample taken from the mammal, an effective amount of a composition disclosed herein. A binding protein as described herein may be used in a method for therapy or diagnosis.
[085] Given their ability to bind VEGF, PLGF, and/or their cognate receptors, in some embodiments, the binding proteins provided herein can be used to detect one or more of those antigens (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), a radioimmunoassay (RIA), or tissue immunohistochemistry. The binding protein is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody. Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin. An example of a luminescent material is luminol and examples of suitable radioactive materials include 3H 14
, C, 35S, 90Y, 99Tc, 111In, 125I, 131I, 177Lu, 166Ho, and 153Sm.
[086] In some embodiments, a method is disclosed for treating a human subject suffering from a disorder in which the target, or targets, capable of being bound by the binding proteins disclosed herein is/are detrimental, comprising administering to the human subject a binding protein disclosed herein such that the activity of the target, or targets, in the human subject is inhibited and one or more symptoms is alleviated or treatment is achieved is provided. In various embodiments, treatment comprises reducing, improving, or ameliorating one or more symptom of a disorder. Treatment includes but does not necessarily require curing (i.e., completely eliminating) a disorder or a symptom of a disorder.
[087] The binding proteins provided herein can be used to treat humans suffering from diseases such as, for example, those associated with increased angiogenesis and/or inflammation (e.g., ocular inflammation). In an embodiment, the binding proteins provided herein or antigen-binding portions thereof, are used to treat an autoimmune disorder, asthma, ocular inflammation, Crohn's disease, ulcerative colitis, inflammatory bowel disease (IBD), insulin dependent diabetes mellitus, rheumatoid arthritis, osteoarthritis, systemic lupus erythematosus (SLE), multiple sclerosis, sepsis, a neurodegenerative disease, or an oncological disorder. In an embodiment, a binding protein disclosed herein is used to treat an eye disorder (e.g., an angiogenic eye disorder). In an embodiment, the eye disorder is a macular degeneration, such as wet macular degeneration, dry macular degeneration, age related macular degeneration (AMD), exudative AMD, dry eye, glaucoma, diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, , iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal neovascularization, vitreal
neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, keratoconjunctivitis sicca, blepharitis, keratitis or another inflammatory disease of the eye.
[088] In an embodiment, the binding proteins provided herein are capable of neutralizing the activity of their antigen targets both in vitro and in vivo. Accordingly, such binding proteins can be used to inhibit antigen activity, e.g., in a cell culture containing the antigens, in human subjects or in other mammalian subjects having the antigens with which a binding protein provided herein cross-reacts. In another embodiment, a method for reducing antigen activity in a subject suffering from a disease or disorder in which the antigen activity is detrimental is provided. A binding protein provided herein may be administered to a human subject for therapeutic purposes. In some embodiments, the binding protein (e.g., the DVD-Ig binding protein) is administered to a patient, e.g., a patient suffering from wet AMD, and can have one or more effects selected from regressing mature vasculature (e.g., via VEGF binding), reducing choroidal neovascularization (e.g., via VEGF binding), allowing access to blood vessels by stripping off pericytes (e.g., via PDGF binding), and/or providing anti-fibrotic effects to reduce visual loss from scarring (e.g., via PDGF binding). In some embodiments, the binding protein is multispecific for VEGF and PDGF, and is administered at a reduced number of injections and/or a reduced injection frequency, as compared to a combination antibody therapy.
[089] The term“a disorder in which antigen activity is detrimental” encompasses diseases and other disorders in which the presence of the antigen in a subject suffering from the disorder has been shown to be or is suspected of being either responsible for the pathophysiology of the disorder or a factor that contributes to a worsening of the disorder. Accordingly, a disorder in which antigen activity is detrimental is a disorder in which reduction of antigen activity is expected to alleviate the symptoms and/or progression of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of the antigen in a biological fluid of a subject suffering from the disorder (e.g., an increase in the concentration of antigen in serum, plasma, synovial fluid, etc., of the subject). Non-limiting examples of disorders that can be treated with the binding proteins provided herein include those disorders discussed below and in the section pertaining to pharmaceutical compositions comprising the binding proteins. [090] Binding proteins disclosed herein, such as the DVD-Ig binding proteins, can be employed in some embodiments for tissue-specific delivery (target a tissue marker and a disease mediator for enhanced local PK thus higher efficacy and/or lower toxicity), including intracellular delivery (targeting an internalizing receptor and an intracellular molecule), delivering through a biological barrier, such as to the inside of the eye or brain (e.g., targeting transferrin receptor and a CNS disease mediator for crossing the blood-brain barrier). The binding proteins may also serve as carrier proteins to deliver an antigen to a specific location via binding to a non- neutralizing epitope of that antigen and also to increase the half-life of the antigen. Furthermore, the binding protein may be designed to either be physically linked to medical devices implanted into patients or target these medical devices (see Burke et al. (2006) Advanced Drug Deliv. Rev. 58(3): 437-446; Hildebrand et al. (2006) Surface and Coatings Technol.200(22-23): 6318-6324; Drug/ device combinations for local drug therapies and infection prophylaxis, Wu (2006) Biomaterials 27(11):2450-2467; Mediation of the cytokine network in the implantation of orthopedic devices, Marques (2005) Biodegradable Systems in Tissue Engineer. Regen. Med. 377-397).
[091] In an embodiment, diseases that can be treated or diagnosed with the compositions and methods disclosed herein include, but are not limited to, primary and metastatic cancers, including carcinomas of breast, colon, rectum, lung, oropharynx, hypopharynx, esophagus, stomach, pancreas, liver, gallbladder and bile ducts, small intestine, urinary tract (including kidney, bladder and urothelium), female genital tract (including cervix, uterus, and ovaries as well as choriocarcinoma and gestational trophoblastic disease), male genital tract (including prostate, seminal vesicles, testes and germ cell tumors), endocrine glands (including the thyroid, adrenal, and pituitary glands), and skin, as well as hemangiomas, melanomas, sarcomas (including those arising from bone and soft tissues as well as Kaposi’s sarcoma), tumors of the brain, nerves, eyes, and meninges (including astrocytomas, gliomas, glioblastomas, retinoblastomas, neuromas, neuroblastomas, Schwannomas, and meningiomas), solid tumors arising from hematopoietic malignancies such as leukemias, and lymphomas (both Hodgkin’s and non-Hodgkin’s lymphomas).
[092] Another embodiment provides for the use of the binding protein in the treatment of a disease or disorder, wherein the disorder is arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, chlamydia, yersinia and salmonella associated arthropathy, spondyloarthopathy, atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free Disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired Immunodeficiency Syndrome, Acquired Immunodeficiency Related Diseases, Hepatitis B, Hepatitis C, common varied immunodeficiency (common variable hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post-inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease, dermatomyositis/polymyositis associated lung disease, Sjögren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycaemia, type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS, glomerulonephritides, microscopic vasulitis of the kidneys, lyme disease, discoid lupus erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjörgren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, cholestasis, idiosyncratic liver disease, Drug-Induced hepatitis, Non-alcoholic Steatohepatitis, allergy and asthma, group B streptococci (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Th1 Type mediated diseases, acute and chronic pain (different forms of pain), and cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma) abetalipoproteinemia, Acrocyanosis, acute and chronic parasitic or infectious processes, acute leukemia, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinomas, aerial ectopic beats, AIDS dementia complex, alcohol- induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-l- antitrypsin deficiency, amyotrophic lateral sclerosis, anemia, angina pectoris, anterior horn cell degeneration, anti cd3 therapy, antiphospholipid syndrome, anti-receptor hypersensitivity reactions, aordic and peripheral aneuryisms, aortic dissection, arterial hypertension, arteriosclerosis, arteriovenous fistula, ataxia, atrial fibrillation (sustained or paroxysmal), atrial flutter, atrioventricular block, B cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt's lymphoma, burns, cardiac arrhythmias, cardiac stun syndrome, cardiac tumors, cardiomyopathy, cardiopulmonary bypass inflammation response, cartilage transplant rejection, cerebellar cortical degenerations, cerebellar disorders, chaotic or multifocal atrial tachycardia, chemotherapy associated disorders, chronic myelocytic leukemia (CML), chronic alcoholism, chronic inflammatory pathologies, chronic lymphocytic leukemia (CLL), chronic obstructive pulmonary disease (COPD), chronic salicylate intoxication, colorectal carcinoma, congestive heart failure, conjunctivitis, contact dermatitis, cor pulmonale, coronary artery disease, Creutzfeldt-Jakob disease, culture negative sepsis, cystic fibrosis, cytokine therapy associated disorders, Dementia pugilistica, demyelinating diseases, dengue hemorrhagic fever, dermatitis, dermatologic conditions, diabetes, diabetes mellitus, diabetic ateriosclerotic disease, Diffuse Lewy body disease, dilated congestive cardiomyopathy, disorders of the basal ganglia, Down's Syndrome in middle age, drug- induced movement disorders induced by drugs which block CNS dopamine receptors, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottitis, epstein-barr virus infection, erythromelalgia, extrapyramidal and cerebellar disorders, familial hematophagocytic
lymphohistiocytosis, fetal thymus implant rejection, Friedreich's ataxia, functional peripheral arterial disorders, fungal sepsis, gas gangrene, gastric ulcer, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallerrorden-Spatz disease, hashimoto's thyroiditis, hay fever, heart transplant rejection, hemachromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic
thrombocytopenic purpura, hemorrhage, hepatitis A, His bundle arryhthmias, HIV infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders, hypersensitity reactions, hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic- pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, Asthenia, infantile spinal muscular atrophy, inflammation of the aorta, influenza a, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia- reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection, lymphederma, malaria, malignamt Lymphoma, malignant histiocytosis, malignant melanoma, meningitis,
meningococcemia, metabolic/idiopathic, migraine headache, mitochondrial multi.system disorder, mixed connective tissue disease, monoclonal gammopathy, multiple myeloma, multiple systems degenerations (Mencel Dejerine-Thomas Shy-Drager and Machado-Joseph), myasthenia gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodyplastic syndrome, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic I muscular atrophies , neutropenic fever, non- hodgkins lymphoma, occlusion of the abdominal aorta and its branches, occulsive arterial disorders, okt3 therapy, orchitis/epidydimitis, orchitis/vasectomy reversal procedures, organomegaly, osteoporosis, pancreas transplant rejection, pancreatic carcinoma, paraneoplastic syndrome/hypercalcemia of malignancy, parathyroid transplant rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherlosclerotic disease, peripheral vascular disorders, peritonitis, pernicious anemia, pneumocystis carinii pneumonia, pneumonia, POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal gammopathy, and skin changes syndrome), post perfusion syndrome, post pump syndrome, post-MI cardiotomy syndrome, preeclampsia, Progressive supranucleo Palsy, primary pulmonary hypertension, radiation therapy, Raynaud's phenomenon and disease, Raynoud's disease, Refsum's disease, regular narrow QRS tachycardia, renovascular hypertension, reperfusion injury, restrictive cardiomyopathy, sarcomas, scleroderma, senile chorea, Senile Dementia of Lewy body type, seronegative arthropathies, shock, sickle cell anemia, skin allograft rejection, skin changes syndrome, small bowel transplant rejection, solid tumors, specific arrythmias, spinal ataxia, spinocerebellar degenerations, streptococcal myositis, structural lesions of the cerebellum, Subacute sclerosing panencephalitis, Syncope, syphilis of the cardiovascular system, systemic anaphalaxis, systemic inflammatory response syndrome, systemic onset juvenile rheumatoid arthritis, T-cell or FAB ALL, Telangiectasia, thromboangitis obliterans, thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV
hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, ,vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital-associated hemaphagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still’s disease, anaphylaxis, anti-phospholipid antibody syndrome, aplastic anemia, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic ischemia, cicatricial pemphigoid, clinically isolated syndrome (cis) with risk for multiple sclerosis, childhood onset psychiatric disorder, dacryocystitis,
dermatomyositis, diabetic retinopathy, disk herniation, disk prolaps, drug induced immune hemolytic anemia, endometriosis, endophthalmitis, episcleritis, erythema multiforme, erythema multiforme major, gestational pemphigoid, Guillain-Barré syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson’s disease, idiopathic interstitial pneumonia, IgE-mediated allergy, immune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, IPF/UIP, iritis, keratitis, keratoconjunctivitis sicca, Kussmaul disease or Kussmaul-Meier disease, Landry's paralysis, Langerhan's cell histiocytosis, livedo reticularis, macular degeneration, microscopic polyangiitis, morbus bechterev, motor neuron disorders, mucous membrane pemphigoid, multiple organ failure, myelodysplastic syndrome, myocarditis, nerve root disorders, neuropathy, non-A non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, pauciarticular JRA, peripheral artery occlusive disease (PAOD), peripheral vascular disease (PVD), peripheral artery, disease (PAD), phlebitis, polyarteritis nodosa (or periarteritis nodosa), polychondritis, polymyalgia rheumatica, poliosis, polyarticular JRA, polyendocrine deficiency syndrome, polymyositis, post-pump syndrome, primary Parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), prostatitis, pure red cell aplasia, primary adrenal insufficiency, recurrent neuromyelitis optica, restenosis, rheumatic heart disease, sapho (synovitis, acne, pustulosis, hyperostosis, and osteitis), scleroderma, secondary amyloidosis, shock lung, scleritis, sciatica, secondary adrenal insufficiency, silicone associated connective tissue disease, sneddon-wilkinson dermatosis, spondilitis ankylosans, Stevens-Johnson syndrome (SJS), systemic inflammatory response syndrome, temporal arteritis, toxoplasmic retinitis, toxic epidermal necrolysis, transverse myelitis, TRAPS (tumor necrosis factor receptor, type 1 allergic reaction, type II diabetes, usual interstitial pneumonia (UIP), vernal conjunctivitis, viral retinitis, Vogt-Koyanagi-Harada syndrome (VKH syndrome), wet macular degeneration, wound healing, fibrosis, renal disease, wet macular degeneration, wound healing, age related macular degeneration (AMD), diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, exudative AMD, iris neovascularization, neovascular glaucoma, post- surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal neovascularization, vitreal neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, or an inflammatory disease of the eye.
[093] In some embodiments, any one of the binding proteins disclosed herein can be used to treat a disorder listed above. In certain embodiments, the binding protein used to treat any of the disorders discussed herein is one or more of the binding proteins listed in Tables 27-30, 38- 42, 46-50, or 55-58. In certain embodiments, the binding protein used to treat any of the disorders discussed herein is one or more of the binding proteins listed in Tables 56-58. In certain embodiments, the binding protein is PR-1572102, PR-1572105, PR-1610561, or PR1611292.
[094] In some embodiments, a binding protein (e.g., PR-1572102, PR-1572105, PR1611292, or PR-1610561) may be used to treat wet AMD that is non-responsive to anti-VEGF monotherapy. For instance, a binding protein targeting VEGF and PDGF (e.g., PR-1572102, PR- 1572105, or PR-1610561) may lead to better regression of angiogenesis, thereby providing for a more effective treatment (this does not necessarily mean, however, that such a binding protein would have a reduced administration frequency; whether that is the case is presently unknown). The dual inhibition of both VEGF and PDGF may provide for certain improved treatment outcomes, as compared to anti-VEGF monotherapy.
[095] In another aspect, methods of treating a patient suffering from a disorder are disclosed, comprising the step of administering any one of the binding proteins disclosed herein before, concurrently, or after the administration of a second agent, are provided. In an embodiment, the second agent is an imaging agent, cytotoxic agent, angiogenesis inhibitor, kinase inhibitor, co-stimulation molecule blocker, adhesion molecule blocker, anti-cytokine antibody or functional fragment thereof, methotrexate, cyclosporin, rapamycin, FK506, detectable label or reporter, TNF antagonist, antirheumatic, muscle relaxant, narcotic, non-steroid anti-inflammatory drug (NSAID), analgesic, anesthetic, sedative, local anesthetic, neuromuscular blocker, antimicrobial, antipsoriatic, corticosteriod, anabolic steroid, erythropoietin, immunization, immunoglobulin, immunosuppressive, growth hormone, hormone replacement drug,
radiopharmaceutical, antidepressant, antipsychotic, stimulant, asthma medication, beta agonist, inhaled steroid, epinephrine or analog, cytokine, or cytokine antagonist.
[096] Also disclosed, in various embodiments, are anti-idiotype antibodies to the binding proteins disclosed herein. An anti-idiotype antibody includes any protein or peptide- containing molecule that comprises at least a portion of an immunoglobulin molecule such as, but not limited to, at least one complementarily determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework region, or any portion thereof, that can be incorporated into a binding protein provided herein.
[097] Also disclosed herein, in various embodiments, are methods of determining the presence, amount or concentration of VEGF and/or PDGF, or fragment thereof, in a test sample. In some embodiments, the methods comprise assaying the test sample for the antigen, or fragment thereof, by an immunoassay. The immunoassay (i) employs at least one binding protein and at least one detectable label and (ii) comprises comparing a signal generated by the detectable label as a direct or indirect indication of the presence, amount or concentration of the antigen, or fragment thereof, in the test sample to a signal generated as a direct or indirect indication of the presence, amount or concentration of the antigen, or fragment thereof, in a control or a calibrator. The calibrator is optionally part of a series of calibrators in which each of the calibrators differs from the other calibrators in the series by the concentration of the antigen, or fragment thereof. The method can comprise (i) contacting the test sample with at least one capture agent, which binds to an epitope on the antigen, or fragment thereof, so as to form a capture agent/antigen, or fragment thereof, complex, (ii) contacting the capture agent/antigen, or fragment thereof, complex with at least one detection agent, which comprises a detectable label and binds to an epitope on the antigen, or fragment thereof, that is not bound by the capture agent, to form a capture agent/antigen, or fragment thereof/detection agent complex, and (iii) determining the presence, amount or concentration of the antigen, or fragment thereof, in the test sample based on the signal generated by the detectable label in the capture agent/antigen, or fragment thereof/detection agent complex formed in (ii), wherein at least one capture agent and/or at least one detection agent is the at least one binding protein.
[098] Alternatively, the method may comprise (i) contacting the test sample with at least one capture agent, which binds to an epitope on the antigen, or fragment thereof, so as to form a capture agent/antigen, or fragment thereof, complex, and simultaneously or sequentially, in either order, contacting the test sample with detectably labeled antigen, or fragment thereof, which can compete with any antigen, or fragment thereof, in the test sample for binding to the at least one capture agent, wherein any antigen, or fragment thereof, present in the test sample and the detectably labeled antigen compete with each other to form a capture agent/antigen, or fragment thereof, complex and a capture agent/detectably labeled antigen, or fragment thereof, complex, respectively, and (ii) determining the presence, amount or concentration of the antigen, or fragment thereof, in the test sample based on the signal generated by the detectable label in the capture agent/detectably labeled antigen, or fragment thereof, complex formed in (ii), wherein at least one capture agent is the at least one binding protein and wherein the signal generated by the detectable label in the capture agent/detectably labeled antigen, or fragment thereof, complex is inversely proportional to the amount or concentration of antigen, or fragment thereof, in the test sample.
[099] In some embodiments, the test sample is from a patient, in which case the method can further comprise diagnosing, prognosticating, or assessing the efficacy of therapeutic/prophylactic treatment of the patient. If the method further comprises assessing the efficacy of therapeutic/prophylactic treatment of the patient, the method optionally further comprises modifying the therapeutic/prophylactic treatment of the patient as needed to improve efficacy. The method can be adapted for use in an automated system or a semi-automated system. Accordingly, the methods described herein also can be used to determine whether or not a subject has or is at risk of developing a given disease, disorder or condition. Specifically, such a method can comprise the steps of: (a) determining the concentration or amount in a test sample from a subject of analyte, or fragment thereof, (e.g., using the methods described herein, or methods known in the art); and (b) comparing the concentration or amount of analyte, or fragment thereof, determined in step (a) with a predetermined level, wherein, if the concentration or amount of analyte determined in step (a) is favorable with respect to a predetermined level, then the subject is determined not to have or be at risk for a given disease, disorder or condition. However, if the concentration or amount of analyte determined in step (a) is unfavorable with respect to the predetermined level, then the subject is determined to have or be at risk for a given disease, disorder or condition.
[0100] Additionally, in various embodiments, provided herein are methods of monitoring the progression of disease in a subject. In some embodiments, the method can comprise the steps of: (a) determining the concentration or amount in a test sample from a subject of analyte; (b) determining the concentration or amount in a later test sample from the subject of analyte; and (c) comparing the concentration or amount of analyte as determined in step (b) with the concentration or amount of analyte determined in step (a), wherein if the concentration or amount determined in step (b) is unchanged or is unfavorable when compared to the concentration or amount of analyte determined in step (a), then the disease in the subject is determined to have continued, progressed or worsened. By comparison, if the concentration or amount of analyte as determined in step (b) is favorable when compared to the concentration or amount of analyte as determined in step (a), then the disease in the subject is determined to have discontinued, regressed or improved.
[0101] Optionally, the method further comprises comparing the concentration or amount of analyte as determined in step (b), for example, with a predetermined level. Further, optionally the method comprises treating the subject with one or more pharmaceutical compositions for a period of time if the comparison shows that the concentration or amount of analyte as determined in step (b), for example, is unfavorably altered with respect to the predetermined level.
[0102] Also provided, in various embodiments, are kits for assaying a test sample for VEGF and/or PDGF, or fragment thereof. The kit may comprise at least one component for assaying the test sample for an antigen, or fragment thereof, and instructions for assaying the test sample for an antigen, or fragment thereof, wherein the at least one component includes at least one composition comprising the binding protein disclosed herein, wherein the binding protein is optionally detectably labeled.
[0103] Unless otherwise defined herein, scientific and technical terms used herein have the meanings that are commonly understood by those of ordinary skill in the art. In the event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. The use of“or” means“and/or” unless stated otherwise. The use of the term“including”, as well as other forms, such as“includes” and“included”, is not limiting. Any range disclosed herein is intended to encompass the endpoints of that range unless stated otherwise.
[0104] Generally, nomenclatures used in connection with cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those known and commonly used in the art. The methods and techniques provided herein are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. Enzymatic reactions and purification techniques are performed according to manufacturer’s specifications, as commonly accomplished in the art or as described herein. The nomenclatures used in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
[0105] That the disclosure may be more readily understood, select terms are defined below.
[0106] The term“antibody” refers to an immunoglobulin (Ig) molecule, which is may comprise four polypeptide chains, two heavy (H) chains and two light (L) chains, or it may comprise a functional fragment, mutant, variant, or derivative thereof, that retains the epitope binding features of an Ig molecule. Such fragment, mutant, variant, or derivative antibody formats are known in the art. In an embodiment of a full-length antibody, each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH). In the case of an IgG molecule, the CH comprises three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The CL is comprised of a single CL domain. The VH and VL can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Generally, each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. CDR regions may be determined by standard methods, e.g., those of Kabat et al. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass.
[0107] The term“bispecific antibody” refers to an antibody that binds one antigen (or epitope) on one of its two binding arms (one pair of HC/LC), and binds a different antigen (or epitope) on its second binding arm (a different pair of HC/LC). A bispecific antibody is a type of bispecific binding protein. A bispecific antibody may have two distinct antigen binding arms (in both specificity and CDR sequences), and may be monovalent for each antigen to which it binds. Bispecific antibodies include those generated by quadroma technology (Milstein and Cuello (1983) Nature 305(5934): 537-40), by chemical conjugation of two different monoclonal antibodies (Staerz et al. (1985) Nature 314(6012): 628-31), or by knob-into-hole or similar approaches which introduces mutations in the Fc region (Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90(14): 6444-6448).
[0108] The term“affinity matured” refers to an antibody or binding protein with one or more alterations in one or more CDR or framework (FR) regions thereof, which may result in an improvement in the affinity for an antigen, compared to a parent antibody or binding protein which does not possess those alteration(s). Exemplary affinity matured antibodies or binding protein will have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies or binding protein may be produced by procedures known in the art, e.g., Marks et al. (1992) BioTechnology 10:779-783 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by Barbas et al. (1994) Proc. Nat. Acad. Sci. USA 91:3809-3813; Schier et al. (1995) Gene 169:147-155; Yelton et al. (1995) J. Immunol.155:1994-2004; Jackson et al. (1995) J. Immunol.154(7):3310-9; Hawkins et al. (1992) J. Mol. Biol.226:889-896 and mutation at selective mutagenesis positions, contact or hypermutation positions with an activity enhancing amino acid residue as described in U.S. Patent No.6,914,128.
[0109] The term“CDR-grafted” refers to an antibody or binding protein that comprises heavy and light chain variable region sequences in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another antibody or binding protein. For example, the two antibodies or binding protein can be from different species, such as antibodies or binding protein having murine heavy and light chain variable regions in which one or more of the murine CDRs has been replaced with human CDR sequences.
[0110] The term“humanized” refers to an antibody or binding protein from a non- human species that has been altered to be more“human-like”, i.e., more similar to human germline sequences. One type of humanized antibody or binding protein is a CDR-grafted antibody or binding protein, in which non-human CDR sequences are introduced into human VH and VL sequences to replace the corresponding human CDR sequences. A humanized antibody or binding protein also encompasses a variant, derivative, analog or fragment of an antibody or binding protein that comprises framework region (FR) sequences having substantially (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identity to) the amino acid sequence of a human antibody and at least one CDR having substantially the amino acid sequence of a non-human antibody. A humanized antibody or binding protein may comprise substantially all of at least one variable domain (Fab, Fab’, F(ab’) 2, FabC, Fv) in which the sequence of all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and the sequence of all or substantially all of the FR regions are those of a human immunoglobulin. The humanized antibody or binding protein also may include the CH1, hinge, CH2, CH3, and/or CH4 regions of the heavy chain. In an embodiment, a humanized antibody or binding protein may also comprise at least a portion of a human immunoglobulin Fc region. In some embodiments, a humanized antibody or binding protein only contains a humanized light chain. In some embodiments, a humanized antibody or binding protein only contains a humanized heavy chain. In some embodiments, a humanized antibody or binding protein only contains a humanized variable domain of a light chain and/or humanized variable domain of a heavy chain. In some embodiments, a humanized antibody or binding protein contains a humanized light chain as well as at least a variable domain of a heavy chain. In some embodiments, a humanized antibody or binding protein contains a humanized heavy chain as well as at least a variable domain of a light chain.
[0111] The term“anti-idiotypic antibody” refers to an antibody raised against the amino acid sequence of the antigen combining site of another antibody. Anti-idiotypic antibodies may be administered to enhance an immune response against an antigen.
[0112] The term“biological activity” refers to any one or more biological properties of a molecule (whether present naturally as found in vivo, or provided or enabled by recombinant means). Biological properties include, but are not limited to, binding a receptor, inducing cell proliferation, inhibiting cell growth, inducing other cytokines, inducing apoptosis, and enzymatic activity. [0113] The term“neutralizing” refers to counteracting the biological activity of an antigen when a binding protein specifically binds to the antigen. In an embodiment, a neutralizing binding protein binds to an antigen (e.g., VEGF and/or PDGF or their receptors) and reduces the antigen’s biological activity by at least about 20%, about 40%, about 60%, about 80%, about 85%, about 90%, about 95%, or about 100% (or any percentage in between).
[0114] The term“specificity” refers to the ability of a binding protein to selectively bind an antigen.
[0115] The term“affinity” refers to the strength of the interaction between a binding protein and an antigen, and is determined by the sequence of the CDRs of the binding protein as well as by the nature of the antigen, such as its size, shape, and/or charge. Binding proteins may be selected for affinities that provide desired therapeutic end-points while minimizing negative side-effects. Affinity may be measured using methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
[0116] The term“potency” refers to the ability of a binding protein to achieve a desired effect, and is a measurement of its therapeutic efficacy. Potency may be assessed using methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No. 7,612,181).
[0117] The term“cross-reactivity” refers to the ability of a binding protein to bind a target other than that against which it was raised. Generally, a binding protein will bind its target tissue(s)/antigen(s) with an appropriately high affinity, but will display an appropriately low affinity for non-target normal tissues. Methods of assessing cross-reactivity are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
[0118] The term“biological function” refers the specific in vitro or in vivo actions of a binding protein. Binding proteins may target several classes of antigens and achieve desired therapeutic outcomes through multiple mechanisms of action. Binding proteins may target soluble proteins, cell surface antigens, as well as extracellular protein deposits. Binding proteins may agonize, antagonize, or neutralize the activity of their targets. Binding proteins may assist in the clearance of the targets to which they bind, or may result in cytotoxicity when bound to cells. Portions of two or more antibodies may be incorporated into a multivalent format to achieve distinct functions in a single binding protein molecule. The in vitro assays and in vivo models used to assess biological function are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
[0119] A“stable” binding protein refers to one in which the binding protein retains some level of its physical stability, chemical stability and/or biological activity upon storage. Methods of stabilizing binding proteins and assessing their stability at various temperatures are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No. 7,612,181).
[0120] The term“solubility” refers to the ability of a protein to remain dispersed within an aqueous solution. The solubility of a protein in an aqueous formulation depends upon the proper distribution of hydrophobic and hydrophilic amino acid residues, and therefore, solubility can correlate with the production of correctly folded proteins. A person skilled in the art will be able to detect an increase or decrease in solubility of a binding protein using routine HPLC techniques and methods known to one skilled in the art (see, e.g., U.S. Patent Appl. No.
20090311253 and U.S. Patent No.7,612,181).
[0121] Binding proteins may be produced using a variety of host cells or may be produced in vitro, and the relative yield per effort determines the“production efficiency.” Factors influencing production efficiency include, but are not limited to, host cell type (prokaryotic or eukaryotic), choice of expression vector, choice of nucleotide sequence, and methods employed. The materials and methods used in binding protein production, as well as the measurement of production efficiency, are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.
20090311253 and U.S. Patent No.7,612,181).
[0122] The term“immunogenicity” means the ability of a substance to induce an immune response. Administration of a therapeutic binding protein may result in a certain incidence of an immune response. Potential elements that might induce immunogenicity in a multivalent format may be analyzed during selection of the parental antibodies, and steps to reduce such risk can be taken to optimize the parental antibodies prior to incorporating their sequences into a multivalent binding protein format. Methods of reducing the immunogenicity of antibodies and binding proteins are known to one skilled in the art (U.S. Patent Appl. No.
20090311253 and U.S. Patent No.7,612,181).
[0123] The terms“label” and“detectable label” refer to a moiety attached to a member of a specific binding pair, such as an antibody/binding protein or its analyte to render a reaction (e.g., binding) between the members of the specific binding pair, detectable. The labeled member of the specific binding pair is referred to as“detectably labeled.” Thus, the term“labeled binding protein” refers to a protein with a label incorporated that provides for the identification of the binding protein. In an embodiment, the label is a detectable marker that can produce a signal that is detectable by visual or instrumental means, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3H 14 35
, C, S, 90Y, 99Tc, 111In, 125I, 131I, 177Lu, 166Ho, or 153Sm); chromogens, fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, luciferase, alkaline phosphatase);
chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates.
Representative examples of labels commonly employed for immunoassays include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein. In this regard, the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety.
[0124] The term“conjugate” refers to a binding protein that is chemically linked to a second chemical moiety, such as a therapeutic or cytotoxic agent. The term“agent” includes a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials. In an embodiment, the therapeutic or cytotoxic agents include, but are not limited to, pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. When employed in the context of an immunoassay, the conjugate antibody may be a detectably labeled antibody used as the detection antibody.
[0125] The terms“crystal” and“crystallized” refer to a binding protein (e.g., an antibody), or antigen binding portion thereof, that exists in the form of a crystal. Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field. The fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined crystallographic symmetry provides the“unit cell” of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. (See Giege and Ducruix (1999) CRYSTALLIZATION OF NUCLEIC ACIDS AND PROTEINS, A PRACTICAL APPROACH, 2nd ed., pp.201-16, Oxford
University Press, NY, NY).
[0126] The term“vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a“plasmid,” which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Other vectors include RNA vectors. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as“recombinant expression vectors” (or simply,“expression vectors”). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification,“plasmid” and“vector” may be used interchangeably as the plasmid is the most commonly used form of vector. However, other forms of expression vectors are also included, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses), which serve equivalent functions. A group of pHybE vectors (e.g., U.S. Patent No.8,187,836) may be used for parental antibody and DVD-binding protein cloning. V1, derived from pJP183; pHybE-hCg1,z,non-a V2; and pJP184, may be used for cloning of antibody and DVD heavy chains with a wild type constant region or modified constant region (e.g., a L234, L235, H435A modified IgG1 constant region). V2, derived from pJP191 (with or without modifications to the Kozak site); pHybE-hCk V3, may be used for cloning of antibody and DVD light chains with a kappa constant region. V3, derived from pJP192; pHybE-hCl V2, may be used for cloning of antibody and DVD light chains with a lambda constant region. V4, built with a lambda signal peptide and a kappa constant region, may be used for cloning of DVD light chains with a lambda-kappa hybrid V domain. V5, built with a kappa signal peptide and a lambda constant region, may be used for cloning of DVD light chains with a kappa-lambda hybrid V domain. V7, derived from pJP183; pHybE-hCg1,z,non-a V2, may be used for cloning of antibody and DVD heavy chains with a (234,235 AA) mutant constant region.
[0127] The terms“recombinant host cell” or“host cell” refer to a cell into which exogenous, e.g., recombinant, DNA has been introduced. Such terms refer not only to the particular subject cell, but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term“host cell” as used herein. In an embodiment, host cells include prokaryotic and eukaryotic cells. In an embodiment, eukaryotic cells include protist, fungal, plant and animal cells. In another embodiment, host cells include but are not limited to the prokaryotic cell line E. coli; mammalian cell lines CHO, HEK 293, COS, NS0, SP2 and PER.C6; the insect cell line Sf9; and the fungal cell Saccharomyces cerevisiae. [0128] The term“transfection” encompasses a variety of techniques commonly used for the introduction of exogenous nucleic acid (e.g., DNA) into a host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
[0129] The term“cytokine” refers to a protein released by one cell population that acts on another cell population as an intercellular mediator. The term“cytokine” includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
[0130] The term“biological sample” refers to a quantity of a substance from a living thing or formerly living thing. Such substances include, but are not limited to, blood, plasma, serum, urine, amniotic fluid, synovial fluid, endothelial cells, leukocytes, monocytes, other cells, organs, tissues, bone marrow, lymph nodes and spleen.
[0131] The term“component” refers to an element of a composition. In relation to a diagnostic kit, for example, a component may be a capture antibody, a detection or conjugate antibody, a control, a calibrator, a series of calibrators, a sensitivity panel, a container, a buffer, a diluent, a salt, an enzyme, a co-factor for an enzyme, a detection reagent, a pretreatment reagent/solution, a substrate (e.g., as a solution), a stop solution, and the like that can be included in a kit for assay of a test sample. Thus, a“component” can include a polypeptide or other analyte as above, that is immobilized on a solid support, such as by binding to an anti-analyte (e.g., anti- polypeptide) antibody. Some components can be in solution or lyophilized for reconstitution for use in an assay.
[0132] “Control” refers to a composition known to not analyte (“negative control”) or to contain analyte (“positive control”). A positive control can comprise a known concentration of analyte. A“positive control” can be used to establish assay performance characteristics and is a useful indicator of the integrity of reagents (e.g., analytes).
[0133] “Predetermined cutoff” and“predetermined level” refer generally to an assay cutoff value that is used to assess diagnostic/prognostic/therapeutic efficacy results by comparing the assay results against the predetermined cutoff/level, where the predetermined cutoff/level already has been linked or associated with various clinical parameters (e.g., severity of disease, progression/nonprogression/improvement, etc.). While the present disclosure may provide exemplary predetermined levels, it is well-known that cutoff values may vary depending on the nature of the immunoassay (e.g., antibodies employed, etc.). It further is well within the ordinary skill of one in the art to adapt the disclosure herein for other immunoassays to obtain
immunoassay-specific cutoff values for those other immunoassays based on this disclosure. Whereas the precise value of the predetermined cutoff/level may vary between assays, correlations as described herein (if any) may be generally applicable. [0134] “Pretreatment reagent,” e.g., lysis, precipitation and/or solubilization reagent, as used in a diagnostic assay as described herein refers to one that lyses any cells and/or solubilizes any analyte that is/are present in a test sample. Pretreatment is not necessary for all samples, as described further herein. Among other things, solubilizing the analyte (e.g., polypeptide of interest) may entail release of the analyte from any endogenous binding proteins present in the sample. A pretreatment reagent may be homogeneous (not requiring a separation step) or heterogeneous (requiring a separation step). With use of a heterogeneous pretreatment reagent there is removal of any precipitated analyte binding proteins from the test sample prior to proceeding to the next step of the assay.
[0135] “Quality control reagents” in the context of immunoassays and kits described herein, include, but are not limited to, calibrators, controls, and sensitivity panels. A“calibrator” or“standard” typically is used (e.g., one or more, such as a plurality) in order to establish calibration (standard) curves for interpolation of the concentration of an analyte, such as an antibody or an analyte. Alternatively, a single calibrator, which is near a predetermined positive/negative cutoff, can be used. Multiple calibrators (i.e., more than one calibrator or a varying amount of calibrator(s)) can be used in conjunction so as to comprise a“sensitivity panel.”
[0136] The term“specific binding partner” refers to a member of a specific binding pair. A specific binding pair comprises two different molecules that specifically bind to each other through chemical or physical means. Therefore, in addition to antigen and antibody specific binding, other specific binding pairs can include biotin and avidin (or streptavidin), carbohydrates and lectins, complementary nucleotide sequences, effector and receptor molecules, cofactors and enzymes, enzyme inhibitors and enzymes, and the like. Furthermore, specific binding pairs can include members that are analogs of the original specific binding members, for example, an analyte-analog. Immunoreactive specific binding members include antigens, antigen fragments, and antibodies, including monoclonal and polyclonal antibodies as well as complexes, fragments, and variants (including fragments of variants) thereof, whether isolated or recombinantly produced.
[0137] The term“Fc region” refers to the C-terminal region of an immunoglobulin heavy chain, which may be generated by papain digestion of an intact antibody or binding protein. The Fc region may be a native sequence Fc region or a variant Fc region. The Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain, and optionally comprises a CH4 domain. Replacements of amino acid residues in the Fc portion to alter effector function are known in the art (e.g., U.S. Patent Nos.5,648,260 and 5,624,821). The Fc region mediates several important effector functions, e.g., cytokine induction, antibody dependent cell mediated cytotoxicity (ADCC), phagocytosis, complement dependent cytotoxicity (CDC), and half-life/ clearance rate of antibody or binding protein and antigen-antibody or antigen-binding protein complexes. In some cases these effector functions are desirable for a therapeutic immunoglobulin but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives.
[0138] The term“antigen-binding portion” of a binding protein refers to one or more fragments of a binding protein that retain the ability to specifically bind to an antigen. The antigen-binding function of a binding protein may be performed by fragments of a full-length binding protein, including bispecific, dual specific, or multi-specific formats; for instance, binding to two or more different antigens. Examples of binding fragments encompassed within the term “antigen-binding portion” of an binding protein include (i) an Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) an F(ab’) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody or binding protein, (v) a dAb fragment, which comprises a single variable domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are encoded by separate genes, they may be joined, e.g., using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv). Such single chain antibodies or binding proteins are also intended to be encompassed within the term“antigen-binding portion” of an antibody or binding protein. Other forms of single chain antibodies, such as diabodies are also encompassed. In addition, single chain antibodies or binding protein also include“linear” antibodies or binding protein comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions.
[0139] The term“multivalent binding protein” refers to a binding protein comprising two or more antigen binding sites. In an embodiment, the multivalent binding protein is engineered to have three or more antigen binding sites, and may not be a naturally occurring antibody. The term“multispecific binding protein” refers to a binding protein capable of binding two or more related or unrelated targets. In an embodiment, the dual variable domain (DVD) binding proteins provided herein comprise two or more antigen binding sites and are tetravalent or multivalent binding proteins.
[0140] The term“linker” refers to an amino acid residue or a polypeptide comprising two or more amino acid residues joined by peptide bonds that are used to link two polypeptides (e.g., two VH or two VL domains). Such linker polypeptides are well known in the art (see, e.g., Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak et al. (1994) Structure 2:1121-1123). A number of suitable linkers for use in the binding proteins described herein are set out in Table 55. In some embodiments, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10(dR) linker. In some embodiments, the X1 linker on the heavy chain is a GS-H10 linker and the X1 linker on the light chain is a GS-L10 linker. In some embodiments, the X1 linker on the heavy chain is an HG-short linker and the X1 linker on the light chain is an LK-long linker.
[0141] The terms“Kabat numbering”,“Kabat definitions” and“Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e., hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody or binding protein, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad. Sci.190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3. In some embodiments, the CDR sequences, framework sequences, and or constant region sequences are identified using Kabat numbering.
[0142] The term“CDR” refers to a complementarity determining region within an immunoglobulin variable region sequence. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the heavy and light chain variable regions. The term“CDR set” refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody or binding protein, but also provides precise residue boundaries defining the three CDRs in each heavy or light chain sequence. These CDRs may be referred to as Kabat CDRs. Chothia and coworkers (Chothia and Lesk (1987) J. Mol. Biol.196:901-917; Chothia et al. (1989) Nature 342:877-883) found that certain sub- portions within Kabat CDRs adopt nearly identical peptide backbone conformations, despite having great diversity at the level of amino acid sequence. These sub-portions were designated as L1, L2 and L3 or H1, H2 and H3 where the“L” and the“H” designates the light chain and the heavy chain regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (1995) FASEB J.9:133-139 and MacCallum (1996) J. Mol. Biol.262(5):732-45). Still other CDR boundary definitions may not strictly follow one of the herein systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although certain embodiments use Kabat or Chothia defined CDRs.
[0143] The term“epitope” refers to a region of an antigen that is specifically bound by a binding protein disclosed herein. In certain embodiments, epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics. An antigen or fragment can contain more than one epitope. An epitope may be determined by obtaining an X-ray crystal structure of an antibody:antigen complex and determining which residues on the antigen (e.g., VEGF or PDGF or a receptor) are within a specified distance of residues on the antibody of interest, wherein the specified distance is, 5 Հ or less, e.g., 5Հ, 4Հ , 3Հ, 2Հ, 1Հ or less, or any distance in between. In some embodiments, the epitope is defined as a stretch of 8 or more contiguous amino acid residues along the antigen sequence in which at least 50%, 70% or 85% of the residues are within the specified distance of the antibody or binding protein in the X-ray crystal structure.
[0144] In certain embodiments, a binding protein specifically binds an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or
macromolecules. Binding proteins that bind to the same or similar epitopes will likely cross- compete (one prevents the binding or modulating effect of the other). Cross-competition, however, can occur even without partial or complete epitope overlap, e.g., if epitopes are adjacent in three-dimensional space and/or due to steric hindrance.
[0145] The term“pharmacokinetic(s)” refers to the process by which a drug is absorbed, distributed, metabolized, and excreted by an organism. To generate a multivalent binding protein molecule with a desired pharmacokinetic profile, parent monoclonal antibodies with similarly desired pharmacokinetic profiles are selected. The PK profiles of the selected parental monoclonal antibodies can be easily determined in rodents using methods known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181).
[0146] The term“bioavailability” refers to the degree and rate at which a drug is absorbed into a living system or is made available at the site of physiological activity.
Bioavailability can be a function of several of the previously described properties, including stability, solubility, immunogenicity and pharmacokinetics, and can be assessed using methods known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181).
[0147] The term“surface plasmon resonance” refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore® system (BIAcore International AB, a GE Healthcare company, Uppsala, Sweden and Piscataway, NJ). For further descriptions, see Jönsson et al. (1993) Ann. Biol. Clin. 51:19-26. The term“K on ” refers to the on rate constant for association of a binding protein (e.g., an antibody or DVD-Ig) to the antigen to form the, e.g., DVD-Ig/antigen complex. The term“K on ” also refers to“association rate constant”, or“ka”, as is used interchangeably herein. This value indicating the binding rate of a binding protein to its target antigen or the rate of complex formation between a binding protein, e.g., an antibody, and antigen also is shown by the equation below:
Antibody (“Ab”) + Antigen (“Ag”)→Ab-Ag
[0148] The term“K off ” refers to the off rate constant for dissociation, or“dissociation rate constant”, of a binding protein (e.g., an antibody or DVD-Ig) from the, e.g., DVD-Ig/antigen complex as is known in the art. This value indicates the dissociation rate of a binding protein, e.g., an antibody, from its target antigen or separation of Ab-Ag complex over time into free antibody and antigen as shown by the equation below:
Ab + Ag→Ab-Ag
[0149] The terms“Kd” and“equilibrium dissociation constant” may refer to the value obtained in a titration measurement at equilibrium, or by dividing the dissociation rate constant (K off ) by the association rate constant (K on ). The association rate constant, the dissociation rate constant and the equilibrium dissociation constant, are used to represent the binding affinity of a binding protein (e.g., an antibody or DVD-Ig) to an antigen. Methods for determining association and dissociation rate constants are well known in the art. Using fluorescence–based techniques offers high sensitivity and the ability to examine samples in physiological buffers at equilibrium. Other experimental approaches and instruments such as a BIAcore® (biomolecular interaction analysis) assay, can be used (e.g., instrument available from BIAcore International AB, a GE Healthcare company, Uppsala, Sweden). Additionally, a KinExA® (Kinetic Exclusion Assay) assay, available from Sapidyne Instruments (Boise, Idaho), can also be used.
[0150] The term“variant” refers to a polypeptide that differs from a given polypeptide in amino acid sequence by the addition (e.g., insertion), deletion, or conservative substitution of amino acids, but that retains the biological activity of the given polypeptide (e.g., a variant VEGF antibody can compete with anti-VEGF antibody for binding to VEGF). A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity and degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids, as understood in the art (see, e.g., Kyte et al. (1982) J. Mol. Biol.157: 105-132). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes in a protein can be substituted and the protein still retains protein function. In one aspect, amino acids having hydropathic indexes of ± 2 are substituted. The hydrophilicity of amino acids also can be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity (see, e.g., U.S. Patent No.4,554,101). Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity, as is understood in the art. In one aspect, substitutions are performed with amino acids having hydrophilicity values within ± 2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties. The term“variant” also includes polypeptide or fragment thereof that has been differentially processed, such as by proteolysis, phosphorylation, or other post-translational modification, yet retains its biological activity or antigen reactivity, e.g., the ability to bind to VEGF. The term “variant” encompasses fragments of a variant unless otherwise defined. A variant may be about 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%,85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, or 75% identical to the wild type sequence.
Use Of Disclosed Binding Proteins In Treating Various Diseases
[0151] The binding protein molecules provided herein are useful as therapeutic molecules to treat various diseases, e.g., wherein the targets that are recognized by the binding proteins are detrimental. Such binding proteins may bind one or more targets involved in a specific disease.
[0152] Without limiting the disclosure, further information on certain disease conditions is provided. 1. Age-Related Macular Degeneration (AMD)
[0153] In various embodiments, one or more of the binding proteins disclosed herein that are capable of binding to VEGF and PDGF and/or their cognate receptors (e.g., a
combination of an anti-VEGF and an anti-PDGF binding protein, or a multispecific binding protein capable of targeting both VEGF and PDGF) can be used to treat AMD. In some embodiments, any of the binding proteins disclosed herein can be used to treat AMD, or a binding protein comprising the CDR and/or variable domain sequences from any of the binding disclosed herein. In certain embodiments, the binding protein used to treat AMD is one or more of the binding proteins listed in Tables 27-30, 38-42, 46-50, or 55-58. In certain embodiments, the binding protein used to treat AMD is one or more of the binding proteins listed in Tables 56-58. In certain embodiments, the binding protein is PR-1572102, PR-1572105, or PR-1610561.
[0154] Age-Related Macular Degeneration (AMD) is the leading cause of irreversible vision loss in individuals over the age of 50 in the United States and a major cause of blindness worldwide. Globally more than 160 million people suffer from AMD. AMD is an age-related ocular disease that results in blindness due to damage to the macula; the region of the retina responsible for sharp central vision. It is associated with the degeneration of the macula and in particular the retinal pigmented epithelium (RPE).
[0155] The disease occurs in two forms, the dry or non-exudative AMD form and the wet or exudative form. The most common form of macular degeneration, dry AMD (non- neovascular), is an early stage of the disease and may result from aging and thinning of macular tissues, deposition of pigment in the macula, or a combination of both processes. Dry AMD is diagnosed when yellowish spots known as drusen accumulate in and around the macula. Drusen are thought to be deposits or debris from nearby deteriorating tissue. The onset of dry AMD is usually associated with age-related changes in Bruch’s membrane, a highly specialized matrix for adhesion of retinal pigment epithelial (RPE) cells. These alterations in Bruch’s membrane can result in death of RPE cells in the macula, accumulation of drusen, and damage to photoreceptor cells. Gradual central loss of vision may occur with dry AMD, but the symptoms are typically not nearly as severe as with the wet form of the disease. Dry AMD can slowly progress to late-stage geographic atrophy (GA) resulting in a gradual deterioration of retinal cells that can cause severe vision loss. Dry AMD (both early and late stage) is the most common form of AMD representing more than 85% of all diagnosed cases.
[0156] The wet or exudative form of the disease usually results in more severe vision loss. Wet macular degeneration mainly affects central vision, causing "blind spots" in the central line of vision. Approximately 10-15% of dry AMD cases progress to wet AMD. Wet AMD is characterized by new blood vessel growth beneath the retina. Clinically, this is referred to as choroidal neovascularization (CNV). Wet AMD accounts for about 10-15% of all cases of AMD. Progression of dry AMD to wet AMD is marked by the development of neovascularization within Bruch’s membrane, as well as in the subretinal space. Wet AMD occurs when abnormal blood vessels behind the retina grow under the macula. These new blood vessels tend to be fragile and often leak blood and fluid. The blood and fluid result in macula inflammation and thickening and disrupts the connection between the photoreceptors and the RPE, leading to vision loss. In wet AMD, neovascularization is stimulated by many angiogenic factors; including vascular endothelial growth factor (VEGF), which appears to be the primary angiogenic factor in patients with wet AMD (Miller et al. (1994) Am. J. Pathol.145(3):574-584). Additionally, VEGF can act as a powerful endothelial cell mitogen, increasing vascular permeability. The primary goals of current AMD treatment are to block or inhibit choroidal neovascularization (CNV) and macular edema following retinal vein occlusion (RVO), stabilize or improve vision, and to reduce the occurrence of adverse effects.
[0157] Anti-VEGF agents may reduce choroidal neovascularization (CNV) and leakage, but do not lead to regression of CNV itself. Emerging evidence indicates the important role of pericytes on the maturation of new blood vessels. Anti-PDGF agents can directly block pericyte recruitment and prevent the maturation and stabilization of choroidal neovascularization. If pericytes can be stripped away from new blood vessels, vascular endothelial cells may become more susceptible to VEGF blockade, ultimately leading to a regression of angiogenesis.
[0158] Among other functions, VEGF stimulates endothelial cell proliferation/growth, increases vascular permeability, and promotes leukocyte activity capable of damaging retinal endothelial cells (Leung et al. (1989) Science 246(4935):1306-9). In wet AMD, retinal tissues produce and release angiogenic growth factors such as VEGF that bind to specific receptors located on the endothelial cells of nearby preexisting blood vessels. Activation of endothelial cells can result in the release of enzymes targeting tight junctions. These enzymes act on the basement membrane surrounding all existing blood vessels and lead to the formation of holes in the membrane. The endothelial cells proliferate and migrate out through these holes toward the diseased tissue. Specialized adhesion molecules such as integrins promote formation of new blood vessel sprouts, and matrix metalloproteinases (MMPs) dissolve the tissue in front of the sprouting vessel tip in order to accommodate it. Finally, smooth muscle cells (pericytes) provide structural support to these newly formed blood vessel loops and blood flow begins in these new immature vessels. Thus, VEGF may serve as a rate-limiting step in angiogenesis. VEGF also increases vascular permeability by leukocyte-mediated endothelial cell injury, formation of fenestrations, and the dissolution of tight junctions. This leads to intra-retinal fluid accumulation and a detrimental effect on visual acuity. Moreover, VEGF can also cause the release of inflammatory cytokines that further reinforce the cycle of inflammation and angiogenesis. [0159] In some embodiments, treatments inhibiting VEGF, PDGF, and/or the receptors (in a combination therapy or in one molecule) using the binding proteins disclosed herein may offer improved options for patients with wet AMD, while reducing the number of injections, reducing the safety concerns associated with multiple injections, and reducing cost.
2. Diabetic Retinopathy
[0160] Diabetic retinopathy is the most common diabetic eye disease and a leading cause of blindness in American adults. It is caused by changes in the blood vessels of the retina. In some people with diabetic retinopathy, blood vessels may swell and leak fluid. In other people, abnormal new blood vessels grow on the surface of the retina. The retina is the light-sensitive tissue at the back of the eye. A healthy retina is necessary for good vision.
[0161] Diabetic retinopathy has four stages: (1) Mild Nonproliferative Retinopathy. At this earliest stage, microaneurysms occur. They are small areas of balloon-like swelling in the retina's tiny blood vessels. (2) Moderate Nonproliferative Retinopathy. As the disease progresses, some blood vessels that nourish the retina are blocked. (3) Severe Nonproliferative Retinopathy. Many more blood vessels are blocked, depriving several areas of the retina with their blood supply. These areas of the retina send signals to the body to grow new blood vessels for nourishment. (4) Proliferative Retinopathy. At this advanced stage, the signals sent by the retina for nourishment trigger the growth of new blood vessels. This condition is called proliferative retinopathy. These new blood vessels are abnormal and fragile. They grow along the retina and along the surface of the clear, vitreous gel that fills the inside of the eye. By themselves, these blood vessels do not cause symptoms or vision loss. However, they have thin, fragile walls. If they leak blood, severe vision loss and even blindness can result.
[0162] Blood vessels damaged from diabetic retinopathy can cause vision loss in two ways: (1) Fragile, abnormal blood vessels can develop and leak blood into the center of the eye, blurring vision. This is proliferative retinopathy and is the fourth and most advanced stage of the disease. (2) Fluid can leak into the center of the macula, the part of the eye where sharp, straight- ahead vision occurs. The fluid makes the macula swell, blurring vision. This condition is called macular edema. It can occur at any stage of diabetic retinopathy, although it is more likely to occur as the disease progresses. About half of the people with proliferative retinopathy also have macular edema.
[0163] In some embodiments, the binding proteins disclosed herein may be used to inhibit VEGF, PDGF, and/or the receptors (in a combination therapy or in one molecule) to treat diabetic retinopathy.
[0164] In various embodiments, other diseases may be treated using the binding proteins disclosed herein, including but not limited to other eye disorders, cancers, fibrosis, renal disease, pathologic angiogenesis, wound healing, bone formation, or other diseases associated with aberrant (e.g., elevated) PDGF and/or VEGF expression.
Pharmaceutical Compositions
[0165] In various embodiments, pharmaceutical compositions comprising one or more of the binding proteins disclosed herein, either alone or in combination with other prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers, are provided. The pharmaceutical compositions comprising binding proteins provided herein are for use in, but not limited to, diagnosing, detecting, or monitoring a disorder, in preventing, treating, managing, or ameliorating a disorder or one or more symptoms thereof, and/or in research. The formulation of pharmaceutical compositions, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers, are known to one skilled in the art (see, e.g., U.S. Patent Appl. No.20090311253 and U.S. Patent No.7,612,181).
[0166] Methods of administering a pharmaceutical composition or a prophylactic or therapeutic agent provided herein include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular, intraperitoneal, intravitreous, intravenous and subcutaneous), epidural administration, intratumoral administration, mucosal administration (e.g., intranasal and oral routes) and pulmonary administration (e.g., aerosolized compounds administered with an inhaler or nebulizer). In an embodiment, the methods of administering a pharmaceutical composition or a prophylactic or therapeutic agent provided herein include topical eye drops, gels, or creams. The formulation of pharmaceutical compositions for specific routes of administration, and the materials and techniques necessary for the various methods of administration are available and known to one skilled in the art (U.S. Patent Appl. No.20090311253 and U.S. Patent No.
7,612,181).
[0167] Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. The term“dosage unit form” refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms provided herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals. An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of a binding protein provided herein is 0.1-20 mg/kg, for example, 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
Combination Therapy
[0168] In various embodiments, a binding protein provided herein may also be administered with one or more additional therapeutic agents useful in the treatment of various diseases, the additional agent being selected by the skilled artisan for its intended purpose. For example, the additional agent can be a therapeutic agent art-recognized as being useful to treat the disease or condition being treated by the antibody provided herein, such as AMD. The combination can also include more than one additional agent, e.g., two or three additional agents.
[0169] Combination therapy agents include, but are not limited to imaging agents, cytotoxic agents, angiogenesis inhibitors, kinase inhibitors, tyrosine kinase inhibitors, tyrosine kinase receptor inhibitors, co-stimulation molecule blockers, adhesion molecule blockers, anti- cytokine antibodies or functional fragments thereof, methotrexate, cyclosporin, rapamycin, FK506, detectable labels or reporters, TNF antagonists, antirheumatics, muscle relaxants, narcotics, non-steroid anti-inflammatory drugs (NSAIDs), analgesics, anesthetics, local anesthetics, sedatives, a hyaluronidase enzyme, neuromuscular blockers, antimicrobials, antipsoriatics, corticosteriods, anabolic steroids, erythropoietin, immunizations, immunoglobulins, immunosuppressives, growth hormones, hormone replacement drugs, radiopharmaceuticals, antidepressants, antipsychotics, stimulants, asthma medications, beta agonists, inhaled steroids, epinephrine or analogs, cytokines, or cytokine antagonists.
Diagnostics
[0170] The disclosure herein also provides, in various embodiments, diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems. The methods, kits, and adaptations provided may be employed in the detection, monitoring, and/or treatment of a disease or disorder in an individual. This is further elucidated below.
[0171] The present disclosure also provides a method for determining the presence, amount or concentration of an analyte, or fragment thereof, in a test sample using at least one binding protein as described herein. Any suitable assay as is known in the art can be used in the method. Examples include, but are not limited to, immunoassays and/or methods employing mass spectrometry.
[0172] Immunoassays provided by the present disclosure may include sandwich immunoassays, radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
[0173] A chemiluminescent microparticle immunoassay, in particular one employing the ARCHITECT® automated analyzer (Abbott Laboratories, Abbott Park, IL), is an example of an immunoassay.
[0174] Methods employing mass spectrometry are provided by the present disclosure and include, but are not limited to MALDI (matrix-assisted laser desorption/ionization) or by SELDI (surface-enhanced laser desorption/ionization).
[0175] Methods for collecting, handling, processing, and analyzing biological test samples using immunoassays and mass spectrometry would be well-known to one skilled in the art, are provided for in the practice of the present disclosure (see, e.g., U.S. Patent No.7,612,181).
Kits
[0176] In various embodiments, a kit for assaying a test sample for the presence, amount or concentration of an analyte, or fragment thereof, in a test sample is also provided. The kit comprises at least one component for assaying the test sample for the analyte, or fragment thereof, and instructions for assaying the test sample for the analyte, or fragment thereof. The at least one component for assaying the test sample for the analyte, or fragment thereof, can include a composition comprising a binding protein, as disclosed herein, and/or an anti-analyte binding protein (or a fragment, a variant, or a fragment of a variant thereof), which is optionally immobilized on a solid phase.
[0177] Optionally, the kit may comprise a calibrator or control, which may comprise isolated or purified analyte. The kit can comprise at least one component for assaying the test sample for an analyte by immunoassay and/or mass spectrometry. The kit components, including the analyte, binding protein, and/or anti-analyte binding protein, or fragments thereof, may be optionally labeled using any art-known detectable label. The materials and methods for the creation provided for in the practice of the present disclosure would be known to one skilled in the art (see, e.g., U.S. Patent No.7,612,181). [0178] The kit (or components thereof), as well as the method of determining the presence, amount or concentration of an analyte in a test sample by an assay, such as an immunoassay as described herein, can be adapted for use in a variety of automated and semi- automated systems (including those wherein the solid phase comprises a microparticle), as described, for example, in U.S. Patent Nos.5,089,424 and 5,006,309, and as commercially marketed, for example, by Abbott Laboratories (Abbott Park, IL) as ARCHITECT®.
[0179] Other platforms available from Abbott Laboratories include, but are not limited to, AxSYM®, IMx® (see, for example, U.S. Patent No.5,294,404, PRISM®, EIA (bead), and Quantum™ II, as well as other platforms. Additionally, the assays, kits and kit components can be employed in other formats, for example, on electrochemical or other hand-held or point-of-care assay systems. The present disclosure is, for example, applicable to the commercial Abbott Point of Care (i-STAT®, Abbott Laboratories) electrochemical immunoassay system that performs sandwich immunoassays. Immunosensors and their methods of manufacture and operation in single-use test devices are described, for example in, U.S. Patent No.5,063,081, 7,419,821, 7,682,833, 7,723,099, and 9,035,027; and U.S. Publication No.20040018577.
Sequences
[0180] Table 1 discloses amino acid and nucleotide sequences encoding VEGF-A from different human isoforms and different species. Table 2 discloses amino acid and nucleotide sequences encoding PDGF-BB from different human isoforms and different species. Table 3 discloses human IgG heavy chain and light chain constant domains, including sequences with the indicated amino acid modifications relative to the wild-type sequence. In various embodiments, the constant domains listed in Table 3 can be used with any of the binding proteins disclosed herein. The variable domains of the binding proteins disclosed herein may be attached to constant regions of any immunoglobulin species, isotypes, or mutants. Exemplary modifications in constant domain mutants include those with amino acid mutations intended to increase or reduce constant domain interactions with Fc-gamma receptors, C1q and FcRn, and/or mutations intended to modulate protein stability or valency (full-length and half molecule, heterodimer molecule, etc.). Tables 4 and 5 disclose exemplary heavy and light chain acceptor framework sequences that can be used with any of the CDR sets disclosed herein (i.e., heavy chain acceptor sequences paired with any of the heavy chain CDRs 1-3 disclosed herein, and/or light chain acceptor sequences paired with any of the light chain CDRs 1-3 disclosed herein) to form functional binding sites for PDGF, VEGF, and/or their cognate receptors. Table 1. Amino Acid and Nucleotide Sequences for VEGF-A
Figure imgf000060_0001
Table 2. Amino Acid and Nucleotide Sequences for PDGF-BB
Figure imgf000061_0001
Table 3. Amino Acid Sequences of Human IgG Heavy Chain and Light Chain Constant Domains
Figure imgf000061_0002
Figure imgf000062_0001
Table 4. Amino Acid Sequences of Heavy Chain Acceptor Frameworks
Figure imgf000063_0001
Figure imgf000064_0001
SEQ ID Protein region/ Sequence
NO: Closest
Germline Family
L15/JK4 FR3 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC L15/JK4 FR4 FGGGTKVEIKR
L5/JK4 FR1 DIQMTQSPSSVSASVGDRVTITC
L5/JK4 FR2 WYQQKPGKAPKLLIY
L5/JK4 FR3 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC L5/JK4 FR4 FGGGTKVEIKR
IGLV3-1 FR1 SYELTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGDTATLTISGTQPMDEADYYC IGLV3-1/JL FR4 FGYGTKVTVL
IGLV3-1 FR1 SYELTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGDTATLTISGTQPMDEADYYC IGLV3-1/JL FR4 GGGTKLTVLG
IGLV3-1 FR1 YELTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGDTATLTISGTQPMDEADYYC IGLV3-1/JL FR4 GGGTKLTVLG
IGLV3-1 FR1 LYVLTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGDTATLTISGTQTMDEADYLC IGLV3-1/JL FR4 FGGGTKVTVLG
IGKV6D-21 FR1 EYVLTQSPDFQSVTPKEKVTITC
IGKV6D-21 FR2 WYQQKPDQSPKLVIY
IGKV6D-21 FR3 GVPSRFSGSNSGDDATLTINSLEAEDAATYYC IGKV6D-21/JK FGQGTKVEIKR
FR4
IGKV3D-15 FR1 EYVLTQSPATLSVSPGERATLSC
IGKV3D-15 FR2 WYQQKPGQSPRLVIY
IGKV3D-15 FR3 DIPARFSGSNSGDEATLTISSLQSEDFAVYYC IGKV3D-15/JK FGQGTRLEIKR
FR4
IGKV4-1 FR1 DYVLTQSPDSLAVSLGERATINC
IGKV4-1 FR2 WYQQKPGQSPKLVIY
IGKV4-1 FR3 GIPDRFSGSNSGDDATLTISSLQAEDVAVYYC IGKV4-1/JK FR4 FGGGTKVEIKR
IGLV3-1 FR1 LPVLTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGNTATLTISGTQTMDEADYLC IGLV3-1/JL FR4 FGGGTKVTVL
IGLV3-1 FR1 SYELTQPPSVSVSPGQTASITC
IGLV3-1 FR2 WYQQKPGQSPVLVIY
IGLV3-1 FR3 GIPERFSGSNSGNTATLTISGTQTMDEADYLC IGLV3-1/JL FR4 FGGGTKLTVL Table A. Select Heavy Chain and Light Chain Variable Domain Sequences (CDRs in bold)
Figure imgf000066_0001
Figure imgf000067_0001
Figure imgf000068_0001
[0181] It will be readily apparent to those skilled in the art that other suitable modifications and adaptations of the methods described herein are obvious and may be made using suitable equivalents without departing from the scope of the embodiments disclosed herein. Having now described certain embodiments in detail, the same will be more clearly understood by reference to the following examples, which are included for purposes of illustration only and are not intended to be limiting. EXAMPLES
Example 1: In vitro Assays Used to Determine the Functional Activity of Anti-VEGF-A Antibodies, Anti-PDGF-BB Antibodies, Anti-VEGFR Antibodies, Anti-PDGFR-B
Antibodies, and DVD-Ig Proteins
Example 1.1: Affinity Determination Using BIACORE ^ Surface Plasmon
Resonance Technology for Antigen Binding
[0182] The BIACORE ^ surface plasmon resonance assay (Biacore, Inc., Piscataway, NJ) determines the affinity of antibodies with kinetic measurements of on-rate and off-rate constants. Binding of anti-VEGF-A antibodies, anti-PDGF-BB antibodies, anti-VEGFR antibodies, anti-PDGFR-B antibodies, or anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules, to a purified recombinant VEGF-A, PDGF-BB, VEGFR extracellular domain (ECD), PDGFR-B ECD or their Fc fusion proteins was determined by surface plasmon resonance-based measurements with a Biacore® instrument (either a Biacore 2000, Biacore 3000, or Biacore T100; GE
Healthcare, Piscataway, NJ) using running buffer HBS-EPB (10 mM HEPES [pH 7.4], 150 mM NaCl, 3 mM EDTA, 0.1 mg/ml BSA and 0.005% surfactant P20) at 25ºC. For example, approximately 9000 RU of goat anti-human Fc specific polyclonal antibody (Thermo Fisher Scientific Inc., Rockford, IL) diluted in 10 mM sodium acetate (pH 4.5) is directly immobilized across a CM5 research grade biosensor chip using a standard amine coupling kit according to manufacturer's instructions and procedures at 25 ^g/ml. Unreacted moieties on the biosensor surface were blocked with ethanolamine. For kinetic analysis, rate equations derived from the 1:1 Langmuir binding model were fitted simultaneously to multiple antigen injections (using global fit analysis) with the use of Scrubber 2 (BioLogic Software), Biacore Biaevaluation 4.0.1 software or Biacore T100 Evaluation software. Purified antibodies or DVD-Ig molecules were diluted in running buffer for capture across goat anti-human Fc reaction surfaces. Antibodies or DVD-Ig molecules to be captured as a ligand (1 ^g/ml) were injected over reaction matrices at a flow rate of 10 μl/minute. During the assay, all measurements were referenced against the capture surface alone (i.e., with no captured antibody or DVD-Ig molecule). The association and dissociation rate constants, Kon (M-1s-1) and Koff (s-1) were determined under a continuous flow rate of 80 μl/minute. Rate constants were derived by making kinetic binding measurements at different antigen concentrations ranging from 1.23– 900 nM, as a 3-fold dilution series, and included buffer-only injections (to be used for double referencing). The equilibrium dissociation constant KD (M) of the reaction between antibodies and the target antigen was then calculated from the kinetic rate constants by the following formula: KD = Koff/Kon. Binding was recorded as a function of time and kinetic rate constants were calculated. In this assay, on-rates as fast as 106 M-1s-1 and off-rates as slow as 10-6 s-1 could be measured. [0183] In some experiements, the conditions below were used for affinity
determination:
[0184] Chip surface: CM5 chip with goat anti human Fc IgG (5000 RU).
[0185] Reference: Goat IgG (capture ~5000 RU).
[0186] Running buffer: HBS-EP, 0.1 mg/ml BSA
[0187] DVD-Ig or mAbs were captured at 1 µg/ml, at 70-200 RU.
[0188] Recombinant ECD proteins were serially diluted 1:5 at 0.016-50nM.
[0189] Association time was 5 min and dissociation time was observed for 10 and 30 min.
[0190] Flow rate was 50ul/min.
[0191] Surface regeneration: two 30s pulses of 10mM Glycine, pH 1.5, at 50μl/min. Example 1.2: Surface Resonance Fc γRIIa, Fc γRIIb, Fc γRIIIa, and FcRn Binding Assay
[0192] The binding of VEGF/PDGF DVD-Ig molecules to recombinant Fc γRs captured via 6xHis-tag was assessed using a Biacore T200 (GE Healthcare) instrument. A CM5 chip (GE Healthcare, Pittsburgh, PA) with mouse anti-6xHis antibodies that were directly immobilized on the chip via amine coupling according to the GE Healthcare protocol to the density of 10000RU (all flow cells) was used for experiments. Human FcγRs were captured on flow cells 2, 3 and 4. Flow cell 1 was used as a reference surface. HBS-EP+ was used as the running buffer. Anti VEGF/PDGF DVD-Igs were injected over all the flow cells at a flow rate of 50µL/minute for 1-2 minutes at concentrations of 31.25; 62.5, 125, 250, 500, 1000, 2000 and 4000 nM, followed by 1-3 minutes of dissociation. The chip surfaces were regenerated with an injection of 10mM glycine pH 1.5 at a flow rate of 100µL/minute over all four flow cells after each cycle.
[0193] For FcRn binding analysis, VEGF/PDGF DVD-Igs were directly immobilized on a CM5 chip by amine coupling according to the manufacturer’s (GE Healthcare) protocol to a density of approximately 750 RU. Flow cell 1, where blank immobilization was performed, did not contain DVD-Igs and was used as a reference surface. Human, cynomolgus, mouse, rat and rabbit recombinant FcRns were injected over all the flow cells at a flow rate of 50µL/minute for 1 minute at a concentrations range of from 2.7 to 6000 nM (three fold serial dilution), followed by a 2 minute dissociation time. The surfaces were regenerated with an injection of 10mM HCl at 100µL/minute for 2 seconds followed by an injection of HBS-EP+, pH 7.4, at a flow rate of 50µL/minute for 30 seconds over all four flow cells. Samples were prepared and run in two running buffer systems, pH 6.0 MES-EP+, and pH 7.4 HBS-EP-EP+. Recombinant human FcγRIIIa V158 and rat and mouse FcRn data were fitted to 1:1 kinetic model. Recombinant human FcγRIIa R131 and FcγRIIa H131, FcγRIIIa F158, and recombinant human, cynomolgus and rabbit FcRn binding data were fitted to a steady state affinity model. Biacore T200
Evaluation Software version 2.0 was used to fit all the data.
Example 1.3: VEGF-A Binding Activity Determined by Capture ELISA
[0194] To identify molecules that could bind hVEGF165, a direct binding ELISA was performed. 96-well high binding neutravidin plates (Thermo Scientific cat#15507) were coated with 0.25 µg/mL / 6.51E-9 M biotinylated recombinant human VEGF165 (AP PR- 1361002, 50 µL/well in D-PBS), and shaken for 1.5 hours at 25°C . During the coating step, supernatant, antibodies, benchmark compounds or DVD-Ig were diluted in 10 % Superblock (Thermo Scientific, cat# 37535 ) and an eight point titration of each sample molecule was performed. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20). The sample molecule titration was added to the coated plate at 50 µL in duplicate and incubated for one hour at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. The appropriate anti-species-IgG HRP conjugate was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for forty-five minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, Lexington, KY cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, Radnor, PA cat#BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in optical density indicates the binding of the test molecule to biotinylated recombinant human VEGF165. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.4: VEGF-A Blocking Activity Determined by Inhibition of VEGF- R2 Interaction with Human VEGF165
[0195] To identify molecules that could block the binding of hVEGF165 to the hVEGF- R2 (KDR/Flk-1) receptor, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.27E-9 M recombinant human VEGF-R2-Fc (R&D Systems cat#357-KD), 50 µL/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween- 20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatant, antibodies, benchmark compounds or DVD-Ig were diluted in 1% Blocker BSA (Thermo Scientific cat#37525) and an eight point titration of each sample molecule was performed. The biotinylated human VEGF165 (AP, PR-1361002) was diluted in 1% Blocker BSA at 35 ng/mL. The sample molecule titration was added to the biotinylated human VEGF165 (17.5 ng/mL / 4.56E-10 M final concentration) and pre-incubated for 45 minutes at 25oC with shaking. The pre-incubated sample/ hVEGF165 complex was added to the coated plate at 50 µL in duplicate and incubated for 30 minutes at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP-40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the hVEGF165 binding to the hVEGF-R2-Fc. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.5: Mouse VEGF-A Blocking Activity Determined by Inhibition of Mouse VEGF-R2 Interaction with Mouse VEGF164
[0196] To identify molecules that could block the binding of mVEGF164 to the mVEGF-R2, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 2 µg/mL anti-human IgG-Fc (Thermo-Scientific, cat 31125) shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were washed four times with wash buffer (TBS, 0.05% Tween-20) and 1 µg/mL / 4.55E-9 M recombinant mouse VEGF-R2-Fc (R&D Systems cat#443-KD)(50 µL/well in D-PBS) was added to wells and incubated for 1.5 hour at 25oC with shaking. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, hybridoma supernatants were diluted in 1% Blocker BSA (Thermo Scientific cat#37525). The mouse VEGF164 (R&D Systems cat# 493-MV-005) was diluted in 1% Blocker BSA to 20 ng/mL. The diluted sample was added to the mouse VEGF164 (10 ng/mL / 5.15E-10 M final concentration) and pre-incubated for 45 minutes at 25oC with shaking. The pre-incubated sample/ mVEGF164 complex was added to the coated plate at 50 µL and incubated for 30 minutes at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. The detection reagent biotinylated goat anti-mVEGF164 (R&D Systems cat#BAF-493) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates for 1 hour at 25°C with shaking. Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP-40 (Fitzgerald cat# 65r-s104phrp) was diluted in assay diluent and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the mVEGF164 binding to the mouse VEGF-R2-Fc. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5. Example 1.6: VEGF-A Blocking Activity Determined by VEGFR2 (Tyr1054) Phosphorylation
[0197] To test candidate molecules for the ability to neutralize hVEGF-A activity, a cell based human VEGF-R2 (KDR/Flk-1) phosphorylation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 µg/mL geneticin and 10% FBS). Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37oC, 5% CO2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 µg/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37oC, 5% CO2. The following day, the MSD anti-VEGFR2-phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD kit cat# K151DJD-2) was blocked with MSD Blocker-A for 1 hour at 25oC with shaking. During blocking, anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human VEGF165 (AP, PR-1350437) (50 ng/ml / 1.3E-9 M final concentration), hVEGF111 (R&DSystems, cat#5336-VE-10/CF) (50 ng/mL / 1.9E-9 M final concentration) or rabbit VEGF165 (AbbVie, PR-1563693.0) (50 ng/mL / 1.24E-9 M final concentration) for 30 minutes at 25 o C w i t h s h a k i n g . Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 µL) for 8 minutes at 37 o C, 5% CO2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80oC. Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 µL) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4oC. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 µL) and incubated for 1 hour at 25oC with shaking. Following incubation, the MSD plate was washed four times with wash buffer. The anti-phospho-Tyr1054-IgG-sulfotag reagent was diluted in detection solution (K 151 D J D - 2 c o m p o n e n t s ) a n d 25 µ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25oC with shaking. Plates were washed four times with wash buffer, 150 µL MSD read buffer (K 151 D J D - 2 c o m p o n e n t ) a d d e d t o w e l l s a n d p l a t e s r e a d o n M S D S e c t o r I m a g e r 6000. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF-A mediated activation. Data was analyzed using Graphpad Prism software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5. Example 1.7: VEGF-A Blocking Activity Determined by Inhibition of Human VEGF165 Stimulated VEGFR2-3T3 Cell Proliferation/Survival
[0198] To screen candidate molecules for the ability to neutralize hVEGF165 activity, a cell based proliferation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 4,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 24 hours at 37oC, 5% CO2. The following day, anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human VEGF165 (AP, PR-1350437) (40 ng/ml / 1.04E-9 M final concentration in assay well) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 µ L ) in triplicate and plates were incubated at 37°C, 5% C02 for 72 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using an ATPlite kit (Perkin Elmer, Waltham, MA) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF165 induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.8: VEGF-A Blocking Activity Determined by Inhibition of
HumanVEGF111 and HumanVEGF121 Stimulated VEGFR2-3T3 Cell
Proliferation/Survival
[0199] To test the ability of candidate molecules to neutralize hVEGF111 and hVEGF121 activity, a cell based proliferation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non- essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 4,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 24 hours at 37oC, 5% CO2. The following day, anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with ei ther recombinant human VEGF 111 (R&D Systems, cat#5336-VE) (10 ng/ml / 3.85E-10 M final concentration) or human VEGF 121 (R&D Systems, cat#4644-VS) (10 ng/ml / 3.57 E-10 M final concentration in assay well) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 72 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using an ATPlite kit (Perkin Elmer, Waltham, MA) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF111 or hVEGF121 induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5. Example 1.9: VEGF-A Blocking Activity Determined by Inhibition of Rabbit VEGF165 Stimulated VEGFR2-3T3 Cell Proliferation/Survival
[0200] To screen candidates for the ability to neutralize rabbitVEGF165, a cell based proliferation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 8.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 4,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 24 hours at 37oC, 5% CO2. The following day, anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant rabbit VEGF165 (AbbVie, PR-1563693.0) (40 ng/ml / 9.92E-10M final concentration in assay well) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 72 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using an ATPlite kit (Perkin Elmer, Waltham, MA) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the rabbitVEGF165 induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.10: VEGF-A Blocking Activity Determined by Inhibition of Human VEGF165 Stimulated Endothelial Cell Proliferation/Survival
[0201] To test for the ability to neutralize hVEGF165, a cell based proliferation assay was performed. Human microvascular endothelial cells (Lonza, cat#CC-2516) were maintained in EBM-2 (Lonza cat#CC3156) supplemented with EGM-2V singlequots (Lonza cat#3202). The day of the assay, the cells (passage 2– 7) were trypsinized, washed in D-PBS and resuspended at 1E5 cells/mL in assay media (M199, 2 mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 10 mM HEPES and 10% FBS). Cells were plated at 5,000 cells / well ( 50 µ L ) on 96-well g e l a t i n c o a t e d plates (BD Biocoat cat#354689) and incubated at 37oC, 5% CO2. The anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human VEGF165 (AP, PR-1350437) (5 ng/ml / 1.3E-10 M final concentration in assay well) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 72 hours. Cell
survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the
manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF165 induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5. Example 1.11: Generation of naturally derived human VEGF-A and Reactivity to the Anti-VEGF antibodies or Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Proteins
[0202] To identify molecules that could bind naturally derived human VEGF-A, a sandwich ELISA was performed. Native human VEGF-A was obtained from the supernatant of Y-79 cells (ATCC, cat#HTB-18) grown in the presence of dimethyloxalylglycine (Sigma-Aldrich, cat#D3695). The naturally derived material was quantified using the R&D Systems VEGF Duoset kit (cat#DY293B). 96-well Costar high binding plates (#3369) were coated with 13.3E-8 M antibodies, benchmark compounds or DVD-Ig in D-PBS, shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were blocked with Superblock blocking buffer (Thermo Scientific, cat#37535) followed by four washes with wash buffer (TBS, 0.05% Tween-20). The naturally derived human VEGF-A supernatant was serially diluted in assay diluent (1% Blocker BSA; Pierce, cat#37525) for final test concentrations of 2900 ng/mL– 11.88 ng/mL. The dilutions were added to the plates (50 µL) and incubated for 2 hours at 25°C with shaking.
Following incubation, plates were washed four times with wash buffer. Detection antibody from the R&D Systems Duoset kit (Part 840163, cat#DY293B) was diluted in assay diluent and added to plates (50 µL) for 2 hours at 25°C with shaking. Plates were then washed four times with wash buffer. The streptavidin-HRP from the R&D Systems Duoset kit (Part 890803, cat#DY293B) was diluted in assay diluent and added to plates (50 µL) for 35 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in optical density indicates binding of the test molecule to the naturally derived human VEGF-A. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.12: PDGF-BB Binding Activity Determined by Capture ELISA
[0203] To identify molecules that could bind hPDGF-BB, a direct binding ELISA was performed. 96-well high binding neutravidin plates (Thermo Scientific cat#15507) were coated with 0.5 µg/mL / 1.99E-8 M recombinant human PDGF-BB-biotin (CST cat#8912BF; labeled at AbbVie, 50 µL/well in D-PBS), shaken for 2 hours at 25°C. During the coating step, supernatants, benchmark compounds or DVD-Ig were diluted in 10% Superblock (Thermo Scientific, cat#37525) and an eight point titration of each sample molecule was performed. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20). The sample molecule titration was added to the coated plate at 50 µL in duplicate and incubated for one hour at 25°C with shaking. Following incubation, plates were washed four times with wash buffer. The appropriate anti-species-IgG HRP conjugate was in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for one hour at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in optical density indicates binding of the test molecule to biotinylated recombinant human PDGF- BB. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.13: PDGF-BB Blocking Activity Determined by Inhibition of PDGF- Rβ Interaction with Human PDGF-BB
[0204] To identify molecules that could block the binding of hPDGF-BB to the hPDGF-Rβ, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.98E-9 M recombinant human PDGF-Rβ-Fc (R&D Systems #385-PR, 50 µL/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatants, antibodies, benchmark compounds or DVD-Ig were diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and an eight point titration of each sample molecule was performed. The recombinant human PDGF-BB-biotin (CST cat#8912BF; labeled at AbbVie) was diluted in assay diluent at 20 ng/mL. The sample molecule titration was added to the human PDGF-BB-biotin (10 ng/mL / 3.97E-10 M final concentration) and pre-incubated for 45 minutes at 25°C with shaking. The pre-incubated sample/PDGF-BB complex was added to the coated plate at 50 µL in duplicate and incubated for 35 minutes at 25°C with shaking. Following incubation, plates were washed four times with wash buffer. Detection reagent Streptavidin- polyHRP-40 (Fitzgerald, cat#65r-s104phrp) was diluted in assay diluent and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the hPDGF-BB binding to the human PDGF-Rβ-Fc. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.14: PDGF-BB Blocking Activity Determined by PDGFRβ (Tyr751) Phosphorylation
[0205] To test candidate molecules for the ability to neutralize hPDGF-BB activity, a cell based PDGF-Rβ phosphorylation assay was performed. Balb-3T3 cells (ATCC cat# CCL- 163) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, and 10% FCS). Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 20 hours at 37oC, 5% CO2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 µg/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37oC, 5% CO2. The following day, the MSD anti-PDGF-Rβ phospho-assay plate (Mesoscale PDGF-Rβ-Tyr751 phospho-MSD kit cat# K150DVD-2) was blocked with MSD Blocker-A for 1 hour at 25oC with shaking. During blocking, anti-PDGF-BB s u p e r n a t a n t s , monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human PDGF-BB (CST, cat#8912BF) (20 ng/ml / 7.94E-10 M final concentration) and rat PDGF-BB (R&D Systems,cat#520-BB) (70 ng/ml / 1.4E-9 M final concentration) for 30 minutes at 25 o C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 µL) for 8 minutes at 37 o C, 5% CO2. Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice- cold D-PBS. Plates were frozen for 10 minutes at -80oC. On ice, ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 µL). Plates were centrifuged at 3000 rpm for 15 minutes at 4oC. The MSD plate was washed f o u r t i m e s with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 µL) and incubated 1 hour at 25oC with shaking. Following incubation, the MSD plate was washed f o u r t i m e s with wash buffer. The anti-phospho-Tyr751-IgG-sulfotag reagent was diluted in detection solution (K150DVD-2 components) and 25 μl added to foil covered wells for 1 hour at 25oC with shaking. Plates were washed four times with wash buffer, 150 µL MSD read buffer
(K150DVD-2 component) added to wells and plates read on MSD Sector Imager 6000. A decrease in observed reporter signal indicates the test molecule is neutralizing the hPDGF-BB mediated activation. Data was analyzed using Graphpad Prism software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.15: PDGF-BB Blocking Activity Determined by Inhibition of Human PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
[0206] To screen candidate molecules for the ability to neutralize hPDGF-BB activity, a cell based proliferation assay was performed. NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 2,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 5 hours at 37ºC, 5% CO2. During cell incubation, anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant human PDGF-BB (CST, cat#8912BF) (1.67 ng/ml / 6.63E-11 M final concentration) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 ^L) in triplicate and plates were incubated at 37°C, 5% CO2 for 44 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hPDGF-BB induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.16: PDGF-BB Blocking Activity Determined by Inhibition of
Cynomolgus PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
[0207] To screen candidate molecules for the ability to neutralize cynomolgus PDGF- BB activity, a cell based proliferation assay was performed. NIH-3T3 cells (ATCC, cat#CRL- 1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non- essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 2,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 5 hours at 37ºC, 5% CO2. During cell incubation, anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant cynomolgus PDGF-BB (AP, PR-1575400) (4 ng/ml / 1.61E-10 M final concentration in assay well) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 ^L) in triplicate and plates were incubated at 37°C, 5% C02 for 44 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the cynoPDGF-BB induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.17: PDGF-BB Blocking Activity Determined by Inhibition of Murine PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
[0208] To test candidate molecules for the ability to neutralize mouse PDGF-BB activity, a cell based assay was performed. NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 2,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 5 hours at 37oC, 5% CO2. During cell incubation, anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant murine PDGF-BB (Abnova, cat#0309-200-58-S) (2 ng/ml / 8.13E-11 M final concentration) for 1 hour at 25°C with gentle shaking. The pre-incubated samples were then added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 44 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the murine PDGF-BB induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.18: PDGF-BB Blocking Activity Determined by Inhibition of Rat PDGF-BB Stimulated NIH-3T3 Cell Proliferation/Survival
[0209] To test candidate molecules for the ability to neutralize rat PDGF-BB activity, a cell based assay was performed. NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 2,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 5 hours at 37oC, 5% CO2. During cell incubation, anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in assay m e d i a and pre-incubated with recombinant rat PDGF-BB (R&D Systems,cat#520-BB) (2 ng/ml / 8.0E-11 M final concentration) for 1 hour at 25°C with gentle shaking. The pre- incubated samples were then added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 44 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the rat PDGF-BB induced proliferation. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.19: Generation of Naturally Derived Human PDGF-BB and
Reactivity to the Anti-PDGF-BB Antibodies or Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Proteins
[0210] The native form of human PDGF was purified from platelets by a modified protocol from Antoniades et al. (Antoniades et al. (1979) Proc. Natl. Acad. Sci. USA 76(4): 1809- 1813. In the modified protocol, ten units of platelets (Bioreclamation Inc.) were thawed, washed with 12 ml of Platelet Wash Buffer (HBSS– Gibco #14175 /0.3%BSA/10 mM EDTA) and centrifuged. The platelets were then suspended in 25 ml of Buffer A (20 mM NaHPO4, pH 7.4, 80 mM NaCl in a 50 ml tube). From here the platelet wash (50 ml tube) and the suspended platelets were worked up in parallel using the same protocol.
[0211] Both the suspended platelets and platelets wash tubes were placed into a boiling water bath for 10 minutes, after which the contents of the tubes were cooled on ice. The supernatant was separated from the pellet by centrifugation. The supernatant was placed aside at 4oC and the pellet was extracted with 30 ml Buffer B (20 mM NaHPO4, pH 7.4, 1M NaCl) by stirring overnight at 4oC. The supernatant was separated from the pellet by centrifugation. The supernatant was placed aside (4oC) and the pellet was extracted with 30 ml Buffer B by stirring overnight at 4oC. This was repeated two more times. All the supernatants were then dialyzed separately against Buffer A. After removal from dialysis, they were all analyzed for protein content and PDGF-BB (ELISA) (See Table 6). Table 6: Native PDGF Extraction from Human Platelets
Figure imgf000081_0001
Table 7: Native PDGF Purification from Human Platelets
Figure imgf000081_0002
[0212] Due to low specific activity (ng PDGF-BB per mg protein), the supernatants were subjected to further purification by CM sepharose. The supernatants were applied (with washing Buffer A) to a 20 ml CM sepharose column (GE Healthcare cat# 17-0719-01) and the PDGF was eluted with Buffer B. Subsequently the eluted protein was dialyzed against Buffer A. From here the protein that was eluted and subsequently dialyzed as well as the flow through were all analyzed for protein content and PDGF-BB (ELISA). At this point the specific activity (eluate 1) was high enough to be queried in the assay.
[0213] To identify molecules that could bind naturally derived human PDGF-BB, a sandwich ELISA was performed. The native human PDGF-BB was isolated and purified from human platelets (AbbVie, PR-1566692). This material was quantified using the R&D Systems PDGF-BB Duoset kit (cat#DY220). 96-well Costar high binding plates (#3369) were coated with 13.3E-8 M antibodies, benchmark compounds or DVD-Ig in D-PBS, shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were blocked with Superblock blocking buffer (Thermo Scientific, cat#37535) followed by four washes with wash buffer (TBS, 0.05% Tween-20). The native human PDGF-BB was serially diluted in assay diluent (1% Blocker BSA; Pierce, cat#37525) for final test concentrations of 2000 ng/mL– 2.74 ng/mL (5.4E-8 M– 7.5E-11 M). The dilutions were added to the plates (50 µL) and incubated for 2 hours at 25oC with shaking. Following incubation, plates were washed f o u r t i m e s with wash buffer.
Detection antibody from the R&D Systems Duoset kit (Part 840926, cat#DY220) was diluted in assay diluent and added to plates (50 µL) for 2 hours at 25°C with shaking. Plates were then washed four times with wash buffer. The streptavidin-HRP from the R&D Systems Duoset kit (Part 890803, cat#DY220) was diluted in assay diluent and added to plates (50 µL) for 35 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in optical density indicates binding of the test molecule to the naturally derived human PDGF-BB. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.20: hVEGF-A Neutralization Potency of Anti-VEGF-A/Anti-PDGF- BB DVD-Ig Proteins When Pre-incubated with hPDGF-BB
[0214] To test candidate molecules for the ability to neutralize hVEGF-A activity in the presence of hPDGF-BB, a cell based VEGF-R2 (KDR/Flk-1) phosphorylation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 µg/mL geneticin and 10% FBS). Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37oC, 5% CO2 Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L- glutamine, 100 units/mL penicillin/100 µg/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37oC, 5% CO2. The following day, the MSD anti-VEGFR2- phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD kit, cat#K151DJD-2) was blocked with MSD Blocker-A for 1 hour at 25oC with shaking. During blocking, anti-VEGF-A monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in growth m e d i a and pre-incubated with recombinant human PDGF-BB (CST cat#8912BF) (0.992 µg/ml / 3.94E-8 M final concentration) for 30 minutes at 25oC with shaking. Following the first pre-incubation step, recombinant human VEGF165 (AP, PR-1350437) was added to the samples for a final concentration of human VEGF165 of 50 ng/ml / 1.3E-9 M and of hPDGF-BB of 0.496 µg/ml / 1.97E-8 M final concentration for 30 minutes at 25 º C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 µL) for 8 minutes at 37 o C, 5% CO2. Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80oC. Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 µL) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4oC. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 µL) and incubated 1 hour at 25oC with shaking. Following incubation, the MSD plate was washed four times with wash buffer. The anti-phospho- Tyr1054-IgG-sulfotag reagent was diluted in detection solution (K 151 D J D - 2
c o m p o n e n t s ) a n d 25 µ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25oC with shaking. Plates were washed four times with wash buffer, 150 µL MSD read buffer
(K 151 D J D - 2 c o m p o n e n t ) a d d e d t o w e l l s a n d p l a t e s r e a d o n M S D S e c t o r I m a g e r 6000. A decrease in observed signal indicates the test molecule is neutralizing the hVEGF165 mediated activation in the presence of hPDGF-BB. Data was analyzed using
Graphpad Prism software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.21: PDGF Neutralization Potency of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Proteins When Pre-incubated with VEGF
[0215] To test candidate molecules for the ability to neutralize hPDGF-BB activity in the presence of hVEGF-A, a cell based proliferation assay was performed. NIH-3T3 cells (ATCC, cat#CRL-1658) were trypsinized, washed in D-PBS and resuspended at 4.5E4 cells/mL in assay media (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate and 0.1% BSA). Cells were plated at 2,250 cells / well ( 50 µ L ) on black 96-well plates and incubated for 5 hours at 37oC, 5% CO2. During cell incubation, anti-PDGF-BB monoclonal antibodies, benchmark compounds or DVD-Ig were serially diluted in a s s a y m e d i a c o n t a i n i n g h V E G F 165 ( 4 µ g / m L / 104.2 n M ) . The samples were pre-incubated with recombinant human PDGF- BB in assay media (CST, cat#8912BF) (3.34 ng/ml / 1.33E-10 M final concentration in well) for 1 hour at 25°C with gentle shaking. The final concentrations of ligand in assay wells were h V E G F 165 2.6E-8 M and hPDGF-BB 6.63E-11 M. The pre-incubated samples were added to the cells (50 µ L ) i n t r i p l i c a t e and plates were incubated at 37°C, 5% C02 for 44 hours. Cell survival/proliferation was measured indirectly by assessing ATP levels using a CellTiter-Glo Luminescent Cell Viability Assay kit (Promega, Madison, WI) according to the manufacturer's instructions. A decrease in observed signal indicates the test molecule is neutralizing the hPDGF-BB induced proliferation in the presence of hVEGF165. Data was analyzed and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.22: Human VEGF-R2 Binding Activity of the Ant i -VEGF-R2 Ant ibodies
[0216] To identify molecules which could bind VEGF-R2 (KDR/Flk-1), a direct binding ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.27E-9 M recombinant human VEGF-R2-Fc (R&D Systems cat#357-KD), 50 µL/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with
Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatant, antibodies or benchmark compounds were diluted in 1% Blocker BSA (Thermo Scientific cat#37525) and an eight point titration of each sample molecule was performed. The samples were added to wells and incubated for one hour at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. The appropriate anti-species-IgG HRP conjugate was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for forty-five minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in observed optical density indicates the test molecule is binding the human VEGF-R2-Fc. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.23: Human VEGF-R2 Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by Inhibition of Human VEGF-R2 Interaction with Human VEGF165
[0217] To identify molecules which could block the binding of VEGF-R2 (KDR/Flk-1) to hVEGF165, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.27E-9 M recombinant human VEGF-R2-Fc (R&D Systems cat#357-KD), 50 µL/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatant, antibodies or benchmark compounds were diluted in 1% Blocker BSA (Thermo Scientific cat#37525) and an eight point titration of each sample molecule was performed. The samples were added to wells and incubated for 30 minutes at 25oC with shaking. The biotinylated human VEGF165 (AP, PR-1361002) was diluted in 1% BSA at 35 ng/mL. This was added to wells (17.5 ng/mL / 4.56E-10 M final concentration) and incubation was continued for 30 minutes at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP-40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the human VEGF-R2-Fc binding to hVEGF165. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.24: VEGF-A Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by VEGFR2 (Tyr1054) Phosphorylation
[0218] To test candidate molecules for the ability to neutralize hVEGF-R2 activity, a cell based VEGF-R2 (KDR/Flk-1) phosphorylation assay was performed. Stably transfected VEGFR2-3T3 cells (AP) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, 400 µg/mL geneticin and 10% FBS). Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 6 hours at 37oC, 5% CO2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 µg/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37oC, 5% CO2. The following day, the MSD anti-VEGR2-phospho assay plate (Mesoscale VEGFR2-Tyr1054 phospho-MSD #kit cat K151DJD-2) was blocked with MSD Blocked with MSD Blocker-A for 1 hour at 25oC with shaking. During blocking, anti-VEGF-R2 supernatant, monoclonal antibodies and benchmark compounds were serially diluted in growth m e d i a and pre-incubated with recombinant human VEGFR2-Fc (R&D Systems, cat#357- KD) (500 ng/ml / 2.27E-9 M final concentration) for 30 minutes at 25 o C with shaking.
Recombinant human VEGF165 (AP, PR-1350437) (50 ng/ml / 1.3E-9 M final concentration) was added to the wells and incubation was continued for 30 minutes at 25 o C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 µL) for 8 minutes at 37oC, 5% CO2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80oC. Ice-cold lysis buffer (CST cat# 9803S) containing 1 mM PMSF was added to cells (50 µL) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4oC. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 µL) and incubated 1 hour at 25oC with shaking. Following incubation, the MSD plate was washed four times with wash buffer. The anti-phospho- Tyr1054-IgG-sulfotag reagent was diluted in detection solution (K 151 D J D - 2
c o m p o n e n t s ) a n d 25 µ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25oC with shaking. Plates were washed four times with wash buffer, 150 µL MSD read buffer
(K 151 D J D - 2 c o m p o n e n t ) a d d e d t o w e l l s a n d p l a t e s r e a d o n M S D S e c t o r I m a g e r 6000. An increase in observed signal indicates the test molecule is neutralizing the exogeneous hVEGFR2 and allowing for hVEGF165 mediated activation. Data was analyzed using Graphpad Prism software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.25: Mouse VEGF-R2 Blocking Activity of the Ant i -VEGF-R2 Ant ibodies as Determined by Inhibition of Mouse VEGF-R2 Interaction with Mouse VEGF164
[0219] To identify molecules which could block the binding of mVEGF164 to the mVEGF-R2, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 1 µg/mL / 4.55E-9 M recombinant mouse VEGF-R2-Fc (R&D Systems cat#443-KD)(50 µL/well in D-PBS) shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were washed four times with wash buffer (TBS, 0.05% Tween-20). Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, hybridoma supernatants and rat IgG were diluted in 1% Blocker BSA (Thermo Scientific cat#37525). The sample was added to the plates (50 µL) and incubated for 45 minutes at 25oC with shaking. The mouse VEGF164 (R&D Systems cat# 493-MV-005) was diluted in 1% Blocker BSA to 20 ng/mL and added to wells for a final concentration of 10 ng/mL / 5.15E-10 M final concentration.
Incubation was continued for 30 minutes at 25oC with shaking. Following incubation, plates were washed four times with wash buffer. The detection reagent biotinylated goat anti- mVEGF164 (R&D Systems cat#BAF-493) was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates for 1 hour at 25°C with shaking.
Following incubation, plates were washed four times with wash buffer. Streptavidin-polyHRP- 40 (Fitzgerald cat#65r-s104phrp) was diluted in assay diluent and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the mouse VEGF-R2-Fc binding to the mVEGF164. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.26: PDGF-Rβ Binding Activity of the Ant i -PDGF-Rβ Ant ibodies
[0220] To identify molecules which bind hPDGF-Rβ, a direct ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.98E-9 M recombinant human PDGF-Rβ-Fc (R&D Systems #385-PR, 50 µL/well in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatants, antibodies and benchmark compounds were diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and an eight point titration of each sample molecule was performed. The samples were added to wells and incubated for one hour at 25oC with shaking. Following incubation, plates were washed f o u r t i m e s with wash buffer. The appropriate anti-species-IgG HRP conjugate was diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and added to plates (50 µL) for forty-five minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. An increase in observed optical density indicates the test molecule is binding the human PDGF-Rβ-Fc. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.27: PDGF-Rβ Blocking Activity of the Ant i -PDGF-Rβ
Ant ibodies as Determined by Inhibition of PDGF-Rβ Interaction with Human PDGF-BB
[0221] To identify molecules which could block the binding of hPDGF-Rβ to hPDGF- BB, a competition ELISA was performed. 96-well Costar high binding plates (#3369) were coated with 0.5 µg/mL / 2.98E-9 M recombinant human PDGF-Rβ-Fc (R&D Systems #385- PR, 50 in D-PBS), shaken for 2 hours at 25°C and stored overnight at 4°C. Plates were then washed four times with wash buffer (TBS, 0.05% Tween-20) and blocked with Superblock blocking buffer (Thermo Scientific, cat#37535). During the blocking step, supernatants, antibodies and benchmark compounds were diluted in assay diluent (10% Superblock containing 0.05% surfactamps) and an eight point titration of each sample molecule was performed. The samples were added to wells and incubated for 30 minutes at 25oC with shaking. The recombinant human PDGF-BB-biotin (CST cat#8912BF; labeled at ABC) was diluted in assay diluent at 20 ng/mL. This was added to wells (10 ng/mL / 3.97E-10 M final concentration) and incubation was continued for 35 minutes at 25oC with shaking. Following incubation, plates were washed f o u r t i m e s with wash buffer. Detection reagent
Streptavidin-polyHRP-40 (Fitzgerald, cat# 65r-s104phrp) was diluted in assay diluent and added to plates (50 µL) for 45 minutes at 25°C with shaking. Plates were washed four times with wash buffer and developed with the addition of Enhanced K-blue TMB substrate (Neogen, cat#308177). The reaction was stopped with 2N sulfuric acid (VWR, cat# BDH3500-1) and the absorbance was read at 450 nm - 570 nm. A decrease in observed optical density indicates the test molecule is blocking the human PDGF-Rβ-Fc binding to hPDGF-BB. Data was analyzed using Softmax Pro 4.8 software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.28: PDGF-Rβ Blocking Activity of the Ant i -PDGF- Rβ
Ant ibodies as Determined by PDGFRβ (Tyr751) Phosphorylation
[0222] To test candidate molecules for the ability to neutralize hPDGF-Rβ activity, a cell based PDGF-Rβ phosphorylation assay was performed. Balb-3T3 cells (ATCC cat# CCL- 163) were trypsinized, washed in D-PBS and resuspended at 3.5E5 cells/mL in growth media assay (DMEM, 2mM L-glutamine, 100 units/mL penicillin/ 100 µg/mL streptomycin, 0.1 % MEM non-essential amino acids, 1mM sodium pyruvate, and 10% FCS). Cells were plated at 3.5E4 cells/well in 96-well plates (Costar cat#3599) and incubated for 20 hours at 37oC, 5% CO2. Growth media was removed and cells were washed with D-PBS. Starvation media was added to wells (DMEM, 2mM L-glutamine, 100 units/mL penicillin/100 µg/mL streptomycin and 1mM sodium pyruvate) and cells were incubated for 18 hours at 37oC, 5% CO2. The following day, the MSD anti-PDGFRβ-phospho-assay plate (Mesoscale PDGF-Rβ-Tyr751 phospho-MSD kit cat# K150DVD-2) was blocked with MSD Blocker-A for 1 hour at 25ºC with shaking. During blocking, supernatants, antibodies or benchmark compounds were serially diluted in growth m e d i a and pre-incubated with 500 ng/mL / 2.98E-9 M hPDGF-Rβ (R&D System, cat 385-PR) for 30 minutes at 25ºC. Recombinant human PDGF-BB (CST, cat#8912BF) (20 ng/ml / 7.94E- 10 nM final concentration) was added to the wells and incubation was continued for 30 minutes at 25 º C with shaking. Starvation media was removed from wells and pre-incubated sample added to cells in duplicate (100 µL) for 8 minutes at 37oC, 5% CO2 Immediately following incubation, plates were transferred to ice where media was removed and cells washed with ice-cold D-PBS. Plates were frozen for 10 minutes at -80oC. Ice-cold lysis buffer (CST cat#9803S) containing 1 mM PMSF was added to cells (50 µL) on ice. Plates were centrifuged at 3000 rpm for 15 minutes at 4oC. The MSD plate was washed four times with wash buffer (TBS, 0.05% Tween-20). The cell lysates were transferred to MSD plate (40 µL) and incubated 1 hour at 25oC with shaking. Following incubation, the MSD plate was washed four times with wash buffer. The anti-phospho-Tyr751-IgG-sulfotag reagent was diluted in detection solution (K 150 D V D - 2 c o m p o n e n t s ) a n d 25 µ L a d d e d t o f o i l c o v e r e d w e l l s f o r 1 h o u r at 25oC with shaking. Plates were washed f o u r t i m e s with wash buffer, 150 µL MSD read buffer (K 150 D V D - 2 c o m p o n e n t s ) a d d e d t o w e l l s a n d p l a t e s r e a d o n M S D S e c t o r I m a g e r 6000. An increase in observed signal indicates the test molecule is neutralizing the exogeneous hPDGF-Rβ and allowing for hPDGF-BB mediated activation. Data was analyzed using Graphpad Prism software and IC50 values calculated using a sigmoidal dose response (variable slope) fit in GraphPad Prism 5.
Example 1.29: Reactivity of Anti-PDGF-BB Antibodies and Anti-VEGF-A/anti- PDGF-BB DVD-Ig Molecules to ECM-associated PDGF-BB
[0223] Both recombinant cell line HEK293 cells over-expressing PDGFBB-RM and HUVEC naturally expressing ECM-associated PDGF-BB cells were used for staining:
[0224] HEK293 Cell Staining: PDGFB-RM transient transfected HEK 293 cells and parental HEK293 cells were re-suspended at 1E6 cells/mL in PBS and fixed in 4%
paraformaldehyde at RT for 10 minutes, washed with PBS and 2E5 cells/tube were incubated in blocking buffer (10% goat serum in PBS) for one hour on ice. Cells were washed with PBS and incubated with primary antibodies or DVD-Ig molecules at 33nM in antibody dilution buffer (5% goat serum in PBS) for one hour on ice. Cells were washed three times with PBS and incubated with Alexa Fluo 488 conjugated Goat anti-Human IgG (Jackson Immune, code: 109-546-098; lot: 108427) 1 : 400 dilution in antibody dilution buffer, incubated on ice for 45 minutes, cells were washed three times with PBS and cytospin onto glass slides and mounted with mounting media with DAPI. Pictures were taken by fluorescent microscopy.
[0225] HUVEC Staining: The anti-VEGF/anti-PDGF DVD-Ig was further assessed for its staining on naturally derived ECM-associated PDGF-BB on HUVEC cells. HUVECs (Lonza, cat#: C2519A lot: 181607) were trypsinized, resuspended at 2E4 cells/mL in culture media (Lonza, EGM2 MV Bulletkit: CC-3202). Cells were plated at 10,000 cells / 500 μl / well in 8-chamber glass slide and incubated for 16 hours at 37oC, 5% CO2. After incubation, cells were fixed with 200 μl 4% paraformaldehyde at RT for 10 minutes, washed with PBS and incubated in blocking buffer (10% goat serum in PBS) for one hour on ice. Cells were washed with PBS 3X and incubated with primary antibodies or DVD-Ig molecules at 33 nM in antibody dilution buffer (5% goat serum in PBS) for one hour on ice. Cells were washed three times with PBS and incubated with Alexa Fluo 488 conjugated Goat anti-Human IgG (JacksonImmune, code: 109- 546-098; lot: 108427) 1 : 400 dilution in antibody dilution buffer, incubate on ice for 45 minutes, cells were washed three times with PBS and mounted with mounting media with DAPI. Pictures were taken by fluorescent microscopy.
A. Example 1.30: Inhibition of Sprouting in HUVEC/MSC Co-culture Sprouting Assay by Anti-VEGF-A/anti-PDGF-BB DVD-Ig Molecules
[0226] In early therapeutic treatment mode, Cytodex-3 beads (Sigma-Aldrich, cat# C3275) were coated with HUVEC cells (Lonza) overnight, and then embedded (100 beads/well) with human mesenchymal stem cells (Lonza, 20,000 cells/well) in fibrin gel in 24-well tissue culture plates. A 1:1 mixture of fresh EGM-2 complete media (Lonza) and fibroblast (Lonza) conditioned EGM-2 media were added on top of the fibrin gel along with 2 ng/mL of recombinant human HGF. Medium was replaced every 2-3 days till the end of the experiment. After EC sprouts and pericyte covering were formed usually on day 4, anti-VEGF-A (4G8.4), anti- PDGFBB (9E8.) or anti-PDGFBB/VEGF-A DVD-Ig, were added to the culture medium at 10 nM starting.10 days later cells were fixed in 4% PFA overnight at 4°C. Endothelial cells were stained with anti-PECAM (Abcam, ab32457), followed by fluorescence-conjugated secondary antibody, and pericytes were labeled with anti-αSMA-Cy3 (Sigma, C6198). Cells were then viewed by an inverted fluorescence microscope and 5 × images were captured (Figures 2 and 3). Example 2: Analytical Methods and Techniques for Physicochemical Property
Characterizations of DVD-Ig Proteins
Example 2.1: Size Exclusion Chromatography Technique
[0227] Size exclusion chromatography (SEC) is used to separate proteins based on size. Proteins are carried in an aqueous mobile phase and through a porous stationary phase resin packed in a column. The retention time in the column is a function of the hydrodynamic size of the protein and the size of the pores in the packed resin bed. Smaller molecules can penetrate into smaller pores in the resin and are retained longer than larger molecules. Samples at 1 mg/ml, or diluted with formulation buffer to this concentration, are injected onto the SEC column at a volume of 10 μl. Upon elution from the column, the proteins are detected by UV absorbance. The SEC method uses a TSK gel guard (TOSOH Biosciences, Montgomeryville, PA, cat. no. 08543) and a TSK gel G3000SWxL (TOSOH Biosciences, Montgomeryville, PA, cat. no.08541). The mobile phase was 100 mM Na2HPO4, 100 mM Na2SO4, pH 6.8. The flow rate is 0.25 ml/minute. The column temperature is room temperature. The autosampler temperature is 2-8ºC. The total run time is 55 minutes. The detection is based on UV absorbance at 214 nm
wavelength, with band width set at 8 nm, using reference wavelength at 360 nm with band width 100 nm. The resulting chromatogram is analysed for the distribution of different size species (aggregate, monomer, and fragment) by the percentage of the total area of the signal.
Example 2.2: Differential Scanning Calorimetry Technique
[0228] The thermal stability of the protein samples was assessed using a differential scanning calorimetry (DSC) instrument. The DSC instrument used was an automated VP-DSC equipment with Capillary Cell (Microcal, GE Healthcare Ltd./Microcal, Buckinghamshire, UK). Unfolding of molecules was studied applying a 1°C/minute scan rate over a 25°C - 95°C temperature range for samples at 1 mg/mL. Additional measurement parameters applied were a fitting period of 16 seconds, a pre-scan wait time of 10 minutes, and measurements were performed in none- feedback mode. For each measurement, 420 µL of sample or blank buffer was filled into the designated receptacle within the DSC instrument. The thermograms obtained (heat capacity versus temperature) were fitted to a non-two state model to obtain the midpoint temperatures and enthalpies of the different transitions.
Example 2.3: Sample Preparation
[0229] The antibodies and DVD-Ig molecules were initially obtained as a solution and diluted below 10 mg/ml with the formulation buffer. Each sample was then inserted into a separate dialysis cartridge (Slide-a-lyzer cassette, 10,000 MWCO, 3-12 mL capacity, Thermo Scientific, USA, Cat. No.66810) and dialyzed against 2L of the formulation buffer with continuous stirring via a magnetic stir bar for 18-24 hours. The samples were then retrieved from the cartridge and briefly spun down in a centrifuge and/or passed through 0.45 μm PVDF filters to remove any precipitation or particles. This was followed by up-concentration of the DVD-Ig solutions with centrifuge spin filters (Amicon Ultra 30,000 MWCO Regenerated Cellulose) to reach the desired protein concentration which was confirmed by UV measurements at 280 nm. If the solutions were above the desired concentration, they were diluted to that concentration with the formulation buffer.
Example 2.4: Storage Stability Analysis Method
[0230] The antibodies and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their physical stability during storage at 40°C, 25°C, and/or 5°C. Both 25°C (room temperature) and 5°C (storage temperature) are typical temperatures at which the samples would be subjected either during preparation and storage for manufacture or as part of the final drug product presentation. Storage at 40°C is considered an accelerated stability condition which provides an indication of long-term stability prospects. The samples were aliquoted into low volume containers (< 0.1 ml), tightly sealed, and placed at the designated temperatures (sometimes in a water bath). The samples were then pulled at periodic intervals and a small portion was removed for analysis by SEC (Example 2.1).
Example 2.5: Freeze-Thaw Analysis Method
[0231] The antibody and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their physical stability during freeze/thaw stress. Samples were aliquoted into low volume containers (< 1 ml) and tightly sealed. The samples were then placed at -80°C for at least 6 hours and then thawed at 30°C in a water bath. This was repeated three more times. After the second and fourth thaws, a small portion of each sample was removed for analysis by SEC (Example 2.1).
[0232] DVD-Ig solutions are typically frozen at -80°C for long term storage as well as shipping to remote manufacturing sites. The samples are then thawed in order to complete the drug product manufacturing process. Stability due to freeze-thawing was assessed at low concentration in order to evaluate greater exposure of protein molecules to the denaturing ice- water interfaces. At higher concentrations, proportionally less protein encounters the ice-water interface, instead interacting with other protein molecules.
Example 2.6: Viscosity Determination Method
[0233] The antibody and DVD-Ig molecule solutions prepared according to Example 2.3 were analyzed for their viscosity at room temperature (~23°C) with a Malvern Viscosizer 200 instrument. The viscosity serves as an indication of the ease of delivery of the sample through a small diameter needle attached to a syringe, a likely drug product presentation. A higher viscosity requires a greater force for delivery, and vice-versa.
Example 2.7: Intact and Reduced Molecular Weight Determination
[0234] The intact molecular weights of the three samples shown in Table 8 were acquired. Each sample was diluted to 1 mg/mL with Milli-Q water. 1.0 µL of the 1 mg/mL sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a C4 MicroTrap column. Table 9 shows the HPLC gradient for intact molecular weight analysis. Buffer A was 0.02% TFA, 0.08% FA in water. Buffer B was 0.02% TFA, 0.08% FA in acetonitrile. The flow rate was 50 µL/minute. The column temperature was set at 60°C. The mass spectrometer was operated at 5 kvolts spray voltage and the scan range was from 600 to 3200 mass to charge ratio. The deglycosylated intact molecular weights of all three samples were measured by Agilent 6510 Q- Tof LC/MS system after the samples were deglycosylated. 100 µL of 1 mg/mL sample was mixed with 5 µL of 10% N-octylglucoside and 2 µL of PNGase F enzyme. The sample was incubated at 37°C for 18 hours. 1.0 µg of the deglycosylated sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a C4 MicroTrap for deglycosylated intact molecular weight analysis.
[0235] The reduced molecular weights of all three samples were obtained. Each sample was diluted to 1 mg/mL with Milli-Q water. 1.0 µL of 1M DTT was added to 100 µL of a 1 mg/mL sample and incubated at 37°C for 30 minutes. 2.0 µL of the reduced sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a diphenyl column. The HPLC gradient for reduced molecular weight analysis is shown in Table 9. The mass spectrometer was operated at 5 kvolts spray voltage and the scan range was from 600 to 3200 mass to charge ratio. Table 8. VEGF/PDGF DVD-Ig Formulations
Figure imgf000093_0001
Table 9. PLC Operating Conditions For Intact And Reduced Molecular Weight
Figure imgf000093_0002
Example 2.8: Oligosaccharide Profiles Determined By Fc Molecular Weight Measurement
[0236] Samples were partially digested with Lys-C enzyme, reduced and analyzed by LC/MS. Different oligosaccharide species were quantitated based on the peak intensity detected by mass spectrometry and the relative percentage of different oligosaccharide species was reported. Samples were diluted to 1 mg/mL with Milli-Q water. 100 µL of each sample was mixed with 2 µL of 0.005 mg/mL Lys-C enzyme and incubated at 37°C for 30 minutes. 1 µL of 1 M DTT was added and incubated at 37°C for 30 minutes for reduction. 2 µL of sample was injected onto an Agilent 6510 Q-Tof LC/MS system with a diphenyl column and a reduced HPLC gradient was used. The column temperature was set at 60 °C. The mass spectrometer was operated at 5 kvolts spray voltage and the scan range was from 600 to 3200 mass to charge ratio.
Example 2.9: Charge Heterogeneity By Weak Cation Exchange Chromatography And Imaged Isoelectric Focusing (icIEF)
[0237] Charge heterogeneity was studied using a Propac WCX-10 column for weak cation exchange chromatography analysis. Mobile phase A was 20 mM MES, pH 5.5. Mobile phase B was 20 mM MES, 500 mM NaCl, pH 5.5. Each sample was diluted to 1 mg/mL in mobile phase A.50 µg of each sample was loaded, and the HPLC gradient is shown in Table 10. The flow rate was 1 mL/minute flow rate and the UV detector was monitored at 280 nm.
Table 10. Gradient Used For Weak Cation Exchange Chromatography
Figure imgf000094_0001
[0238] Imaged isoelectric focusing was performed on an iCE instrument from
ProteinSimple. All three samples were diluted to 1 mg/mL with Milli-Q water before mixing with amphalyte and other components as shown in Table 11. Each sample was vortexed briefly and centrifuged for 5 minutes at 10k RPM before being transferred to glass inserts for analysis. Each sample was pre-focused at 1500 V for 1 minute and focused at 3000 V for 8 minutes.
Table 11. Sample Preparation for icIEF
Figure imgf000094_0002
Example 3: Generation of Rat Anti-VEGF-A, Anti-VEGFRII, Rat-Anti-PDGF-BB, Anti- PDGFR-B Monoclonal Antibodies by DNA Immunization and Rat Hybridoma Technology Example 3.1: DNA Immunization, Hybridoma Fusion and Screening
[0239] Genetic immunization enables the development of antibodies against any protein target directly from a cDNA. A cDNA encoding the soluble human VEGFA-165, soluble human PDGF-BB, human VEGFR-II ECD (extracellular domain) or human PDGFR-BB ECD was cloned into a eukaryotic expression vector (Aldevron GmbH, Freiburg, Germany). Wistar rats were immunized by intradermal application of DNA-coated gold-particles using a hand-held device for particle-bombardment (“gene gun”). Antibody-producing splenocytes or lymph node cells were isolated and fused with fusion partner myeloma cells using polyethylene glycol (PEG) according to standard procedures. To help identify positive antisera and hybridomas, screening is done with the use of either cells transfected with screening vector encoding GPI anchored human VEGF-A165, human PDGF-BB, human VEGFR-II ECD or human PDGFR-BB ECD proteins, soluble recombinant human VEGF-A165 and human PDGF-BB protein or peptides. The tables below are the lists of antibodies generated using the rat DNA immunization approach.
[0240] Anti-VEGF-A antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays. Supernatants were tested for the ability to bind hVEGF165 (Example 1.3) and block binding of hVEGF165 to hVEGFR2 in a competition ELISA format (Example 1.4). Select hybridomas were assessed for cross-reactivity by testing for the ability to block human VEGF111 and rabbit VEGF165 in a Tyr1054
phosphorylation assay (Example 1.6) and blocking of murine VEGF164 binding to mVEGFR2 (Example 1.5). Candidate rat IgG was then examined for potency in the hVEGF165 -induced cell proliferation assay (Example 1.7), reactivity to native hVEGF165 (Example 1.11) and binding affinity measurement by Biacore analysis (Example 1.1). The data is summarized in Tables 12 and 13 below. Table 12. A List of Anti-VEGF-A Antibodies Generated Using DNA Immunization and Rat Hybridoma Technology
Figure imgf000095_0001
Figure imgf000096_0002
Table 13. Biacore Binding of Rat Anti-VEGF Antibodies
Figure imgf000096_0001
[0241] Anti-PDGF-BB antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays. Supernatants were tested for the ability to bind hPDGF-BB (Example 1.12) and block binding of hPDGF-BB to hPDGF-R in a competition ELISA format (Example 1.13). Select hybridomas were assessed for the ability to block human and rat PDGF-BB in a Tyr751 phosphorylation assay (Example 1.14). Candidate rat IgG was then examined for potency in the human, mouse and cynomolgus PDGF-BB-induced cell proliferation assay (Examples 1.15-1.17), reactivity to native hPDGF-BB (Example 1.19) and binding affinity measurement by Biacore analysis (Example 1.1). The data is summarized in Tables 14 and 15 below.
Table 14. A List of Anti-PDGF-BB Antibodies Generated using DNA Immunization and Rat Hybridoma Technology
Figure imgf000097_0001
Table 15. Biacore Binding of Rat Anti-PDGF Antibodies
Figure imgf000097_0002
Figure imgf000098_0002
[0242] Anti-VEGFR2 antibodies derived from rat hybridomas were characterized for binding, function and cross-reactivity in a panel of assays. The subcloned rat antibodies were tested for the ability to bind hVEGFR2 (Example 1.22), block binding of hVEGF-R2 to hVEGF165 in a competition ELISA format (Example 1.23), and a hVEGF165 Tyr1054 phosphorylation assay (Example 1.24). Candidate molecules were then characterized for species cross-reactivity by testing their ability to block binding of mVEGFR2 to mVEGF164 in a competition ELISA format (Example 1.25). The data is summarized in Table 16 below. Table 16. A List of Anti-VEGFR II Antibodies Generated Using DNA Immunization and Rat Hybridoma Technology
Figure imgf000098_0001
[0243] Anti-PDGF-Rβ antibodies derived from rat hybridomas were characterized for binding and function in a panel of assays. The subcloned rat antibodies were tested for the ability to bind hPDGF-Rβ (Example 1.26). Candidate IgG was also characterized for the ability to block binding of hPDGF-Rβ to hPDGF-BB in a competition ELISA format (Example 1.27) and an hPDGF-BB Tyr751 phosphorylation assay (Example 1.28). The data is summarized in Table 17 below. Attorney Docket No.12252.202-304 Table 17. A List of Anti-PDGFR-B Antibodies Generated Using DNA Immunization and Rat Hybridoma Technology
Figure imgf000099_0001
Example 4: Deduction of Variable Region Protein Sequences of Monoclonal Antibodies by DNA Cloning and Sequencing
[0244] Total RNA was extracted from hybridoma cell pellets using RNeasy mini kit (Qiagen, catalog # 74104) using the following protocol. 600 μl of buffer RLT were added to disrupt cells by pipetting up and down several times. The cell lysate was homogenized by passing it 10 times through a 20-gauge needle fitted to an RNase-free syringe. One volume of 70% ethanol was added to the homogenized lysate and mixed well by pipetting. Up to 700 μl at a time of the sample were added to an RNeasy spin column and spun for 15 seconds at 10,000 rpm, discarding flow through. 700 μl of buffer RW1 were added to the column and spun for 15 seconds at 10,000 rpm, discarding flow through. 500 μl of buffer RPE were added to wash the column membrane and spun for 15 seconds at 10,000 rpm, discarding flow through. The same step was repeated one more time, but the column was centrifuged for 2 minutes. Sample was then centrifuged for 1 minute at 10,000 rpm to eliminate any carryover of buffer RPE. RNA was eluted with 30 μl of RNase-free water by centrifuging for 1 minute at 10,000 rpm. Subsequently, 2 ^g of total RNA were used to synthesize first-strand cDNA using SuperScript First-Strand Synthesis System for RT-PCR (Invitrogen, catalog # 11904-018) according to following protocol: 2 ^g of RNA + 2 μl dNTP + 2 μl Oligo (dT) + DEPC-H2O (to 20 μl) were incubated at 65 °C for 5 minutes, then transferred to ice for at least 1 minute. The sample was then added to the following mixture: 4 μl of 10X RT buffer + 8 μl 25 mM MgCl2 + 4 μl 0.1 M DTT + 2 μl RNase OUT and incubated at 42 °C for 2 minutes. Then, 2 μl of SuperScript II RT were added to the sample and incubated at 42 °C for 50 minutes. Sample was then incubated at 70 °C for 15 minutes and chilled on ice. 2 μl of RNase H were then added and the sample was incubated at 37 °C for 20 minutes. cDNA was then used as template for PCR amplification of variable regions of antibodies. PCR was performed using first-strand cDNA, primers from Mouse Ig-Primer Set (Novagen, catalog # 69831-3) and Platinum Super Mix High Fidelity (Invitrogen, catalog # 12532-016). To amplify heavy chain variable regions, PCR samples were assembled as follows: 22.5 μl PCR Super Mix + 0.25 μl reverse primer MuIgG VH3'-2 + 1 μl cDNA + 1.25 μl of one the forward primers (VH-A, VH-B) or 0.5 μl of one of the forward primers (VH-C, VH-D, VH-E, VH-F). To amplify light 97 chain variable regions, PCR samples were assembled as follows: 22.5 μl PCR Super Mix + 0.25 μl reverse primer MuIgKVL-3'-1 + 1 μl cDNA + 1.25 μl of one the forward primers (VL-A, VL- B) or 0.5 μl of one of the forward primers (VL-C, VL-D, VL-E, VL-F, VL-G).
[0245] For samples with primers VH-A, VH-B, VL-A and VL-B, the following PCR cycles were used (40-45 cycles, steps 2 through 4):
1-Denature 94 °C 2 minutes.
2-Denature 94 °C 30 seconds.
3-Anneal 50 °C 30 seconds.
4-Extend 68 °C 1 minute.
5-Final extension 68 °C 5 minutes.
6-Cool 4 °C forever
For samples with primers VH-C through VH-F, and VL-C through VL-G, the following PCR cycles were used (40-45 cycles, steps 2 through 4):
1-Denature 94 °C 2 minutes.
2-Denature 94 ^0C 30 seconds.
3-Anneal 60 °C 30 seconds.
4-Extend 68 °C 1 minute.
5-Final extension 68 °C 5 minutes.
6-Cool 4 °C forever
[0246] PCR products were run on a 1.2% agarose gel, and bands migrating at the expected size (400-500 bp) were excised for DNA extraction. DNA was purified using QIAquick Gel Extraction Kit (Qiagen, catalog # 28704) according to the following protocol: gel slices were weighed.3 volumes of buffer QG to 1 volume of gel were added to each gel slice. Samples were incubated at 50 °C for 10 minutes until gel slices were completely dissolved, mixing every 2-3 minutes. One gel volume of isopropanol was then added to each sample and mixed. Samples were then applied to QIAquick column and centrifuged for 1 minute at 13000 rpm. To wash, 750 μl of buffer PE were added to samples and spun for 1 minute at 13000 rpm. Columns were then centrifuged for an additional minute at 13,000 rpm to completely remove residual ethanol. DNA was eluted by adding 30 μl of H2O to each column and by spinning 1 minute at 13,000 rpm. Purified PCR products were then sequenced to identify variable region sequences (see Tables below).
Figure imgf000101_0001
Figure imgf000102_0001
Figure imgf000103_0001
Figure imgf000104_0001
Figure imgf000105_0001
Figure imgf000106_0001
Figure imgf000107_0001
Figure imgf000108_0001
Figure imgf000109_0001
Figure imgf000110_0001
Figure imgf000111_0001
Figure imgf000112_0001
Figure imgf000113_0001
Figure imgf000114_0001
Figure imgf000115_0002
Example 5: Generation of Chimeric Antibodies
[0247] The variable domains of the heavy and light chain of the rat mAbs were cloned in-frame to mutant human IgG1 (L234, 235A) heavy-chain and kappa light-chain constant regions, respectively. The activities of the resulting chimeric antibodies were confirmed in ELISA-based binding and competition assays or Biacore binding assay, and were comparable to their parental rat mAbs.
[0248] Chimeric anti-VEGF-A antibodies were characterized for binding, function and cross-reactivity in a panel of assays. Potency for all chimeric molecules was characterized in the hVEGF165 -induced cell proliferation assay (Example 1.7). Binding affinity of these molecules to hVEGF165 was measured by Biacore analysis (Example 1.1). Select chimeric molecules were tested for the ability to block binding of hVEGF165 to hVEGF-R2 in a competition ELISA format (Example 1.4) and a hVEGF111 Tyr1054 phosphorylation assay (Example 1.6). Candidate molecules were then examined for potency in the HMVEC-d hVEGF165-induced proliferation assay (Example 1.10) and species cross-reactivity in the rabVEGF165 -induced cell proliferation assay (Example 1.9). The data is summarized in Tables 22 and 23 below.
Table 22. Characterization of Chimeric Anti-Human VEGF-A Monoclonal Antibodies
Figure imgf000115_0001
Figure imgf000116_0002
NT– Not tested Table 23. Biacore Binding of Rat and Rat-Human Chimera Anti-VEGF
Figure imgf000116_0001
[0249] Chimeric anti-PDGF-BB antibodies were characterized for binding, function and cross-reactivity in a panel of assays. The chimeric molecules were first tested for the ability to bind hPDGF-BB in a direct binding ELISA (Example 1.12). Binding affinity of these molecules to hPDGF-BB was then measured by Biacore analysis (Example 1.1). Functional characterization of these molecules included testing of the ability to block binding of hPDGF-BB to hPDGF-Rβ in a competition ELISA format (Example 1.13) and an hPDGFRβ Tyr751 phosphorylation assay (Example 1.14). Potency was further characterized in the hPDGF-BB - induced cell proliferation assay (Example 1.15). Candidate molecules were advanced and cross- reactivity was determined for mouse and rat/rabbit PDGF-BB in the cell-based proliferation assay (Examples 1.17-1.18). The data is summarized in Tables 24 and 25 below. Table 24. Characterization of Chimeric Anti-Human PDGF-BB Monoclonal Antibodies
Figure imgf000117_0001
NT– Not tested Table 25. Biacore Binding Of Rat And Rat-Human Chimera Anti-PDGF
Figure imgf000117_0002
[0250] Chimeric anti-VEGFR2 antibodies were tested for the ability to block binding of VEGFR2 to hVEGF165 in a competition ELISA format, as described in Example 1.22. The data is summarized in Table 26. Table 26. Characterization of Chimeric Anti-Human VEGFR II Monoclonal Antibodies
Figure imgf000118_0001
Example 6: Humanization of Rat Monoclonal Antibodies
[0251] Below are the humanization designs for the rat monoclonal antibodies, followed by summaries of amino acid sequences and characterization of selected humanized antibodies.
Example 6.1: Humanization of PDGF-BB Antibodies
Example 6.1.1: Humanization Method
[0252] Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding.
Example 6.1.2: Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized PDGF Antibodies
[0253] By applying the aforementioned method, the CDR sequences of VH and VL chains of monoclonal antibodies BDI-5H1-F6, BDI-9E8-E7, BDI-7H10-D8, BDI-1E1-D5, BDI- 6A3-A9, BFU-3E2 and BFU-11A8 were grafted onto different human heavy and light chain acceptor sequences.
Example 6.1.2.1: BDI-5H1-F6
[0254] Based on the alignments with the VH and VL sequences of monoclonal antibody BDI-5H1-F6 of the present invention, the following known human sequences are selected:
1. IGHV2-70*01 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGHV2-70*04 and IGHJ6*01 as alternative acceptor sequence for constructing heavy chain
3. IGHV3-66*01 and IGHJ1 *01as alternative acceptor sequence for constructing heavy chain
4. IGLV6-57*01 and IGJL2*01 for constructing light chain acceptor sequences 5. IGKV3-20*01 and IGJK4*01 as alternative acceptor sequences for constructing light chain
6. IGKV4-1*01 and IGJK4*01 as alternative acceptor sequences for constructing light chain 7. IGKV1-39*01 and IGJK1*01 as alternative acceptor sequences for constructing light chain
[0255] By grafting the corresponding VH and VL CDRs of BDI-5H1-F6 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.2: BDI-9E8-E7
[0256] Based on the alignments with the VH and VL sequences of monoclonal antibody BDI-9E8-E7 of the present invention, the following known human sequences are selected:
1. IGHV2-70*01 and IGHJ3*01 for constructing heavy chain acceptor sequences
2. IGHV2-70*04 and IGHJ6*01 as alternative acceptor sequence for constructing heavy chain
3. IGHV3-66*01 and IGHJ1 *01as alternative acceptor sequence for constructing heavy chain
4. IGLV6-57*01 and IGJL2*01 for constructing light chain acceptor sequences
5. IGKV3-20*01 and IGJK4*01 as alternative acceptor for constructing light chain sequences
6. IGKV4-1*01 and IGJK4*01 as alternative acceptor sequences for constructing light chain 7. IGKV1-39*01 and IGJK1*01 as alternative acceptor sequences for constructing light chain
[0257] By grafting the corresponding VH and VL CDRs of BDI-9E8-E7 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.3: BDI-7H10-D8
[0258] Based on the alignments with the VH and VL sequences of monoclonal antibody BDI-7H10-D8 of the present invention, the following known human sequences are selected:
1. IGHV1-69*01 and IGHJ3*01 for constructing heavy chain acceptor sequences 2. IGKV2-29*02 and IGK2*01 for constructing light chain acceptor sequences
[0259] By grafting the corresponding VH and VL CDRs of BDI-7H10-D8 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.4: BDI-1E1-D5
[0260] Based on the alignments with the VH and VL sequences of monoclonal antibody BDI-1E1-D5 of the present invention the following known human sequences are selected:
1. IGHV1-69*06 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGKV1D-13*01 and IGKJ2*01 for constructing light chain acceptor sequences 3. IGKV3-11*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
[0261] By grafting the corresponding VH and VL CDRs of BDI-1E1-D5 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.5: BDI-6A3-A9
[0262] Based on the alignments with the VH and VL sequences of monoclonal antibody BDI-6A3-A9 of the present invention the following known human sequences are selected:
1. IGHV3-7*01 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGHV1-3*01 and IGHJ6*01 as alternative acceptor sequence for constructing heavy chain
3. IGLV6-57*01 and IGJL2*01 for constructing light chain acceptor sequences
[0263] By grafting the corresponding VH and VL CDRs of BDI-6A3-A9 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.6: BFU-3E2
[0264] Based on the alignments with the VH and VL sequences of monoclonal antibody BFU-3E2 of the present invention, the following known human sequences are selected:
1. IGHV1-69*01 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGKV3-11*01 and IGKJ4*01 for constructing light chain acceptor sequences 3. IGKV1-13*01 and IGKJ4*01 as alternative acceptor sequence for constructing light chain
[0265] By grafting the corresponding VH and VL CDRs of BFU-3E2 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.2.7: BFU-11A8
[0266] Based on the alignments with the VH and VL sequences of monoclonal antibody BFU-11A8 of the present invention, the following known human sequences are selected:
1. IGHV1-69*01 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGKV3-11*01 and IGKJ4*01 for constructing light chain acceptor sequences
3. IGKV1-5*01 and IGKJ4*01 as alternative acceptor sequence for constructing light chain
[0267] By grafting the corresponding VH and VL CDRs of BFU-11A8 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.1.3: Introducing Potential Framework Back-Mutations In CDR-Grafted Antibodies
[0268] To generate humanized antibody with potential framework back-mutations, the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
BDI-5H1-F6
[0269] When IGHV2-70*01 and IGHJ6*01 selected as BDI-5H1-F6 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, A44→G, K75→N, V78→A, M82→I with or without N65→T (CDR change).
[0270] When IGHV2-70*04 and IGHJ6*01 selected as BDI-5H1-F6 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q→1E, K5→R, K75→N, N76→S, V78→A and M82→I.
[0271] When IGHV3-66*01 and IGHJ1*01 selected as BDI-5H1-F6 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: A24→F, V37→I, V48→L, S49→A, F67→L, R71→K, N73→T, T77→Q, L78→A, and M82→I. [0272] When IGLV6-57*01 and IGJL2*01 selected as BDI-5H1-F6 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: N1→Q, S22→P, S43→P, T46→N, G57→E, P59→S, and Y87→F.
[0273] When IGKV3-20*01 and IGJK4*01 selected as BDI-5H1-F6 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→F, A43→P, L46→N, L47→V, I58→V, G66→I, G68→S, T69→N, F71→A, Y87→F and with or without two residues insertion D66a, S66b and deletion of T10.
[0274] When IGKV4-1*01 and IGJK4*01 selected as BDI-5H1-F6 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→F, M4→L, L46→N, L47→V, T69→N, D70→S, F71→A, Y87→F.
[0275] When IGKV1-39*01 and IGJK1*01 selected as BDI-5H1-F6 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→F, M4→L, L46→N, L47→V, T69→N, D70→S, F71→A, and Y87→F.
BDI-9E8-E7
[0276] When IGHV2-70*01 and IGHJ6*01 selected as BDI-9E8-E7 heavy chain acceptor sequences, one or more of following residues could be back-mutated as follows: Q1→E, A44→G, V78→A M82→I with or without N65→T (CDR change).
[0277] When IGHV2-70*04 and IGHJ6*01 selected as BDI-9E8-E7 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, K5→R, V78→A, and M82→I.
[0278] When IGHV3-66*01 and IGHJ1*01 selected as BDI-9E8-E7 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: A24→F, V37→I, V48→L, S49→A, F67→L, R71→K, N73→T, T77→Q, L78→A, and M82→I.
[0279] When IGLV6-57*01 and IGJL2*01 selected as BDI-9E8-E7 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: S43→P, T46→N and Y87→F.
[0280] When IGKV3-20*01 and IGJK4*01 selected as BDI-9E8-E7 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→F, A43→P, L46→N, L47→V, I58→V, G66→I, T69→N, F71→A, Y87→F and W/WO two residues insertion (D66a, S66b) and deletion of T10.
[0281] When IGKV4-1*01 and IGJK4*01 selected as BDI-9E8-E7 light chain acceptor sequences, one or more of the following residues could be back mutated as follows: I2→F, M4→L, L46→N, L47→V, T69→N, D70→S, F71→A, T72→S, and Y87→F. [0282] When IGKV1-39*01 and IGJK1*01 selected as BDI-9E8-E7 light chain acceptor sequences, one or more of the following residues could be back mutated as follows: I2→F, M4→L, L46→N, L47→V, T69→N, D70→S, F71→A, and T72→S.
BDI-7H10-D8
[0283] When IGHV1-69*01and IGHJ3*01 selected as BDI-7H10-D8 heavy chain acceptor sequences, one or more of following residues could be back-mutated as follows: Q1→E, M48→I, V67→A, I69→L, E73→T, S76→N, with or without CDR changes Y27→G and T30→S.
[0284] When IGKV2-29*02 and IGKJ2*01 selected as BDI-7H10-D8 light chain acceptor sequences, one or more of following residues could be back-mutated as follows: I2→V and M4→L.
BDI-1E1-D5
[0285] When IGHV1-69*06 and IGHJ6*01 selected as BDI-1E1-D5 heavy chain acceptor sequence, one or more of the following residues could be back-mutated as follows: Q1→E M48→I, V67→A, I69→L and S76→N.
[0286] When IGKV1D-13*01 and IGKJ2*01 selected as BDI-1E1-D5 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V58→I and F71→Y.
[0287] When IGKV3-11*01 and IGKJ2*01 selected as BDI-1E1-D5 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: F71→Y and V85→T.
BDI-6A3-A9
[0288] When IGHV3-7*01 and IGHJ6*01 selected as BDI-6A3-A9 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: S28→T, R60→V, N76→S.
[0289] When IGHV1-3*01 and IGHJ6*01 selected as BDI-6A3-A9 heavy chains acceptor sequences, one or more of following residues could be back-mutated as follows: Q1→E, R44→G, M48→V, G49→A, V67→F, T73→N, A78→L and M80→L.
[0290] When IGLV6-57*01 and IGJL2*01 selected as BDI-6A3-A9 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: S43→P, T46→N, Y49→F and Y87→F. BFU-3E2
[0291] When IGHV1-69*01 and IGHJ6*01 selected as BFU-3E2 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: R38-->K, G44-->S, W47-->L, M48-->I, R66-->K, V67-->A, I69-->L, S76-->N, Y91-->F.
[0292] When IGKV3-11*01 and IGKJ4*01 selected as BFU-3E2 light chain acceptor sequences, one or more of the following could be back-mutated as follows: I2-->T, A43-->Q, I58- ->V, Y87-->F.
[0293] When IGKV1-13*01 and IGKJ4*01 selected as BFU-3E2 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2-->T, T22-- >S, A43-->Q, K45-->R, Y87-->F.
BFU-11A8
[0294] When IGHV1-69*01 and IGHJ6*01 selected as BFU-11A8 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: R38-->K,W47-->L, M48-->I, R66-->K, V67-->A, I69-->L, S76-->N, and Y91-->F.
[0295] When IGKV3-11*01 and IGKJ4*01 selected as BFU-11A8 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2-->T, S22-- >P, A43-->Q, I58-->V, Y87-->F.
[0296] When IGKV1-5*01 and IGKJ4*01 selected as BFU-11A8 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2-->T, M4-- >L, T22-->P, A43-->Q, Y87-->F.
Example 6.1.4: Generation of Humanized Antibodies To PDGF Containing
Framework Back-Mutations In CDR-Grafted Antibodies
[0297] The following humanized variable regions of the murine monoclonal PDGF antibodies were cloned into IgG expression vectors for functional characterization.
Example 6.1.4.1: BDI-5H1-F6
Table 1.4.1. Sequences of Humanized BDI-5H1-F6 Variable Regions
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
● hBDI-5H1-F6VH.1z is a CDR-grafted, humanized BDI-5H1-F6 VH containing IGHV2- 70*01 and IGHJ6 framework sequences.
● hBDI-5H1-F6VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation.
● hBDI-5H1-F6VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (A44G, K75N, V78A and M82I).
● hBDI-5H1-F6VH.1b is an intermediate design between .1 and .1a and only has two proposed framework back-mutations (A44G and M82I).
● hBDI-5H1-F6VH.1c is based on .1b with additional one CDR germlining change N65T to improve identity to human germline sequence.
● hBDI-5H1-F6VH.2z is a CDR-grafted, humanized BDI-5H1-F6 VH containing IGHV2- 70*04 and IGHJ6 framework sequences.
● hBDI-5H1-F6VH.2 is based on .2z with Q1E change to prevent pyroglutamate
formation.
● hBDI-5H1-F6VH.2a (hBDI-5H1-F6VH.1d) is based on .2 and contains four proposed framework back-mutations (K75N, N76S, V78A and M82I).
● hBDI-5H1-F6VH.2b (hBDI-5H1-F6VH.v2) is an intermediate design between .2 and .2a and only has two proposed framework back-mutations (V78A and M82I).
● hBDI-5H1-F6VH.2c (hBDI-5H1-F6VH.v6) is based on .2 and contains three proposed framework back-mutations (K5R, V78A, M82I).
● hBDI-5H1-F6VH.v7 is a humanized BDI-5H1-F6 VH containing IGHV3-66*01 and IGHJ1 framework sequences with ten proposed framework back-mutations (A24F, V37I, V48L, S49A, F67L, R71K, N73T, T77Q, L78A, and M82I). ● hBDI-5H1-F6VL.1 is a CDR-grafted humanized BDI-5H1-F6 VL containing IGLV6- 57*01 and IGJL2*01 framework sequences.
● hBDI-5H1-F6VL.1a is a humanized design based on .1 with 3 proposed framework back-mutations (S43P, T46N and Y87F).
● hBDI-5H1-F6VL.1b is a humanized design based on .1 with 7 proposed framework back-mutations ( N1Q, S22P, S43P, T46N, G57E, P59S, Y87F).
● hBDI-5H1-F6VL.1c is an intermediate design between .1 and .1b with 2 back-mutations (N1Q and Y87F).
● hBDI-5H1-F6VL.2 is a CDR-grafted humanized BDI-5H1-F6 VL containing IGKV3- 20*01 and IGJK4*01 framework sequences.
● hBDI-5H1-F6VL.2a is a humanized design based on .2 with 10 proposed framework back-mutations (I2F, A43P, L46N, L47V, I58V, G66I, G68S, T69N, F71A, Y87F) and one residue deletion (T10) and two residues insertion (D66a and S66b).
● hBDI-5H1-F6VL.2b is based on .2a only with 2 proposed framework back-mutations (I2F, L47V) and without residues deletion (T10) and insertion (D66a, S66b).
● hBDI-5H1-F6VL.2c is a humanized design on .2 with 6 proposed framework back- mutations (I2F, A43P, L46N, L47V, I58V, Y87F) and without residues deletion (T10) and insertion (D66a, S66b).
● hBDI-5H1-F6VL.v6 is a humanized BDI-5H1-F6 VL containing IGKV4-1*01 and IGJK4*01 framework sequences with eight proposed framework back-mutations (I2F, M4L, L46N, L47V, T69N, D70S, F71A, Y87F).
● hBDI-5H1-F6VL.v7 is a humanized BDI-5H1-F6 VL containing IGKV1-39*01 and IGJK1*01 framework sequences with eight proposed framework back-mutations (I2F, M4L, L46N, L47V, T69N, D70S, F71A, and Y87F).
Example 6.1.4.2: BDI-9E8-E7
Table 1.4.2. Sequences of Humanized BDI-9E8-E7 Variable Regions
Figure imgf000129_0001
Figure imgf000130_0001
● hBDI-9E8-E7VH.1z is a CDR-grafted, humanized BDI-9E8-E7 VH containing IGHV2- 70*01 and IGHJ3*01 framework sequences.
● hBDI-9E8-E7VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation.
● hBDI-9E8-E7VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (A44G, V78A and M82I).
● hBDI-9E8-E7VH.1b is an intermediate design between .1 and .1a and only has two proposed framework back-mutations (A44G and M82I).
^ hBDI-9E8-E7VH.1c is based on .1b with additional one CDR germlining change N65T to improve identity to human germline sequence.
● hBDI-9E8-E7VH.v6 is a humanized BDI-9E8-E7 VH containing IGHV2-70*04 and IGHJ6 framework sequences with four proposed framework back-mutations (Q1E, K5R, V78A, and M82I).
● hBDI-9E8-E7VH.v7 is a humanized BDI-9E8-E7 VH containing IGHV3-66*01 and IGHJ1 framework sequences with ten proposed framework back-mutations (A24F, V37I, V48L, S49A, F67L, R71K, N73T, T77Q, L78A, and M82I ). ● hBDI-9E8-E7VL.1 is a CDR-grafted humanized BDI-9E8-E7 VL containing IGLV6- 57*01 and IGJL2*01 framework sequences.
● hBDI-9E8-E7VL.1a is a humanized design based on .1 with three proposed framework back-mutations (S43P, T46N and Y87F).
● hBDI-9E8-E7VL.2 is a CDR-grafted humanized BDI-9E8-E7 VL containing IGKV3- 20*01 and IGJK4*01 framework sequences.
● hBDI-9E8-E7VL.2a is a humanized design based on .2 with 9 proposed framework back-mutations (I2F, A43P, L46N, L47V, I58V, G66I, T69N, F71A, Y87F) and one residue deletion (T10) and two residues insertion (D66a and S66b).
^ hBDI-9E8-E7VL.2b is based on .2a only with 2 proposed framework back-mutations (I2F, L47V) and without residues deletion (T10) and insertion (D66a, S66b).
● hBDI-9E8-E7VL.v6 is a humanized BDI-9E8-E7 VL containing IGKV4-1*01 and IGJK4*01 framework sequences with nine proposed framework back-mutations: (I2F, M4L, L46N, L47V, T69N, D70S, F71A, T72S, and Y87F).
● hBDI-9E8-E7VL.v7 is a humanized BDI-9E8-E7 VL containing IGKV1-39*01 and IGJK1*01 framework sequences with eight proposed framework back-mutations: I2F, M4L, L46N, L47V, T69N, D70S, F71A, and T72S. Example 6.1.4.3: BDI-7H10-D8
Table 1.4.3. Sequences of Humanized BDI-7H10-D8 Variable Regions
Figure imgf000131_0001
● hBDI-7H10-D8VH.1z is a CDR-grafted, humanized BDI-7H10-D8 VH containing
IGHV1-69*01 and IGHJ3 framework sequences.
● hBDI-7H10-D8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation.
● hBDI-7H10-D8VH.1a is a humanized design based on .1 and contains five proposed framework back-mutations (M48I, V67A, I69L, E73T and S76N).
● hBDI-7H10-D8VH.1b is an intermediate design between .1 and .1a and only has one proposed framework back-mutation M48I.
● hBDI-7H10-D8VH.1c is based on .1b with two additional CDR germlining changes Y27G and T30S.
● hBDI-7H10-D8VL.1 is a CDR-grafted humanized BDI-7H10-D8 VL containing IGKV2- 29*02 and IGKJ2 framework sequences.
● hBDI-7H10-D8VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations I2V and M4L.
^ hBDI-7H10-D8VL.1b is an intermediate design between .1 and .1a with only one
proposed framework back-mutation I2V. Example 6.1.4.4: BDI-1E1-D5
Table 1.4.4. Sequences of Humanized BDI-1E1-D5 Variable Regions
Figure imgf000133_0001
● hBDI-1E1-D5VH.1z is a CDR-grafted, humanized BDI-1E1-D5 VH containing IGHV1- 69*06 and JH6 framework sequences.
● hBDI-1E1-D5VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation. ● hBDI-1E1-D5VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (M48I, V67A, I69L and S76N).
● hBDI-1E1-D5VH.1b is an intermediate design between .1 and .1a and only has one back- mutations M48I. This design eliminates Carter residue back-mutations.
● hBDI-1E1-D5VL.1 is a CDR-grafted humanized BDI-1E1-D5 VL containing IGKV1D- 13*01 and Jk2 framework sequences.
● hBDI-1E1-D5VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations (V58I and F71Y).
● hBDI-1E1-D5VL.2 is a CDR-grafted humanized BDI-1E1-D5 VL containing IGKV3- 11*01 and Jk2 framework sequences.
● hBDI-1E1-D5VL.2a is a humanized design based on .2 with 2 proposed framework back-mutations (F71Y and V85T).
Example 6.1.4.5: BDI-6A3-A9
Table 1.4.5. Sequences of Humanized BDI-6A3-A9 Variable Regions
Figure imgf000134_0001
Figure imgf000135_0001
● hBDI-6A3-A9VH.1 is a CDR-grafted, humanized BDI-6A3-A9 VH containing IGHV3- 7*01 and JH6 framework sequences.
● hBDI-6A3-A9VH.1a is a humanized design based on .1 and contains one proposed
framework back-mutation N76S.
● hBDI-6A3-A9VH.1b is based on .1 with additional two CDR germlining changes S28T and R60V to improve identity to human germline sequence.
● hBDI-6A3-A9VH.2z is a CDR-grafted, humanized BDI-6A3-A9 VH containing IGHV1- 3*01 and JH6 framework sequences.
● hBDI-6A3-A9VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
formation.
● hBDI-6A3-A9VH.2a is a humanized design based on .2 and contains seven proposed framework back-mutations R44G, M48V, G49A, V67F, T73N, A78L and M80L. ● hBDI-6A3-A9VH.2b is an intermediate design between .2 and .2a with only three proposed framework back-mutations R44G, M48V and M80L.
● hBDI-6A3-A9VL.1 is a CDR-grafted humanized BDI-6A3-A9 VL containing IGLV6- 57*01 and JL2 framework sequences.
● hBDI-6A3-A9VL.1a is a humanized design based on .1 with 4 proposed framework back-mutations (S43P, T46N, Y49F and Y87F).
● hBDI-6A3-A9VL.1b is an intermediate design between .1 and .1a with only 1 proposed framework back-mutation Y49F. Example 6.1.4.6: BFU-3E2
Table 1.4.6. Sequences of Humanized BFU-3E2 Variable Regions
Figure imgf000136_0001
Figure imgf000137_0001
● hBFU-3E2VH.1b is an intermediate design between .1 and .1a and contains 3 proposed framework back-mutations (W47L, M48I, I69L).
● hBFU-3E2VH.1c is an intermediate design between .1 and .1a and contains 2 proposed framework back-mutations (W47L, M48I.)
● hBFU-3E2VH.1d is a humanized design based on .1 and contains 9 proposed framework back-mutations (R38K, G44S, W47L, M48I, R66K, V67A, I69L, S76N, Y91F) ● hBFU-3E2VL.1 is a CDR-grafted, humanized BFU-3E2 VL containing IGKV3-11*01 and IGKJ4*01 framework sequences.
● hBFU-3E2VL.1a is a humanized design based on .1 and contains 4 proposed framework back-mutations (I2T, A43Q, I58V, Y87F).
● hBFU-3E2VL.1b is an intermediate design between .1 and 1a. It contains 3 proposed framework back-mutations (I2T, I58V, Y87F).
● hBFU-3E2VL.1c is a design based on .1b and contains 1 proposed framework back- mutations: I2T.
● hBFU-3E2VL.2 is a CDR-grafted, humanized BFU-3E2 VL containing IGKV1-13*01 and IGKJ4*01 framework sequences.
● hBFU-3E2VL.2a is a humanized design based on .2 and contains 5 proposed framework back-mutations (I2T, T22S, A43Q, K45R, Y87F).
● hBFU-3E2VL.2b is an intermediate design between .2 and 2a. It contains 3 proposed framework back-mutations (I2T, K45R, Y87F).
● hBFU-3E2VL.2c is a design based on .2b and contains 2 proposed framework back- mutations (I2T, K45R).
Example 6.1.4.7: BFU-11A8
Table 1.4.7. Sequences of Humanized BFU-11A8 Variable Regions
Figure imgf000139_0001
Figure imgf000140_0001
● hBFU-11A8VH.1z is a CDR-grafted, humanized BFU-11A8 VH containing IGHV1- 69*01 and IGHJ6*01 framework sequences.
● hBFU-11A8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation. ● hBFU-11A8VH.1a is a humanized design based on .1 and contains 8 proposed
framework back-mutations: R38K, W47L, M48I, R66K, V67A, I69L, S76N, Y91F. ● hBFU-11A8VH.1b is an intermediate design between .1 and .1a and contains 4 proposed framework back-mutations: W47L, M48I, I69L, S76N.
● hBFU-11A8VH.1c is a design based on .1b and contains 2 proposed framework back- mutations: W47L, M48I.
● hBFU-11A8VL.1 is a CDR-grafted, humanized BFU-11A8 VL containing IGKV3-11*01 and IGKJ4*01 framework sequences.
● hBFU-11A8VL.1a is a humanized design based on .1 and contains 5 proposed
framework back-mutations: I2T, S22P, A43Q, I58V, Y87F.
● hBFU-11A8VL.1b is an intermediate design between .1 and 1a. It contains 3 proposed framework back-mutations: I2T, I58V, Y87F.
● hBFU-11A8VL.1c is a design based on .1b and contains 1 proposed framework back- mutations: I2T.
● hBFU-11A8VL.2 is a CDR-grafted, humanized BFU-11A8 VL containing IGKV1-5*01 and IGKJ4*01 framework sequences. ● hBFU-11A8VL.2a is a humanized design based on .2 and contains 5 proposed framework back-mutations: I2T, M4L, T22P, A43Q, Y87F.
● hBFU-11A8VL.2b is an intermediate design between .2 and 2a. It contains 3 proposed framework back-mutations: I2T, M4L, Y87F.
● hBFU-11A8VL.2c is a design based on .2b and contains 1 proposed framework back- mutations: I2T.
Example 6.2: Humanization Of VEGF Antibodies
Example 6.2.1: Humanization Method
[0298] Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding.
Example 6.2.2: Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized VEGF Antibodies
[0299] By applying the aforementioned method, the CDR sequences of VH and VL chains of monoclonal antibodies BDB-4G8-D4, BEW-9A8-E2, BEW-6C2-C8, BEW-9D2-E8, BEW-9E3-B9, BEW-5C3, BEW-9E10, BEW-1B10, and BEW-1E3 were grafted onto different human heavy and light chain acceptor sequences.
Example 6.2.2.1: BDB-4G8-D4
[0300] Based on the alignments with the VH and VL sequences of monoclonal antibody BDB-4G8-D4 of the present invention, the following known human sequences are selected:
1. IGHV7-4-1*02 and IGHJ3*01 for constructing heavy chain acceptor sequences 2. IGHV1-18*01 and IGHJ3*01 as backup acceptor sequences for constructing heavy chain 3. IGHV5-51*01 and IGHJ3*01 as backup acceptor sequences for constructing heavy chain 4. IGHV3-66*01 and IGHJ1*01 as backup acceptor sequences for constructing heavy chain 5. IGKV1D-13*01 and IGKJ2*01 for constructing light chain acceptor sequences
6. IGKV3-11*01 and IGKJ2*01 as alternative acceptor sequences for constructing light chain
7. IGKV3-15*01 and IGKJ5*01 as alternative acceptor sequences for constructing light chain 8. IGKV3-15*01 and IGKJ1*01 as alternative acceptor sequences for constructing light chain
9. IGKV1-39*01 and IGKJ1*01 as alternative acceptor sequences for constructing light chain.
[0301] By grafting the corresponding VH and VL CDRs of BDB-4G8-D4 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.2: BEW-9A8-E2
[0302] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-9A8-E2 of the present invention the following known human sequences are selected:
1. IGHV7-81*01 and IGHJ1*01 for constructing heavy chain acceptor sequences 2. IGHV1-18*01 and IGHJ1*01 as alternative acceptor sequence for constructing heavy chain
3. IGHV7-4-1*01 and IGHJ1*01 as alternative acceptor sequence for constructing heavy chain
4. IGKV6-21*01 and IGKJ2*01 for constructing light chain acceptor sequences 5. IGKV1-39*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
6. IGKV3-11*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
7. IGKV1-13*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
[0303] By grafting the corresponding VH and VL CDRs of BEW-9A8-E2 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.3: BEW-6C2-C8
[0304] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-6C2-C8 of the present invention the following known human sequences are selected:
1. IGHV3-7*01 and IGHJ3*01 for constructing heavy chain acceptor sequences 2. IGKV3-11*01 and IGKJ2*01 for constructing light chain acceptor sequences 3. IGKV1-39*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
[0305] By grafting the corresponding VH and VL CDRs of BEW-6C2-C8 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.4: BEW-9D2-E8
[0306] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-9D2-E8 of the present invention the following known human sequences are selected:
1. IGHV7-81*01 and IGHJ4*01 for constructing heavy chain acceptor sequences 2. IGHV1-18*01 and IGHJ4*01 as alternative acceptor sequence for constructing heavy chain
3. IGKV3-11*01 and IGKJ2*01 for constructing light chain acceptor sequences 4. IGKV1-39*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
[0307] By grafting the corresponding VH and VL CDRs of BEW-9D2-E8 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.5: BEW-9E3-B9
[0308] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-9E3-B9 of the present invention the following known human sequences are selected:
1. IGHV7-81*01 and IGHJ4*01 for constructing heavy chain acceptor sequences 2. IGHV1-18*01 and IGHJ4*01 as alternative acceptor sequence for constructing heavy chain
3. IGKV3-11*01 and IGKJ2*01 for constructing light chain acceptor sequences 4. IGKV1-39*01 and IGKJ2*01 as alternative acceptor sequence for constructing light chain
[0309] By grafting the corresponding VH and VL CDRs of BEW-9E3-B9 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared. Example 6.2.2.6: BEW-5C3
[0310] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-5C3 of the present invention, the following known human sequences are selected:
1. IGHV7-4-1*01 and IGHJ1*01 for constructing heavy chain acceptor sequences
2. IGHV1-69*06 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3. IGKV3-11*01 and IGKJ4*01 for constructing light chain acceptor sequences
4. IGKV1-13*01 and IGKJ4*01 as alternative acceptor for constructing light chain
[0311] By grafting the corresponding VH and VL CDRs of BEW-5C3 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.7: BEW-9E10
[0312] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-9E10 of the present invention, the following known human sequences are selected:
1. IGHV7-4-1*01 and IGHJ1*01 for constructing heavy chain acceptor sequences
2. IGHV1-69*06 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3. IGKV1-27*01 and IGKJ2*01 for constructing light chain acceptor sequences
[0313] By grafting the corresponding VH and VL CDRs of BEW-9E10 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.2.8: BEW-1B10
[0314] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-1B10 of the present invention, the following known human sequences are selected:
1. IGHV3-7*01 and IGHJ6*01 for constructing heavy chain acceptor sequences
2. IGKV1-39*01 and IGKJ4*01 for constructing light chain acceptor sequences
[0315] By grafting the corresponding VH and VL CDRs of BEW-1B10 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared. Example 6.2.2.9: BEW-1E3
[0316] Based on the alignments with the VH and VL sequences of monoclonal antibody BEW-1E3 of the present invention, the following known human sequences are selected:
1. IGHV7-4-1*01(0-1) and IGHJ1*01 for constructing heavy chain acceptor sequences 2. IGHV1-18*01 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3. IGKV3-11*01 and IGKJ2*01 for constructing light chain acceptor sequences
4. IGKV1-13*01 and IGKJ2*01 as alternative acceptor for constructing light chain
[0317] By grafting the corresponding VH and VL CDRs of BEW-1E3 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.2.3: Introducing Potential Framework Back-Mutations In CDR-Grafted Antibodies
[0318] To generate humanized antibody with potential framework back-mutations, the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
Example 6.2.3.1: BDB-4G8-D4
[0319] When IGHV7-4-1*02 and IGHJ3*01 selected as BDB-4G8-D4 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→, V2→I, W47→Y, and Y91→F.
[0320] When IGHV1-18*01 and IGHJ3*01 selected as BDB-4G8-D4 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, W47→Y, V67→F, M69→F, T71→L and Y91→F.
[0321] When IGHV5-51*01 and IGHJ3*01 selected as BDB-4G8-D4 heavy chain acceptor sequences, one or more following residues could be back-mutated as follows: V2→I, A9→T, G24→A, R38→K, W47→Y, Q66→R, V67→F, I69→F, A71→L, I75→F, S76→N, Y79→F and Y91→F.
[0322] When IGHV3-66*01 and IGHJ1*01 selected as BDB-4G8-D4 heavy chain acceptor sequences, one or more following residues could be back-mutated as follows: V2→I, E6→Q, L11→V, R38→K, W47→Y, V48→M, S49→G, I69→F, R71→L, N73→T, N76→S, L78→A, M82→L and Y91→F.
[0323] When IGKV1D-13*01 and IGKJ2*01 selected as BDB-4G8-D4 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, A43→Q and Y87→F with or without one residue deletion (S10).
[0324] When IGKV3-11*01 and IGKJ2*01 selected as BDB-4G8-D4 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: E1→D, I2→T, I58→V, and Y87→F.
[0325] When IGKV3-15*01 and IGKJ5*01 or IGKJ5*01 selected as BDB-4G8-D4 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: E1→D, I2→T, M4→L, A9→S, L13→A, L21→I, R45→K, I58→V, A60→S, G66→R, E70→D, E79→Q and Y87→F.
[0326] When IGKV1-39*01 and IGKJ1*01 selected as BDB-4G8-D4 light chain acceptor sequences, one or more of the following residues could be back- mutated as follows: I2→T, M4→L, T22→S, and Y87→F.
Example 6.2.3.2: BEW-9A8-E2
[0327] When IGHV7-81*01 and IGHJ1*01 selected as BEW-9A8-E2 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E V2→I, P38→K, W47→Y, M71→L, Y90→F and Y91→F with or without CDR change T28→S.
[0328] When IGHV1-18*01 and IGHJ1*01 selected as BEW-9A8-E2 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, R38→K, W47→Y, V67→F, M69→F, T71→L, Y90→F and Y91→F.
[0329] When IGHV7-4-1*01 and IGHJ1*01 selected as BEW-9A8-E2 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, R38→K, W47→Y, Y90→F, Y91→F.
[0330] When IGKV6-21*01 and IGKJ2*01 selected as BEW-9A8-E2 light chain accepter sequences, one or more of the following residues could be back-mutated as follows: I2→T, S43→Q, K49→H and Y87→F. Additional mutations include the following: F10 deletion.
[0331] When IGKV1-39*01 and IGKJ2*01 selected as BEW-9A8-E2 light chain accepter sequemces, one or more of the following residues could be back-mutated as follows: I2→T, M4→L, A43→Q, Y49→H and Y87→F. Additional mutations include the following: S10 deletion. [0332] When IGKV3-11*01 and IGKJ2*01 selected as BEW-9A8-E2 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, Y49→H, I58→V, V85→T, and Y87→F.
[0333] When IGKV1-13*01 and IGKJ2*01 selected as BEW-9A8-E2 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, T22→S, Y49→H, Y87→F.
Example 6.2.3.3: BEW-6C2-C8
[0334] When IGHV3-7*01 and IGHJ3*01 selected as BEW-6C2-C8 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V37→I, V48→M and R94→A.
[0335] When IGKV3-11*01 and IGKJ2*01 selected as BEW-6C2-C8 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: F71→Y and Y87→F.
[0336] When IGKV1-39*01 and IGKJ2*01 selected as BEW-6C2-C8 light chain acceptor sequence, one or more of the following residues could be back-mutated as follows: M4→L, V58→I, F71→Y and Y87→F.
Example 6.2.3.4: BEW-9D2-E8
[0337] When IGHV7-81*01 and IGHJ4*01 selected as BEW-9D2-E8 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, P38→K, Q39→L, W47→Y, M48→L, M71→L and Y91→F with or without CDR change T28→S.
[0338] When IGHV1-18*01 and IGHJ4*01 selected as BEW-9D2-E8 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, R38→K, Q39→L, W47→Y, M48→L, V67→F, M69→F, T71→L, M80→L and Y91→F.
[0339] When IGKV3-11*01 and IGKJ2*01 selected as BEW-9D2-E8 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, A43→Q, I58→V and Y87→F. Additional mutations include the following: T10 deletion.
[0340] When IGKV1-39*01 and IGKJ2*01 selected as BEW-9D2-E8 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, M4→L, A43→Q and Y87→F. Additional mutations include the following: T10 deletion. Example 6.2.3.5: BEW-9E3-B9
[0341] When IGHV7-81*01 and IGHJ4*01 selected as BEW-9E3-B9 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1E, V2→I, W47→Y, M71→L and Y91→F with or without CDR change T28→S.
[0342] When IGHV1-18*01 and IGHJ4*01 selected as BEW-9E3-B9 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q1→E, V2→I, W47→Y, V67→F, M69→F, T71→L and Y91→F.
[0343] When IGKV3-11*01 and IGKJ2*01 selected as BEW-9E3-B9 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, A43→Q, I58→V and Y87→F. Additional mutations include the following: S10 deletion.
[0344] When IGKV1-39*01 and IGKJ2*01 selected as BEW-9E3-B9 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I2→T, M4→L, A43→Q and Y87→F. Additional mutations include the following: S10 deletion.
Example 6.2.3.6: BEW-5C3
[0345] When IGHV7-4-1*01 and IGHJ1*01 selected as BEW-5C3 heavy chain accepter sequences, one or more of the following residues could be back-mutated as follows: V2→I, R38→K, W47→Y, Y90→F, Y91→F.
[0346] When IGHV1-69*01 and IGHJ1*01 selected as BEW-5C3 heavy chain accepter sequences, one or more of the following residues could be back-mutated as follows: V67→F, I69→F, A71→L. Additional mutations include the following: V2→I, R38→K, W47→Y, T68→V, M80→L, Y90→F, Y91→F.
[0347] When IGKV3-11*01 and IGKJ4*01 selected as BEW-5C3 light chain accepter sequences, one or more of the following residues could be back-mutated as follows: E1→D, I2→T, Y36→F, Y87→F. Additional mutations include the following: A43→Q, I58→V, C34→S (CDR change).
[0348] When IGKV1-13*01 and IGKJ4*01 selected as BEW-5C3 light chain accepter sequences, one or more of the following residues could be back-mutated as follows: A1→D, I2→T, T22→S, Y36→F, A43→Q, Y87→F with CDR change C34→S.
Example 6.2.3.7: BEW-9E10
[0349] When IGHV7-4-1*01 and IGHJ1*01 selected as BEW-9E10 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V2→I, R38→K, W47→Y, Y91→F. [0350] When IGHV1-69*06 and IGHJ1*01 selected as BEW-9E10 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V67→F, I69→F. Additional mutations include the following: V2→I, R38→K, W47→Y, Y91→F.
[0351] When IGKV1-27*01 and IGKJ2*01 selected as BEW-9E10 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Q3→R, V43→S, F71→Y, Y87→F. Additional mutations include the following: T22→E, T72→S.
Example 6.2.3.8: BEW-1B10
[0352] When IGHV3-7*01 and IGHJ6*01 selected as BEW-1B10 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V37→F, I69→V. Additional mutations include the following: N76→S, S77→T.
[0353] When IGKV1-39*01 and IGKJ4*01 selected as BEW-1B10 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: A43→S, F71→Y. Additional mutations include the following: L47→V.
Example 6.2.3.9: BEW-1E3
[0354] When IGHV7-4-1*01 and IGHJ1*01 selected as BEW-1E3 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V2→I, R38→K, W47→Y, Y91→F.
[0355] When IGHV1-18*01 and IGHJ1*01 selected as BEW-1E3 heavy chain acceptor sequences, one or more of the following residues could be back-mutated as follows: V67→F, M69→F, T71→L. Additional mutations include the following: V2→I, R38→K, W47→Y, Y91→F.
[0356] When IGKV3-11*01 and IGKJ2*01 selected as BEW-1E3 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: I58→V, Y87→F. Additional mutations include the following: I2→T, A43→Q.
[0357] When IGKV1-13*01 and IGKJ2*01 selected as BEW-1E3 light chain acceptor sequences, one or more of the following residues could be back-mutated as follows: Y87→F. Additional mutations include the following: I2→T, T22→S, A43→Q.
Example 6.2.4: Generation Of Humanized Antibodies To VEGF Containing Framework Back-Mutations In CDR-Grafted Antibodies
[0358] The following humanized variable regions of the murine monoclonal VEGF antibodies were cloned into IgG expression vectors for functional characterization. Example 6.2.4.1: BDB-4G8-D4
Table 2.4.1. Sequences of Humanized BDB-4G8-D4 Variable Regions
Figure imgf000150_0001
Figure imgf000151_0001
● hBDB-4G8-D4VH.1z is a CDR-grafted, humanized BDB-4G8-D4 VH containing IGHV7-4-1*02 and IGHJ3*01 framework sequences.
● hBDB-4G8-D4VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
● hBDB-4G8-D4VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (V2I, W47Y and Y91F).
● hBDB-4G8-D4VH.1b is an intermediate design between .1 and .1a and only has one back-mutations W47Y.
● hBDB-4G8-D4VH.2z is a CDR-grafted, humanized BDB-4G8-D4 VH containing IGHV1-18*01 and IGHJ3*01 framework sequences. ● hBDB-4G8-D4VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation.
● hBDB-4G8-D4VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (V2I, W47Y, V67F, M69F, T71L and Y91F).
● hBDB-4G8-D4VH.2b is an intermediate design between .2 and .2a and only has two proposed framework back-mutations (W47Y and T71L).
● hBDB-4G8-D4VH.v3 is a humanized BDB-4G8-D4 VH containing IGHV5-51*01 and IGHJ3*01 framework sequences with thirteen proposed framework back-mutations (V2I, A9T, G24A, R38K, W47Y, Q66R, V67F, I69F, A71L, I75F, S76N, Y79F and Y91F). ● hBDB-4G8-D4VH.v4 is a humanized BDB-4G8-D4 VH containing IGHV3-66*01 and IGHJ1*01 framework sequences with thirteen proposed framework back-mutations (V2I, E6Q, L11V, W47Y, V48M, S49G, I69F, R71L, N73T, N76S, L78A, M82L and Y91F). ● hBDB-4G8-D4VH.v5 is a humanized BDB-4G8-D4 containing IGHV3-66*01 and
IGHJ1*01 framework sequences with ten proposed framework back-mutations (R38K, W47Y, V48M, S49G, I69F, R71L, N73T, N76S, L78A and Y91F).
● hBDB-4G8-D4VL.1 is a CDR-grafted humanized BDB-4G8-D4 VL containing
IGKV1D-13*01 and IGKJ2*01 framework sequences.
● hBDB-4G8-D4VL.1a is a humanized design based on .1 with 3 proposed framework back-mutations (I2T, A43Q and Y87F) and one residue deletion (S10).
● hBDB-4G8-D4VL.1b is an intermediate design between .1 and .1a with only one
proposed framework back-mutation I2T.
● hBDB-4G8-D4VL.1c is a humanized design based on .1b with one residue insertion (S10).
● hBDB-4G8-D4VL.v2 is a humanized BDB-4G8-D4 VL containing IGKV3-11*01 and IGKJ2*01 framework sequences with four proposed framework back-mutations (E1D, I2T, I58V, and Y87F).
● hBDB-4G8-D4VL.v3 is a humanized BDB-4G8-D4 VL design containing IGKV3-15*01 and IGKJ5*01 framework sequences with five proposed framework back-mutations (I2T, M4L, I58V, E70D, and Y87F).
● hBDB-4G8-D4VL.v4 is a humanized BDB-4G8-D4 VL containing IGKV3-15*01 and IGKJ1*01 framework sequences with eleven proposed framework back-mutations (E1D, I2T, A9S, L13A, L21I, R45K, I58V, A60S, G66R, E79Q, and Y87F). ● hBDB-4G8-D4VL.v5 is a humanized BDB-4G8-D4 VL containing IGKV1-39*01 and IGKJ1*01 framework sequences with four proposed framework back-mutations (I2T, M4L, T22S, and Y87F).
Example 6.2.4.2: BEW-9A8-E2
Table 2.4.2. Sequences of Humanized BEW-9A8-E2 Variable Regions
Figure imgf000153_0001
Figure imgf000154_0001
Figure imgf000155_0001
● hBEW-9A8-E2VH.1z is a CDR-grafted, humanized BEW-9A8-E2 VH containing IGHV7-81*01 and IGHJ1*01 framework sequences. ● hBEW-9A8-E2VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
● hBEW-9A8-E2VH.1a is a humanized design based on .1 and contains six proposed framework back-mutations (V2I, P38K, W47Y, M71L, Y90F and Y91F).
● hBEW-9A8-E2VH.1b is an intermediate design between .1 and .1a and only has three proposed framework back-mutations (W47Y, M71L and Y90F).
● hBEW-9A8-E2VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
● hBEW-9A8-E2VH.2z is a CDR-grafted, humanized BEW-9A8-E2 VH containing
IGHV1-18*01 and IGHJ1*01 framework sequences.
● hBEW-9A8-E2VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
formation.
● hBEW-9A8-E2VH.2a is a humanized design based on .2 and contains eight proposed framework back-mutations (V2I, R38K, W47Y, V67F, M69F, T71L, Y90F and Y91F). ● hBEW-9A8-E2VH.2b is an intermediate design between .2 and .2a and contains three back-mutations (W47Y, M71L and Y90F).
● hBEW-9A8-E2VH.2c (hBEW-9A8VH.4a) is an intermediate design between .2 and .2a and contains six proposed framework back-mutations (V2I, R38K, W47Y, V67F, M69F, and T71L).
● hBEW-9A8-E2VH.2d (hBEW-9A8VH.4b) is an intermediate design between .2 and .2a contains four proposed framework back-mutations (V2I, V67F, M69F, and T71L).
● hBEW-9A8VH.3z is a CDR-grafted, humanized BEW-9A8 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
● hBEW-9A8VH.3 is based on .3z with a Q1E change to prevent pyroglutamate formation. ● hBEW-9A8VH.3a is a humanized design based on .3 and contains 3 proposed
framework back-mutations (V2I, R38K, W47Y).
● hBEW-9A8VH.3b is an intermediate design between .3 and .3a and contains 1 proposed framework back-mutations: V2I.
● hBEW-9A8VH.3c is a humanized design based on .3 and contains 5 proposed framework back-mutations (V2I, R38K, W47Y, Y90F, Y91F).
● hBEW-9A8-E2VL.1 is a CDR-grafted humanized BEW-9A8-E2 VL containing IGKV6- 21*01 and IGKJ2*01 framework sequences. ● hBEW-9A8-E2VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, S43Q, K49H and Y87F).
● hBEW-9A8-E2VL.1b is an intermediate design between .1 and .1a with only two
proposed framework back-mutation (I2T and K49H).
● hBEW-9A8-E2VL.1c is based on .1b with one residue deletion of F10.
● hBEW-9A8-E2VL.2 is a CDR-grafted humanized BEW-9A8-E2 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
● hBEW-9A8-E2VL.2a is a humanized design based on .2 with five proposed framework back-mutations (I2T, M4L, A43Q, Y49H and Y87F).
● hBEW-9A8-E2VL.2b is an intermediate design between .1 and .1a with only two
proposed framework back-mutation (I2T and Y49H).
● hBEW-9A8-E2VL.2c is based on .2b with one residue deletion of S10.
● hBEW-9A8VL.3 is a CDR-grafted, humanized BEW-9A8 VL containing IGKV3-11*01 and IGKJ2*01 framework sequences.
● hBEW-9A8VL.3a is a humanized design based on .3 and contains 5 proposed framework back-mutations: (I2T, Y49H, I58V, V85T, Y87F).
● hBEW-9A8VL.3b is an intermediate design between .3 and 3a. It contains 2 proposed framework back-mutations: (I2T, Y87F).
● hBEW-9A8VL.3c is a design based on .3b and contains 1 proposed framework back- mutations: I2T.
● hBEW-9A8VL.4 is a CDR-grafted, humanized BEW-9A8 VL containing IGKV1-13*01 and IGKJ2*01 framework sequences.
● hBEW-9A8VL.4a is a humanized design based on .4 and contains 4 proposed framework back-mutations: I2T, T22S, Y49H, Y87F.
● hBEW-9A8VL.4b is an intermediate design between .4 and 4a. It contains 2 proposed framework back-mutations: I2T, Y87F.
● hBEW-9A8VL.4c is a design based on .4b and eliminated Carter residue back-mutations.
It contains 1 proposed framework back-mutations: I2T. Example 6.2.4.3: BEW-6C2-C8
Table 2.4.3. Sequences of Humanized BEW-6C2-C8 Variable Regions
Figure imgf000158_0001
● hBEW-6C2-C8VH.1 is a CDR-grafted, humanized BEW-6C2-C8 VH containing
IGHV3-7*01 and IGHJ3*01 framework sequences.
● hBEW-6C2-C8VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations V37I, V48M and R94A.
● hBEW-6C2-C8VH.1b is an intermediate design between .1 and .1a and only has two back-mutations V48M and R94A. This design eliminates Carter residue back-mutations. ● hBEW-6C2-C8VL.1 is a CDR-grafted humanized BEW-6C2-C8 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences. ● hBEW-6C2-C8VL.1a is a humanized design based on .1 with 2 proposed framework back-mutations (F71Y and Y87F).
● hBEW-6C2-C8VL.2 is a CDR-grafted humanized BEW-6C2-C8 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
● hBEW-6C2-C8VL.2a is a humanized design based on .2 with 4 proposed framework back-mutations (M4L, V58I, F71Y and Y87F).
Example 6.2.4.4: BEW-9D2-E8
Table 2.4.4. Sequences of Humanized BEW-9D2-E8 Variable Regions
Figure imgf000159_0001
Figure imgf000160_0001
● hBEW-9D2-E8VH.1z is a CDR-grafted, humanized BEW-9D2-E8 VH containing IGHV7-81*01 and IGHJ4*01 framework sequences.
● hBEW-9D2-E8VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation. ● hBEW-9D2-E8VH.1a is a humanized design based on .1 and contains seven proposed framework back-mutations (V2I, P38K, Q39L, W47Y, M48L, M71L and Y91F).
● hBEW-9D2-E8VH.1b is an intermediate design between .1 and .1a and only has four proposed framework back-mutations ( P38K, W47Y, M48L, M71L).
● BEW-9D2-E8VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
● hBEW-9D2-E8VH.2z is a CDR-grafted, humanized BEW-9D2-E8 VH containing
IGHV1-18*01 and IGHJ4*01 framework sequences.
● hBEW-9D2-E8VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
formation.
● hBEW-9D2-E8VH.2a is a humanized design based on .2 and contains ten proposed framework back-mutations (V2I, R38K, Q39L, W47Y, M48L, V67F, M69F, T71L, M80L and Y91F).
● hBEW-9D2-E8VH.2b is an intermediate design between .2 and .2a and only has five proposed framework back-mutations (R38K, W47Y, M48L, T71L and M80L).
● hBEW-9D2-E8VL.1 is a CDR-grafted humanized BEW-9D2-E8 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences.
● hBEW-9D2-E8VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, A43Q, I58V and Y87F).
● hBEW-9D2-E8VL.1b is an intermediate design between .1 and .1a with one proposed framework back-mutation I2V.
● hBEW-9D2-E8VL.2 is a CDR-grafted humanized BEW-9D2-E8 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
● hBEW-9D2-E8VL.2a is a humanized design based on .2 with four proposed framework back-mutations (I2T, M4L, A43Q and Y87F).
● hBEW-9D2-E8VL.2b is an intermediate design between .2 and .2a with one proposed framework back-mutation I2V.
Example 6.2.4.5 BEW-9E3-B9
Table 2.4.5. Se uences of Humanized BEW-9E3-B9 Variable Re ions
Figure imgf000162_0001
Figure imgf000163_0001
● hBEW-9E3-B9VH.1z is a CDR-grafted, humanized BEW-9E3-B9 VH containing IGHV7-81*01 and IGHJ4*01 framework sequences.
● hBEW-9E3-B9VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
● hBEW-9E3-B9VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (V2I, W47Y, M71L and Y91F).
● hBEW-9E3-B9VH.1b is an intermediate design between .1 and .1a and only has two back-mutations (W47Y and M71L).
● hBEW-9E3-B9VH.1c is based on .1b with additional one CDR germlining change T28S to improve identity to human germline sequence.
● hBEW-9E3-B9VH.2z is a CDR-grafted, humanized BEW-9E3-B9 VH containing IGHV1-18*01 and IGHJ4*01 framework sequences. ● hBEW-9E3-B9VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation.
● hBEW-9E3-B9VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (V2I, W47Y, V67F, M69F, T71L and Y91F).
● hBEW-9E3-B9VH.2b is an intermediate design between .2 and .2a and only has two back-mutations W47Y and T71L.
● hBEW-9E3-B9VL.1 is a CDR-grafted humanized BEW-9E3-B9 VL containing IGKV3- 11*01 and IGKJ2*01 framework sequences.
● hBEW-9E3-B9VL.1a is a humanized design based on .1 with four proposed framework back-mutations (I2T, A43Q, I58V and Y87F).
● hBEW-9E3-B9VL.1b is an intermediate design between .1 and .1a with 1 proposed framework back-mutation I2T.
● hBEW-9E3-B9VL.2 is a CDR-grafted humanized BEW-9E3-B9 VL containing IGKV1- 39*01 and IGKJ2*01 framework sequences.
● hBEW-9E3-B9VL.2a is a humanized design based on .1 with four proposed framework back-mutations (I2T, M4L, A43Q and Y87F).
● hBEW-9E3-B9VL.2b is an intermediate design between .1 and .1a with 1 proposed framework back-mutation I2T.
Example 6.2.4.6: BEW-5C3
Table 2.4.6. Sequences of Humanized BEW-5C3 Variable Regions
Figure imgf000164_0001
Figure imgf000165_0001
● hBEW-5C3VH.1z is a CDR-grafted, humanized BEW-5C3 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
● hBEW-5C3VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation. ● hBEW-5C3VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (V2I, R38K, W47Y).
● hBEW-5C3VH.1b is a humanized design based on .1 and contains five proposed
framework back-mutations (V2I, R38K, W47Y, Y90F, Y91F).
● hBEW-5C3VH.2z is a CDR-grafted, humanized BEW-5C3 VH containing IGHV1- 69*06 and IGHJ1*01 framework sequences.
● hBEW-5C3VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation. ● hBEW-5C3VH.2a is a humanized design based on .2 and contains seven proposed
framework back-mutations (V2I, R38K, W47Y, V67F, I69F, A71L, Y91F).
● hBEW-5C3VH.2b is an intermediate design between .2 and .2a and contains three
proposed framework back-mutations (V67F, I69F, A71L).
● hBEW-5C3VH.2c is a humanized design based on .2 and contains ten proposed
framework back-mutations (V2I, R38K, W47Y, V67F, T68V, I69F, A71L, M80L, Y90F, Y91F).
● hBEW-5C3VL.1 is a CDR-grafted, humanized BEW-5C3 VL containing IGKV3-11*01 and IGKJ4*01 framework sequences.
● hBEW-5C3VL.1a is a humanized design based on .1 and contains six proposed
framework back-mutations (E1D, I2T, Y36F, A43Q, I58V, Y87F).
● hBEW-5C3VL.1b is an intermediate design between .1 and 1a. It contains four proposed framework back-mutations (E1D, I2T, Y36F, Y87F).
● hBEW-5C3VL.1c is a design based on .1b and contains two proposed framework back- mutations (E1D, I2T)
● hBEW-5C3VL.2 is a CDR-grafted, humanized BEW-5C3 VL containing IGKV1-13*01 and IGKJ4*01 framework sequences.
● hBEW-5C3VL.2a is a humanized design based on .2 and contains six proposed
framework back-mutations (A1D, I2T, T22S, Y36F, A43Q, Y87F).
● hBEW-5C3VL.2b is an intermediate design between .2 and 2a. It contains four proposed framework back-mutations (A1D, I2T, Y36F, Y87F).
● hBEW-5C3VL.2c is a design based on .2b and contains two proposed framework back- mutations (A1D, I2T) Example 6.2.4.7: BEW-9E10
Table 2.4.7. Sequences of Humanized BEW-9E10 Variable Regions
Figure imgf000167_0001
● hBEW-9E10VH.1z is a CDR-grafted, humanized BEW-9E10 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences. ● hBEW-9E10VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation.
● hBEW-9E10VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (V2I, R38K, W47Y, Y91F).
● hBEW-9E10VH.2z is a CDR-grafted, humanized BEW-9E10 VH containing IGHV1- 69*06 and IGHJ1*01 framework sequences.
● hBEW-9E10VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
formation.
● hBEW-9E10VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (V2I, R38K, W47Y, V67F, I69F, Y91F).
● hBEW-9E10VH.2b is an intermediate design between .2 and .2a and contains two proposed framework back-mutations: (V67F, I69F).
● hBEW-9E10VL.1 is a CDR-grafted, humanized BEW-9E10 VL containing IGKV1- 27*01 and IGKJ2*01 framework sequences.
● hBEW-9E10VL.1a is a humanized design based on .1 and contains six proposed framework back-mutations (Q3R, T22E, V43S, F71Y, T72S, Y87F).
● hBEW-9E10VL.1b is an intermediate design between .1 and 1a. It contains four proposed framework back-mutations (Q3R, V43S, F71Y, Y87F).
Example 6.2.4.8: BEW-1B10
Table 2.4.8. Sequences of Humanized BEW-1B10 Variable Regions
Figure imgf000168_0001
Figure imgf000169_0002
● hBEW-1B10VH.1 is a CDR-grafted, humanized BEW-1B10 VH containing IGHV3- 7*01 and IGHJ6*01 framework sequences.
● hBEW-1B10VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (V37F, I69V, N76S, S77T).
● hBEW-1B10VH.1b is an intermediate design between .1 and .1a and contains two proposed framework back-mutations: (V37F, I69V).
● hBEW-9E10VH.1z is a CDR-grafted, humanized BEW-9E10 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
● hBEW-9E10VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation.
● hBEW-1B10VL.1 is a CDR-grafted, humanized BEW-1B10 VL containing IGKV1- 39*01 and IGKJ4*01 framework sequences.
● hBEW-1B10VL.1a is a humanized design based on .1 and contains three proposed framework back-mutations: (A43S, L47V, F71Y).
● hBEW-1B10VL.1b is an intermediate design between .1 and 1a. It contains two
proposed framework back-mutations (A43S, F71Y).
Example 6.2.4.9: BEW-1E3
Table 2.4.9. Sequences of Humanized BEW-1E3 Variable Regions
Figure imgf000169_0001
Figure imgf000170_0001
● hBEW-1E3VH.1z is a CDR-grafted, humanized BEW-1E3 VH containing IGHV7-4- 1*01 and IGHJ1*01 framework sequences.
● hBEW-1E3VH.1 is based on .1z with a Q1E change to prevent pyroglutamate formation. ● hBEW-1E3VH.1a is a humanized design based on .1 and contains four proposed framework back-mutations (V2I, R38K, W47Y, Y91F).
● hBEW-1E3VH.2z is a CDR-grafted, humanized BEW-1E3 VH containing IGHV1- 18*01 and IGHJ1*01 framework sequences.
● hBEW-1E3VH.2 is based on .2z with a Q1E change to prevent pyroglutamate formation. ● hBEW-1E3VH.2a is a humanized design based on .2 and contains seven proposed
framework back-mutations (V2I, R38K, W47Y, V67F, M69F, T71L, Y91F).
● hBEW-1E3VH.2b is an intermediate design between .2 and .2a and contains three
proposed framework back-mutations (V67F, M69F, T71L).
● hBEW-1E3VL.1 is a CDR-grafted, humanized BEW-1E3 VL containing IGKV3-11*01 and IGKJ2*01 framework sequences.
● hBEW-1E3VL.1a is a humanized design based on .1 and contains four proposed
framework back-mutations (I2T, A43Q, I58V, Y87F).
● hBEW-1E3VL.1b is an intermediate design between .1 and 1a. It contains two proposed framework back-mutations (I58V, Y87F).
● hBEW-1E3VL.2 is a CDR-grafted, humanized BEW-1E3 VL containing IGKV1-13*01 and IGKJ2*01 framework sequences.
● hBEW-1E3VL.2a is a humanized design based on .2 and contains four proposed
framework back-mutations (I2T, T22S, A43Q, Y87F).
● hBEW-1E3VL.2b is an intermediate design between .2 and 2a. It contains one proposed framework back-mutations Y87F.
Example 6.3: Humanization of VEGFRII Antibodies
Example 6.3.1: Humanization Method
[0359] Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding.
Example 6.3.2: Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized VEGFRII Antibodies
[0360] By applying the aforementioned method, the CDR sequences of VH and VL chains of monoclonal antibody BCU-6B1-G6 were grafted onto different human heavy and light chain acceptor sequences. Example 6.3.2.1: BCU-6B1-G6
[0361] Based on the alignments with the VH and VL sequences of monoclonal antibody BCU-6B1-G6 of the present invention, the following known human sequences are selected:
1. IGHV7-4-1*01 and IGHJ1*01 for constructing heavy chain acceptor sequences
2. IGHV1-18*01 and IGHJ1*01 as alternative acceptor for constructing heavy chain 3. IGKV1-27*01 and IGKJ4*01 for constructing light chain acceptor sequences
[0362] By grafting the corresponding VH and VL CDRs of BCU-6B1-G6 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.3.3: Introducing Potential Framework Back-Mutations In CDR-Grafted Antibodies
[0363] To generate humanized antibody with potential framework back-mutations, the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
Example 6.3.3.1: BCU-6B1-G6
[0364] When IGHV7-4-1*01 and IGHJ1*01 selected as BCU-6B1-G6 heavy chain acceptor sequence, one or more of the following residues could back-mutated as follows:
W47→F. Additional mutations include the following: R38→K, Y91→F.
[0365] When IGHV1-18*01 and IGHJ1*01 selected as BCU-6B1-G6 heavy chain acceptor sequence, one or more of the following residues could back-mutated as follows:
W47→F, V67→F, M69→F, T71→L. Additional mutations include the following: R38→K, Y91→F.
[0366] When IGKV1-27*01 and IGKJ4*01 selected as BCU-6B1-G6 light chain acceptor sequence, one or more of the following residues could back-mutated as follows: V43→S, Y49→F, F71→Y, Y87→F. Additional mutations include the following: T22→E, T72→S.
Example 6.3.4: Generation Of Humanized Antibodies To VEGFRII Containing Framework Back-Mutations In CDR-Grafted Antibodies
[0367] The following humanized variable regions of the murine monoclonal VEGFRII antibodies were cloned into IgG expression vectors for functional characterization. Example 6.3.4.1: BCU-6B1-G6
Table 3.4.1. Sequences of Humanized BCU-6B1-G6 Variable Regions
Figure imgf000173_0001
● hBCU-6B1-G6VH.1z is a CDR-grafted, humanized BCU-6B1-G6 VH containing IGHV7-4-1*01 and IGHJ1*01 framework sequences.
● hBCU-6B1-G6VH.1 is based on .1z with a Q1E change to prevent pyroglutamate
formation.
● hBCU-6B1-G6VH.1a is a humanized design based on .1 and contains 3 proposed
framework back-mutations: (R38K, W47F, Y91F).
● hBCU-6B1-G6VH.1b is an intermediate design between .1 and .1a and contains 1
proposed framework back-mutations: W47F
● hBCU-6B1-G6VH.2z is a CDR-grafted, humanized BCU-6B1-G6 VH containing
IGHV1-18*01 and IGHJ1*01 framework sequences.
● hBCU-6B1-G6VH.2 is based on .2z with a Q1E change to prevent pyroglutamate
formation.
● hBCU-6B1-G6VH.2a is a humanized design based on .2 and contains six proposed framework back-mutations (R38K, W47F, V67F, M69F, T71L, Y91F).
● hBCU-6B1-G6VH.2b is an intermediate design between .2 and .2a and contains four proposed framework back-mutations: W47F, V67F, M69F, T71L.
● hBCU-6B1-G6VL.1 is a CDR-grafted, humanized BCU-6B1-G6 VL containing IGKV1- 27*01 and IGKJ4*01 framework sequences.
● hBCU-6B1-G6VL.1a is a humanized design based on .1 and contains six proposed
framework back-mutations (T22E, V43S, Y49F, F71Y, T72S, Y87F).
● hBCU-6B1-G6VL.1b is an intermediate design between .1 and 1a. It contains four proposed framework back-mutations (V43S, Y49F, F71Y, Y87F).
Example 6.4: Humanization of PDGFRB Antibodies
Example 6.4.1: Humanization Method
[0368] Antibody humanization is achieved by grafting CDRs of the rodent antibody onto a“similar” human framework (acceptor) and incorporating minimal number of key framework residues (back-mutation) from the rodent antibody that are selected to maintain the original CDR conformation in order to minimize the immunogenicity while retaining the optimal antigen binding. Example 6.4.2: Human Germline Sequence Selections For Constructing CDR- Grafted, Humanized PDGFRB Antibodies
[0369] By applying the aforementioned method, the CDR sequences of VH and VL chains of monoclonal antibody BDE-3C9-G4 was grafted onto different human heavy and light chain acceptor sequences.
Example 6.4.2.1: BDE-3C9-G4
[0370] Based on the alignments with the VH and VL sequences of monoclonal antibody BDE-3C9-G4 of the present invention, the following known human sequences are selected:
1. IGHV3-7*01 and IGHJ3*01 for constructing heavy chain acceptor sequences
2. IGKV1-33*01 and IGKJ4*01 for constructing light chain acceptor sequences
[0371] By grafting the corresponding VH and VL CDRs of BDE-3C9-G4 into said acceptor sequences, the CDR-grafted, humanized, and modified VH and VL sequences were prepared.
Example 6.4.3: Introducing Potential Framework Back-Mutations In CDR-Grafted Antibodies
[0372] To generate humanized antibody with potential framework back-mutations, the mutations were identified and introduced into the CDR-grafted antibody sequences by de novo synthesis of the variable domain, or mutagenic oligonucleotide primers and polymerase chain reactions, or by methods well known in the art. Different combinations of back mutations and other mutations are constructed for each of the CDR-grafts as follows. Residue numbers for these mutations are based on the Kabat numbering system.
Example 6.4.3.1: BDE-3C9-G4
[0373] When IGHV3-7*01 and IGHJ3*01 selected as BDE-3C9-G4 heavy chain acceptor sequence, one or more of the following residues could back-mutated as follows: S77→T, L78→Q, Y91→F.
[0374] When IGKV1-33*01 and IGKJ4*01 selected as BDE-3C9-G4 light chain acceptor sequence, one or more of the following residues could back-mutated as follows:
Q38→L, K45→R, I48→M, Y49→R, T69→R, F71→Y. Additional mutations include the following: V58→T. Example 6.4.4: Generation Of Humanized Antibodies To PDGFRB Containing Framework Back-Mutations In CDR-Grafted Antibodies
[0375] The following humanized variable regions of the murine monoclonal PDGFRB antibodies were cloned into IgG expression vectors for functional characterization.
Example 6.4.4.1: BDE-3C9-G4
Table 4.4.1. Sequences of Humanized BDE-3C9-G4 Variable Regions
Figure imgf000176_0001
● hBDE-3C9-G4VH.1 is a CDR-grafted, humanized BDE-3C9-G4 VH containing IGHV3- 7*01 and IGHJ3*01 framework sequences.
● hBDE-3C9-G4VH.1a is a humanized design based on .1 and contains three proposed framework back-mutations (S77T, L78Q, Y91F).
● hBDE-3C9-G4VL.1 is a CDR-grafted, humanized BDE-3C9-G4 VL containing IGKV1- 33*01 and IGKJ4*01 framework sequences.
● hBDE-3C9-G4VL.1a is a humanized design based on .1 and contains seven proposed framework back-mutations (Q38L, K45R, I48M, Y49R, V58T, T69R, F71Y). ● hBDE-3C9-G4VL.1b is an intermediate design between .1 and 1a. It contains four proposed framework back-mutations (K45R, Y49R, T69R, F71Y).
Summary of VH and VL Amino Acid Sequences of Humanized Rat Anti-human VEGF-A and Humanized Rat Anti-human PDGF-BB Monoclonal Antibodies
Table 27. VH and VL Amino Acid Sequences of Humanized Rat Anti-Human VEGF-A Monoclonal Antibodies CDRs in bold
Figure imgf000177_0001
Figure imgf000178_0001
Figure imgf000179_0001
Figure imgf000180_0001
Figure imgf000181_0001
Figure imgf000182_0001
Figure imgf000183_0001
Figure imgf000184_0001
Figure imgf000185_0001
Figure imgf000186_0001
Figure imgf000187_0001
Figure imgf000188_0001
Figure imgf000189_0001
Figure imgf000190_0001
Figure imgf000191_0001
Figure imgf000192_0001
Figure imgf000193_0001
Figure imgf000194_0001
Figure imgf000195_0001
Figure imgf000196_0001
Figure imgf000197_0001
Figure imgf000198_0001
Figure imgf000199_0001
Figure imgf000200_0001
Figure imgf000201_0001
Figure imgf000202_0001
Figure imgf000203_0001
Figure imgf000204_0001
Figure imgf000205_0001
Figure imgf000206_0001
Figure imgf000207_0001
Figure imgf000208_0001
Figure imgf000209_0001
Figure imgf000210_0001
Figure imgf000211_0001
Figure imgf000212_0001
Figure imgf000213_0001
Figure imgf000214_0001
Figure imgf000215_0001
Figure imgf000216_0001
Figure imgf000217_0001
Figure imgf000218_0001
Figure imgf000219_0001
Figure imgf000220_0001
Figure imgf000221_0001
Figure imgf000222_0001
Figure imgf000223_0001
Figure imgf000224_0001
Figure imgf000225_0001
Figure imgf000226_0001
Figure imgf000227_0001
Figure imgf000228_0001
Figure imgf000229_0001
¹Octet titer is the amout of IgG in the unpurified supernatant as determined by protein A binding compared to a standard curve using an Octet instrument.
²Yield is determined by the total amount of purified protein in mg divided by the total cell culture volume in liters.
³SEC % monomer is determined using HPLC size exclusion chromatography.
[0378] Humanized anti-VEGF antibodies were tested for their binding to human VEGF-A according to the method described in Example 1.1. The on-rate, off-rate and binding kinetics are summarized in Table 32 below.
Table 32. Biacore Binding of Humanized Anti-VEGF Antibodies
Figure imgf000230_0001
Figure imgf000231_0002
[0379] Humanized anti-VEGF-A antibodies were tested for potency against hVEGF165- induced cell proliferation in one of two cellular assay formats. The HMVEC-d bioassay utilizes cells which natively express VEGFR2 (Example 1.10). The VEGFR2-3T3 cells are stably transfected with VEGFR2 (Example 1.7). The data is summarized in Table 33 below.
Table 33. Summary of Characterization of Humanized Anti-Human VEGF-A Monoclonal Antibodies.
Figure imgf000231_0001
Figure imgf000232_0002
[0380] Humanized anti-PDGF-BB antibodies were tested for their binding to human PDGF-BB according to the method described in Example 1.1. The on-rate, off-rate and binding kinetics are summarized in Table 34 below.
Table 34. Biacore Binding of Humanized Anti-PDGF Antibodies
Figure imgf000232_0001
*Heterogeneous off-rate
[0381] Humanized anti-PDGF-BB antibodies were tested for potency against hPDGF- BB in functional assays. The ability to neutralize hPDGF-BB -induced cell proliferation was assessed (Example 1.15) as well as the ability to block binding of hPDGF-BB to hPDGF-Rβ in a competition ELISA format (Example 1.13). The data is summarized in Table 35 below.
Table 35. Summary of Characterization of Humanized Anti-Human PDGF-BB Monoclonal Antibodies
Figure imgf000233_0001
NT– Not tested
[0382] Humanized anti-VEGFR2 antibodies were tested for potency against hVEGFR2 in functional assay formats. The antibodies were characterized for the ability to block VEGFR2 binding to hVEGF165 in a competition ELISA format (Example 1.22). The antibodies were also tested for the ability to bind exogeneous hVEGFR2 and allow signaling in response to hVEGF165 (Example 1.23). The data is summarized in Table 36 below.
Table 36. Summary of Characterization of Humanized Anti-Human VEGFR II Monoclonal Antibodies.
Figure imgf000234_0001
NT– Not tested
[0383] Humanized anti-PDGF-Rβ antibodies were characterized for activity in functional assays. Antibodies were assessed for the ability to bind hPDGF-Rβ (Example 1.26) and block binding of hPDGF-Rβ to hPDGF-BB in a competition ELISA format (Example 1.27). They were also tested for the ability to bind exogenoeous hPDGF-Rβ and allow signaling in response to hPDGF-BB (Example 1.28). The data is summarized in Table 37 below.
Table 37. Summary of Characterization of Humanized Anti-Human PDGFR-B Monoclonal Antibodies
Figure imgf000234_0002
NT– Not tested Example 7: Affinity Maturation of Anti-Human VEGF-A Antibody 4G8
Library Designs And Strategy
[0384] Two different hBDB-4G8.3 parental sequences were made: One with“DT” and another with“EI” at the beginning of VL. Both parentals were tested as scFv, and the“EI” was chosen as the template for the libraries. Two libraries were made by dope primers: HC and LC. After library selection and diversity reduction, libraries were combined into one recombined library (rHC+LC). Final selected clones from each of 3 libraries were converted to IgG.
HC Library
- Doping (X) 11 residues at 76080808: 30, 31, 33, 53, 56, 58, 95, 96, 100, 100a and 100c - Co-evolve (1): D61Q/D62G/K64T. Library will contain DDFKG or QGFTG [0385] A 109 library will be able to sample mutants carrying up to 4 doped residues at least 4 times. On average, library members will have 5 doped residues.
LC Library
- Doping (X) 10 residues at 76080808: 30, 31, 32, 50, 53, 91-94 and 96
- Germline toggle (Z): E27Q, V58I and F87Y
- Co-evolve (1): M33L/H34A. Library will contain HMHW or YLAW
[0386] A 109 library will be able to sample mutants carrying up to 4 doped residues at least 4 times. On average, library members will have 5 doped residues.
Recombined Library
H1+H2 library is recombined with H3 library into a HC library. HC library is combined with LC library for a total recombined library rHC+LC.
Codons Specified For Residues To Be Doped
For instance, if a proline is to be doped, the doping oligo will have C(5-85-5-5)C(5-85-5-5)S codon regardless of the original codon in the antibody sequence. These codons are selected based on the following criteria: Increase non-synonymous mutation; increase coverage of more amino acids when mutated; and uses high frequency codons and avoid SSS and WWW codons
[0387] Doping order is A-C-G-T
Figure imgf000235_0001
Figure imgf000236_0001
List of Amino Acid Sequences of Affinity Matured H4g8.3 VH Variants.
Table 38 provides a list of amino acid sequences of unique, functional VH regions of affinity matured humanized anti-VEGF antibodies derived from hBDB-4G8.3. Amino acid residues of individual CDRs of each VH sequence are indicated in bold.
Table 38. List of Amino Acid Sequences of Affinity Matured H4g8.3 VH Variants
Figure imgf000236_0002
Figure imgf000237_0001
Figure imgf000238_0001
Figure imgf000239_0001
Figure imgf000240_0001
Figure imgf000241_0001
Figure imgf000242_0001
Figure imgf000243_0001
Figure imgf000244_0001
Figure imgf000245_0001
Figure imgf000246_0001
Figure imgf000247_0001
Figure imgf000248_0001
Figure imgf000249_0001
Figure imgf000250_0001
Figure imgf000251_0001
Figure imgf000252_0001
Figure imgf000253_0001
Figure imgf000254_0001
Figure imgf000255_0001
Figure imgf000256_0001
Figure imgf000257_0001
Figure imgf000258_0001
Figure imgf000259_0001
Figure imgf000260_0001
Figure imgf000261_0001
Figure imgf000262_0001
Figure imgf000263_0001
Figure imgf000264_0001
Figure imgf000265_0001
Figure imgf000266_0001
Figure imgf000267_0001
Figure imgf000268_0001
Figure imgf000269_0001
Figure imgf000270_0001
Figure imgf000271_0001
Figure imgf000272_0001
Figure imgf000273_0001
Figure imgf000274_0001
Figure imgf000275_0001
Figure imgf000276_0001
Figure imgf000277_0001
Figure imgf000278_0001
Figure imgf000279_0001
Figure imgf000280_0001
Figure imgf000281_0001
Figure imgf000282_0001
Figure imgf000283_0001
Figure imgf000284_0001
Figure imgf000285_0001
Figure imgf000286_0001
Figure imgf000287_0001
Figure imgf000288_0001
Figure imgf000289_0001
Figure imgf000290_0001
T H
Figure imgf000291_0001
Figure imgf000292_0001
Figure imgf000293_0001
Figure imgf000294_0001
Figure imgf000295_0001
Figure imgf000296_0001
Figure imgf000297_0001
Figure imgf000298_0001
Figure imgf000299_0001
Figure imgf000300_0001
Figure imgf000301_0001
Figure imgf000302_0001
Table 43. Summary of Protein Expression and Purification Affinity Matured Humanized Anti-Human VEGF-A Antibodies
Figure imgf000303_0001
¹Yield is determined by the total amount of purified protein in mg divided by the total cell culture volume in liters.
²SEC % monomer is determined using HPLC size exclusion chromatography.
Table 44. Biacore Binding of Affinity Matured Humanized Anti-VEGF Antibodies
Figure imgf000303_0002
[0388] Affinity matured humanized anti-VEGF antibodies were characterized for hVEGF165 binding and potency. Binding affinity of these molecules to hVEGF165 was determined by Biacore analysis (Example 1.1). Potency was evaluated in both cell-based and ELISA formats. The ability to block binding of hVEGF165 to hVEGFR2 was evaluated in a competition ELISA (Example 1.4). Inhibition of hVEGF165-induced cell proliferation was assessed using HMVEC-d cells (Example 1.10). The data is summarized in Table 45 below.
Table 45. Summary of Characterization of Affinity Matured Humanized Anti-Human VEGF-A Antibodies
Figure imgf000304_0001
Example 8: Affinity Maturation of Anti-Human PDGF-BB Antibody hBDI-9E8
[0389] The PDGF-β antibody hBDI-9E8.4 was obtained from rat hybridomas generated at Aldevron and was humanized at AbbVie Bioresearch Center (100 Research Drive, Worcester, MA 01605). The human germlines for this clone are VH2-70 and IGKV3-20. To improve the affinity of hBDI-9E8.4, hypermutated CDR residues were identified from other human antibody sequences in the IgBLAST database that also shared high identity to germlines VHVH2-70 and IGKV3-20. The corresponding h9E8.4 CDR residues were then subjected to limited mutagenesis by PCR with primers having low degeneracy at these positions to create three antibody libraries in the scFv format suitable for surface display. To improve the affinity of hBDI-9E8.4 to PDGFβ we generated three antibody libraries in scFv format suitable for surface display. In the first library, residues 30, 32, 34, 35, and 35b in the VH CDR1 and residues 50, 52, 54, 56, 57, 58, 60, 61 and 65 (Kabat numbering) in the VH CDR2 were subjected to limited mutagenesis by primers. In the second library residues 95-100a, 100c and 102 (Kabat numbering) in the VH CDR3 were subjected to limited mutagenesis by primers. In the third library residues 24, 25, 27b, and 29-32 in the VL CDR1, residues 47, 50, 51, 53, 55, and 56 in the VL CDR2 and residues 90, 93-95a, 96 and 97 (Kabat numbering) in the VL CDR3 were subjected to limited mutagenesis by primers.
[0390] These hBDI-9E8.4 libraries were displayed to be selected against a low concentration of biotinylated PDGFβ by magnetic then fluorescence activated cell sorting.
Selections for improved on-rate, off-rate, or both were carried out and antibody protein sequences of affinity-modulated hBDI-9E8.4 clones. [0391] Table 46 provides a list of amino acid sequences of VH regions of affinity matured humanized PDGF antibodies derived from hBDI-9E8.4. Amino acid residues of individual CDRs of each VH sequence are indicated in bold.
Table 46. List of amino Acid Sequences Of Affinity Matured hBDI-9E8.4 VH Variants
Figure imgf000305_0001
Figure imgf000306_0001
Figure imgf000307_0001
Figure imgf000308_0001
Figure imgf000309_0001
Figure imgf000310_0001
Figure imgf000311_0001
Figure imgf000312_0001
Figure imgf000313_0001
Figure imgf000314_0001
Figure imgf000315_0001
Figure imgf000316_0001
Figure imgf000317_0001
Figure imgf000318_0001
Figure imgf000319_0001
Figure imgf000320_0001
Figure imgf000321_0001
Figure imgf000322_0001
Figure imgf000323_0001
Figure imgf000324_0001
Figure imgf000325_0001
Figure imgf000326_0001
Figure imgf000327_0001
Figure imgf000328_0001
Figure imgf000329_0001
Figure imgf000330_0001
Figure imgf000331_0001
Figure imgf000332_0001
Figure imgf000333_0001
Figure imgf000334_0001
Figure imgf000335_0001
Figure imgf000336_0001
Figure imgf000337_0001
Figure imgf000338_0001
Figure imgf000339_0001
Figure imgf000340_0001
Figure imgf000341_0001
Figure imgf000342_0001
Figure imgf000343_0001
Figure imgf000344_0001
Figure imgf000345_0001
Figure imgf000346_0001
Figure imgf000347_0001
Figure imgf000348_0001
Figure imgf000349_0001
Figure imgf000350_0001
Figure imgf000351_0001
Figure imgf000352_0001
Figure imgf000353_0001
Figure imgf000354_0001
Figure imgf000355_0001
Figure imgf000356_0001
Figure imgf000357_0001
Figure imgf000358_0001
Figure imgf000359_0001
Figure imgf000360_0001
Figure imgf000361_0001
Figure imgf000362_0001
Figure imgf000363_0001
Figure imgf000364_0001
Figure imgf000365_0001
Figure imgf000366_0001
Figure imgf000367_0001
Figure imgf000368_0001
Figure imgf000369_0001
Figure imgf000370_0001
Figure imgf000371_0001
Figure imgf000372_0001
Figure imgf000373_0001
Figure imgf000374_0001
Figure imgf000375_0001
Figure imgf000376_0001
Figure imgf000377_0002
Table 51. Summary of Protein Expression And Purification Of Affinity Matured Humanized Anti-Human PDGF-BB Antibodies
Figure imgf000377_0001
Figure imgf000378_0002
¹Octet titer is the amount of IgG in the unpurified supernatant as determined by protein A binding compared to a standard curve using an Octet instrument.
²Yield is determined by the total amount of purified protein in mg divided by the total cell culture volume in liters.
³SEC % monomer is determined using HPLC size exclusion chromatography. Table 52. Biacore Binding of Affinity-Matured Humanized Anti-PDGF Antibodies
Figure imgf000378_0001
Heterogeneous o -rate
[0392] Affinity matured humanized anti-PDGF-BB antibodies were characterized for PDGF-BB binding and potency. Human PDGF-BB binding affinity was determined by Biacore analysis (Example 1.1). Potency was evaluated in both cell-based and ELISA formats. The ability to block binding of hPDGF-BB to hPDGF-Rβ was tested in a competition ELISA format (Example 1.13). Inhibition of human and cynomolgus PDGF-BB-induced cell proliferation was assessed using NIH-3T3 cells (Examples 1.15 and 1.16). The data is summarized in Table 53 below.
Table 53. Summary of Characterization of Affinity Matured Humanized Anti-Human PDGF-BB Antibodies
Figure imgf000378_0003
Figure imgf000379_0001
Example 9: Methods of Selecting Preferred Humanized Antibodies as DVD-Ig Building Blocks
Example 9.1. A Technique For Assessing The Stability Of Regions Of The Parental Antibodies Intended For DVD-Ig Protein Incorporation
[0393] The technique of differential scanning calorimetry (DSC) can be used to determine the thermal stabilities of the different domains of an antibody (e.g. CH2, CH3, CH1- CL, and VH-VL). The temperature of the highest peak in a DSC thermogram (plotted as heat capacity versus temperature) of an antibody has been shown to correspond to the midpoint of the unfolding transition or process of that antibody’s VH-VL region due to increasing temperature. This may be interpreted as a measure of VH-VL thermal stability. VH-VL regions with high thermal stability in the antibody format will also likely have high thermal stability when incorporated into the DVD-Ig format as one of the binding domains. Therefore, antibodies can be screened to determine those with VH-VL regions of high thermal stability. Those regions can then be incorporated into the DVD-Ig format to increase the probability of generating a more stable DVD-Ig molecule.
Example 9.2. Determination of the Thermal Stability Of The VH-VL Regions Of Anti-VEGF mAbs and Anti-PDGF mAbs By Differential Scanning Calorimetry
[0394] A total of 73 mAbs (45 anti-VEGF and 28 anti-PDGF) were selected and analyzed by DSC (Example 2.2) and the thermal stabilities of their VH-VL regions were quantitated by determining the temperature of the highest peak in the DSC thermograms as detailed in Example 9.1 (Table 54).
Table 54. Thermal Stability of Anti-VEGF and Anti-PDGF Antibodies
Figure imgf000380_0001
Figure imgf000381_0001
Example 10: Generation of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules [0395] The variable domain sequences from humanized anti-human VEGF-A and anti- human PDGF-BB mAbs were used to design the VH and VL domains of anti-human VEGF- A/anti-human PDGF-BB DVD-Ig molecules. In some cases, variable regions were synthesized using two-step PCR. Primers were designed with homologous flanking regions to the cloning vector and the linker region between each DVD variable pair. In some cases, variable regions were generated using gene synthesis. Bacterial transformations were performed to identify positive clones and constructs were harvested and purified for use in mammalian transfection using standard protocols known in the art.
[0396] The variable domains of the heavy and light chain were cloned in-frame into mutant human IgG1 (L234, 235A) heavy-chain or mutant human IgG1 (L234, 235A, H435A) heavy-chain, and kappa light-chain constant regions, respectively, into pHybE vectors to generate anti-human VEGF-A/anti-human PDGF-BB DVD-Ig molecules.
Table 55. Amino Acid Sequences of DVD-Ig Linkers
Figure imgf000382_0001
Figure imgf000383_0002
Table 56. Heavy (H) and Light Chain (L) Composition of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules (first and second polypeptide chains are listed in alternating rows of the table)
Figure imgf000383_0001
Figure imgf000384_0001
Figure imgf000385_0001
Figure imgf000386_0001
Figure imgf000387_0001
Figure imgf000388_0001
Figure imgf000389_0001
Figure imgf000390_0001
Figure imgf000391_0001
Figure imgf000392_0001
Figure imgf000393_0001
Figure imgf000394_0001
Figure imgf000395_0001
Figure imgf000396_0001
Figure imgf000397_0001
Figure imgf000398_0001
Figure imgf000399_0001
Figure imgf000400_0001
Figure imgf000401_0001
Figure imgf000402_0001
Figure imgf000403_0001
Figure imgf000404_0001
All HC use the exact same LC (last sequence in Table 59). The naming of the HC follows the following convention: VH name - Linker length (between Fc and scFv) - scFv name with orientation of scFv.
Example 13: In vitro Characterization of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules and Other Bispecific Molecules
Example 13.1: Expression and Purification of Anti-VEGF-A/Anti-PDGF-BB DVD- Ig Molecules and CO-DVD-Ig Molecules
[0399] All variants were transiently transfected into 200 - 500 mls of HEK 2936e suspension cell cultures in a ratio of 60% to 40% light to heavy chain construct. 1 mg/ml PEI was used to transfect the cells. Alternatively variants were transiently transfected into 500 mls of Expi293 suspension cell cultures using the ExpiFectamine kit (LifeTechnologies A14524).
Supernatants were harvested after six days in shaking flasks, spun down to pellet cells, and filtered through 0.22 ^m filters to separate IgG from culture contaminates. All was purified via gravity flow using 1-2 ml of rProteinA sepharose fast flow beads (GE Healthcare, 17-1279-04) over poly prep chromatography columns (Bio Rad, 731-1550). Once supernatants had passed through the columns the beads were washed with 10 column volumes of binding buffer, and IgG was eluted with Immunopure IgG elution buffer (Pierce, 1851520) and collected in 1 ml aliquots. Fractions containing DVD-Ig were pooled and dialyzed in PBS or 15mM Histidine pH 6 overnight at 4 °C. Table 60. Expression Level and SEC Profile of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig, CO- DVD-Ig and IgG-scFv Fusion Proteins
Figure imgf000405_0001
Figure imgf000406_0001
Figure imgf000407_0001
Example 13.2: Binding Affinity of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules and CO-DVD-Ig Molecules
[0400] The binding affinity of anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules and CO-DVD-Ig molecules to VEGF-A and PDGF-BB were measured by Biacore using the method described in Example 1.1 and the data is summarized in Tables 61 and 62 below. Table 61. Biacore Binding of Anti-VEGF/anti-PDGF DVD-Ig Molecules
Figure imgf000408_0001
Figure imgf000409_0002
Table 62. Biacore Binding of Anti-VEGF/anti-PDGF CO-DVD-Ig Molecules
Figure imgf000409_0001
Example 13.2.1: Binding of Anti-VEGF/anti-PDGF DVD-Ig Molecule (PR-1610561) to Various VEGF-A Isoforms and VEGF-A and PDGF-BB of Different Species
[0401] Binding of anti-VEGF/anti-PDGF DVD-Ig molecule (PR-1610561) and their parental monoclonal antibodies to various VEGF-A isoforms and VEGF-A and PDGF-BB of different species were measured by Biacore using the method described in Example 1.1 and the data is summarized in Table 63 below. Tables 63A-B summarize the high affinity for VEGF-A165 (65 pM), VEGF-A121 (230 pM), VEGF-A111 (290 pM), isoforms and the high affinity for soluble PDGF-BB (5 pM), observed for PR-1610561. The data shows that PR-1610561binds to both soluble and extracellular-matrix (ECM) bound forms of PDGF-BB.
Figure imgf000410_0001
0 4
-3
02
.2
52
2
12
o.
t N
e
ck
o
D
y
ne
or
tt
A
9 4 0
Figure imgf000411_0001
Table 63A. Affinity of PR-1610561 to Various Isoforms of Human VEGF-A
Figure imgf000412_0001
Example 13.3: Neutralization Potencies of Anti-VEGF-A/anti-PDGF-BB DVD-Ig Molecules and CO-DVD-Ig Molecules
[0402] The DVD-Ig molecules and CO-DVD-Ig molecules were evaluated for their potencies to block VEGF165/VEGFR2 interaction (Example 1.4) and neutralize VEGF165 activity in HMVEC-d or VEGFR2-3T3 proliferation assays (Examples 1.10 and 1.7). The molecules were also characterized for the ability to block PDGF-BB/PDGF-Rβ interaction (Example 1.13) and inhibition of PDGF-BB induced proliferation of NIH-3T3 cells (Example 1.15). The data is summarized in Table 64 below. PR-1610561 exhibited neutralization activity against human VEGF-A (IC50 of 145 pM) and human PDGF-BB (IC50 of 34 pM), as summarized in Table 64A. Table 64. Human VEGF-A and Human PDGF-BB Neutralization Potency of Anti-VEGF- A/anti-PDGF-BB DVD-Ig and CO-DVD-Ig Proteins
Figure imgf000412_0002
Figure imgf000413_0001
Figure imgf000414_0001
Figure imgf000415_0001
Figure imgf000416_0003
Table 64A. Neutralization Activities in Cellular Assays
Figure imgf000416_0001
[0403] Selected DVD-Ig molecules were further characterized for the ability to neutralize human VEGF111 and human VEGF121, isoforms of human VEGF-A. The molecules were tested for inhibition of VEGF111 and human VEGF121 induced proliferation of VEGFR2-3T3 cells (Example 1.8). Neutralization of non-human VEGF-A species was also evaluated.
Molecules were tested for inhibition of rabbit VEGF165 induced proliferation of VEGFR2-3T3 cells (Example 1.9). The data is summarized in Table 65 below. As noted, the amino acid sequence of cynomolgus monkey VEGF-A is identical to human VEGF-A. Parental antibodies had previously been examined for mouse VEGF164 cross-reactivity in a competition ELISA and no blocking was observed (Example 1.5).
Table 65. Neutralization of Different VEGF-A Isoforms by Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules
Figure imgf000416_0002
Figure imgf000417_0002
NT– Not tested
[0404] Selected DVD-Ig molecules were further evaluated for their potencies to neutralize PDGF-BB of different species using the assay described in Examples 1.15-1.18. The data is summarized in Table 66 below. As noted, the amino acid sequence of rabbit PDGF-BB is identical to rat PDGF-BB.
Table 66. Neutralization of Different PDGF-BB Species by Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules
Figure imgf000417_0001
NT– Not tested
[0405] Selected DVD-Ig molecules were evaluated for their ability to neutralize in the presence of a second ligand. To evaluate hPDGF-BB potency, the DVD-Ig molecules were pre- incubated with an excess of human VEGF165 prior to testing in the NIH-3T3 proliferation assay (Example 1.21). To evaluate hVEGF165 potency, the DVD-Ig molecules were pre-incubated with an excess of human hPDGF-BB prior to testing in the VEGFR2-3T3 (KDR/Flk-1) phosphorylation assay (Example 1.20). The data is summarized in Table 67 below.
Table 67. Simultaneous binding to VEGF and PDGF
Figure imgf000418_0001
NT– Not tested
[0406] Selected DVD-Ig molecules were further evaluated for their ability to bind naturally derived human VEGF165 (Example 1.11) and naturally derived human PDGF-BB (Example 1.19). The data is summarized in Table 68 below. Table 68. Binding of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules to hVEGF165 and hPDGF-BB by ELISA
Figure imgf000419_0001
NT– Not tested
Example 13.4: Species cross-reactivity of an Anti-VEGF/anti-PDGF DVD-Ig Molecule (PR-1610561)
[0407] PR-1610561 was further evaluated for its ability to cross-react with cynomolgus monkey, mouse, rat, and rabbit using cell-based proliferation assays (Examples 1.6, 1.17, 1.18, and 1.25). The data is summarized in Table 69 below.
Table 69. Species Cross-Reactivity of Anti-VEGF/anti-PDGF DVD-Ig Molecule (PR- 1610561)
Figure imgf000419_0002
Example 13.5: Reactivity of Anti-PDGF-BB Antibodies and Anti-VEGF-A/Anti- PDGF-BB DVD-Ig Molecules to ECM-Associated PDGF-BB
[0408] As described in Example 1.27, first recombinant cell line HEK293 cells over- expressing PDGFBB-RM and then HUVEC naturally expressing ECM-associated PDGF-BB cells were used for staining:
[0409] HEK293 Cell Staining: PDGFB-RM transient transfected HEK 293 cells and parental HEK293 cells were re-suspended at 1E6 cells/mL in PBS and fixed in 4%
paraformaldehyde at RT for 10 minutes, washed with PBS and 2E5 cells/tube were incubated in blocking buffer (10% goat serum in PBS) for one hour on ice. Cells were washed with PBS and incubated with primary antibody or DVD at 33nM in antibody dilution buffer (5% goat serum in PBS) for one hour on ice. Cells were washed three times with PBS and incubated with Alexa Fluo 488 conjugated Goat anti-Human IgG (Jackson Immune, code: 109-546-098; lot: 108427) 1 : 400 dilution in antibody dilution buffer, incubate on ice for 45 minutes. Cells were washed three times with PBS and cytospin onto glass slides and mounted with mounting media with DAPI. Pictures were taken by fluorescent microscopy. Anti-PDGF-BB parental and affinity matured mAbs and three DVD-Ig molecules all showed positive staining on PDGFB-RM transient transfected 293 cells (Figure 2A) and no staining on parental HEK 293 cells except for the slightly positive staining of affinity matured anti-PDGF-BB mAb. It is unclear if parental HEK 293 cells express low level of PDGF-BB endogenously
[0410] HUVEC Staining: HUVEC cells secrete PDGF-BB, and low level of PDGF- BB may be captured on the cell surface as ECM-associated PDGF-BB. Affinity matured anti- PDGF-BB mAb and anti-VEGF/anti-PDGF DVD-Ig built with affinity-matured anti-PDGF-BB mAb was further assessed for its staining on naturally derived ECM-associated PDGF-BB on HUVEC cells. HUVECs (Lonza, cat#: C2519A lot: 181607) were trypsinized, resuspended at 2E4 cells/mL in culture media (Lonza, EGM2 MV Bulletkit: CC-3202). Cells were plated at 10,000 cells / 500 μl / well in 8-chamber glass slide and incubated for 16 hours at 37oC, 5% CO2. After incubation, cells were fixed with 200 μl 4% paraformaldehyde at RT for 10 minutes, washed with PBS and incubated in blocking buffer (10% goat serum in PBS) for one hour on ice. Cells were washed with PBS 3X and incubated with primary antibodies or DVD-Ig molecules at 33 nM in antibody dilution buffer (5% goat serum in PBS) for one hour on ice. Cells were washed three times with PBS and incubated with Alexa Fluo 488 conjugated Goat anti-Human IgG (JacksonImmune, code: 109-546-098; lot: 108427) 1 : 400 dilution in antibody dilution buffer, incubate on ice for 45 minutes . Cells were washed three times with PBS and mounted with mounting media with DAPI. Pictures were taken by fluorescent microscopy. As shown in Figure 2B, affinity matured anti-PDGF-BB mAb showed positive staining on HUVEC cells while the staining of parental anti-PDGF-BB mAb on HUVEC cells is not evident (Figure 2B). Anti- VEGF/anti-PDGF DVD-Ig (PR-1610561) built with affinity-matured anti-PDGF-BB mAb showed positive staining on HUVEC cells but control anti-tetanus toxoid DVD-Ig molecule also showed some weak staining which may be due to the background issue.
Example 13.6: Inhibition of Sprouting in HUVEC/MSC Co-culture Sprouting Assay by Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules
[0411] As described in Example 1.28, in early therapeutic treatment mode, Cytodex-3 beads (Sigma-Aldrich, cat# C3275) were coated with HUVEC cells (Lonza) overnight, and then embedded (100 beads/well) with human mesenchymal stem cells (Lonza, 20,000 cells/well) in fibrin gel in 24-well tissue culture plates. A 1:1 mixture of fresh EGM-2 complete media (Lonza) and fibroblast (Lonza) conditioned EGM-2 media were added on top of the fibrin gel along with 2 ng/mL of recombinant human HGF. Medium was replaced every 2-3 days till the end of the experiment. After EC sprouts and pericyte coverings were formed, usually on day 4, anti-VEGF- A (4G8.4), anti-PDGFBB (9E8.) or anti-PDGFBB/VEGF-A DVD-Ig were added to the culture medium at 10 nM.10 days later cells were fixed in 4% PFA overnight at 4°C. Endothelial cells were stained with anti-PECAM (Abcam, ab32457), followed by fluorescence-conjugated secondary antibody, and pericytes were labeled with anti-αSMA-Cy3 (Sigma, C6198). Cells were then viewed by an inverted fluorescence microscope and 5 × images were captured (Figure 3). As seen in the pictures, DVD-Ig molecules as well as the combination of anti-VEGF and anti-PDGF mAbs are able to prevent sprouting formation greater than that of anti-VEGF mAb alone. Neither anti-PDGF mAb or anti-PDGF aptamer alone appear to have any significant inhibition of sprouting formation (Figure 3). Similar experiments were also conducted in prophylactic and later therapeutic treatment modes and the results clearly demonstrated that anti-VEGF/anti-PDGF DVD-Ig (PR-1610561) strongly inhibited sprouting formation in this 3D co-culture assay.
Example 13.7: Characterization of FcRn and Fc ^Rs Binding
[0412] Anti-VEGF/anti-PDGF DVD-Ig molecules, including 4G8.3-GS-9E8.4, 4G8.3- SL-9E8.4, 4G8.3-GS-9E8.4(g), 4G8.3-SL-9E8.4(g), 9E10.1GS_CL-33675, are human IgG1/ ^ isotype with L234A, L235A mutations to attenuate Fc γRs binding and H435A mutation to eliminate FcRn binding. The binding of DVD-Ig molecules to FcRn from various species and the binding of DVD-Ig molecules to various Fc γRs were characterized by Biacore using the method described in Example 1.2. The data is summarized in Tables 70 and 71 below.
Table 70. Binding of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules to FcRn from Different Species, Measured by Biacore
Figure imgf000421_0001
N B = No s gn cant n ng at t e concentrat on teste ; n a = not ava a e Table 71. Binding of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules to Various Human Fc γRs, Measured by Biacore
Figure imgf000422_0001
= o s gn can n ng a e concen ra on es e ; n a = no ava a e Example 14: Physicochemical Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules
Example 14.1: Assessment of Physicochemical Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules.
[0413] Twenty one DVD-Ig molecules were selected for a screen of their solubility and stability profiles. Samples were prepped and evaluated according to Example 2.4. The DVD-Ig proteins were prepared in a formulation buffer and stored at 40°C and 5°C for up to 21 days. Samples were pulled and analyzed by SEC to determine changes in aggregation (Table 72). The molecules were evaluated at the listed concentrations. SEC was used to quantitate the aggregation percentage.
Table 72. Aggregation and Solubility Screening Of Selected DVD-Ig Molecules Stored At 40°C and 5°C for 21 Days in a Formulation Buffer
Figure imgf000422_0002
Figure imgf000423_0001
Example 14.2: Further Assessment of Physicochemical Properties of Anti-VEGF- A/Anti-PDGF-BB DVD-Ig Molecules (Stability During Storage at 40°C, 25°C, and 5°C)
[0414] Based on the physicochemical screen discussed above (Example 14.1), three anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules (4G8.3-GS-9E8.4, 4G8.3-SL-9E8.4, and 9E10.1-GS-33675) were selected for further characterization. Sample prep and analysis was performed according to Example 2.4.
[0415] Briefly, the molecules were prepared in a formulation buffer at 100 ± 10 mg/ml and stored at 40°C, 25°C, and 5°C for 84 days. Samples were periodically pulled for characterization (Tables 73-75 below).
[0416] As mentioned in Example 2.4, both 25°C (room temperature) and 5°C (storage temperature) are typical temperatures at which the samples would be subjected either during preparation and storage for manufacture or as part of the final drug product presentation. Also, storage at 40°C is considered an accelerated stability condition which provides an indication of long-term stability prospects. Table 73. Stability of 4G8.3-GS-9E8.4 During Storage. Aggregate, Monomer, And Fragment Percentages Were Quantitated By SEC
Figure imgf000424_0001
* Samples were too degraded or compromised to evaluate with SEC (e.g. gelled, precipitated). Table 74. Stability of 4G8.3-SL-9E8.4 During Storage. Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC
Figure imgf000425_0002
Table 75. Stability of 9E10.1-GS-33675 During Storage. Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000425_0001
[0417] Both 4G8.3-GS-9E8.4 and 4G8.3-SL-9E8.4 formed a white precipitate when stored at 40°C after 7 days and thus could not be analyzed by SEC. The samples are assumed to be completely aggregated. At 25°C, there was an observable increase in aggregation for both molecules. The aggregation was less rapid for 4G8.3-GS-9E8.4 than for 4G8.3-SL-9E8.4.
Aggregation of the former increased from 1.8% to 5.0% after 84 days while that of the latter started at 4.2% and reached as high as 13.2% over the course of 84 days. At 5°C, there is no noticeable aggregate increase for the two molecules.
[0418] For 9E10.1-GS-33675, aggregation at 5°C increased from 0.8% to 6.7% by 21 days and levelled off at ~ 8% from 42 to 84 days. At 25°C, aggregation increased from 0.8% to 4.7% by 7 days and levelled off at that value up to 84 days. Finally, aggregation at 40°C increased from 0.8% to 22.8% in an apparently linear fashion over the course of 84 days. The aggregation at 40°C for 9E10.1-GS-33675 is much less that that observed for the other two DVD- Ig molecules. This may be the result of the universal formulation buffer used.
[0419] There was no apparent change in fragmentation for all three DVD-Ig molecules at 25°C or 5°C. At 40°C, an apparent and expected increase in fragmentation was observed for 9E10.1-GS-33675 after 21 days.
Example 14.3: Further Assessment of Physicochemical Properties of Anti-VEGF-A/Anti- PDGF-BB DVD-Ig Molecules (Stability to Freeze-Thaw Stress)
[0420] Based on the earlier physicochemical screen (Example 14.1), three anti-VEGF- A/anti-PDGF-BB DVD-Ig molecules (4G8.3-GS-9E8.4, 4G8.3-SL-9E8.4, and 9E10.1-GS-33675) were selected for further characterization. Sample prep, stress, and analysis were performed according to Example 2.5. Briefly, the molecules were prepared in a formulation buffer at concentrations of 100 ± 10 mg/ml or 1 mg/ml and subjected to four cycles of freezing (-80°C) and thawing (30°C). Samples were characterized after the second and fourth thaw (Tables 76-81 below).
[0421] As mentioned in Example 2.5, protein samples are typically frozen at -80°C for long term storage as well as shipping to remote manufacturing sites. The samples are then thawed in order to complete the drug product manufacturing process. Table 76. Stability of 4G8.3-GS-9E8.4 at 100 ± 10 mg/ml When Subjected To Freeze-Thaw Stress (-80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000426_0001
Table 77. Stability of 4G8.3-SL-9E8.4 at 100 ± 10 mg/ml When Subjected To Freeze-Thaw stress (-80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC
Figure imgf000427_0001
Table 78. Stability of 9E10.1-GS-33675 at 100 ± 10 mg/ml when Subjected To Freeze-Thaw Stress (-80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000427_0002
Table 79. Stability of 4G8.3-GS-9E8.4 at 1 mg/ml When Subjected To Freeze-Thaw Stress (-80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000427_0003
Table 80. Stability of 4G8.3-SL-9E8.4 at 1 mg/ When Subjected To Freeze-Thaw Stress (- 80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000427_0004
Figure imgf000428_0002
Table 81. Stability of 9E10.1-GS-33675 at 1 mg/ml When Subjected To Freeze-Thaw Stress (-80°C / 30°C). Aggregate, Monomer, And Fragment Percentages Were Quantitated by SEC.
Figure imgf000428_0001
[0422] For all three DVD-Igs, at either 100 ± 10 mg/ml or 1 mg/ml, no apparent increase in aggregation was observed due to freeze-thaw stress after two cycles.
Example 14.4: Further Assessment of Physicochemical Properties of Anti-VEGF-A/Anti- PDGF-BB DVD-Ig Molecules (Viscosity Determination)
[0423] Based on the earlier physicochemical screen (Example 14.1), three anti-VEGF- A/anti-PDGF-BB DVD-Ig molecules (4G8.3-GS-9E8.4, 4G8.3-SL-9E8.4, and 9E10.1-GS-33675) were selected for further characterization. The molecules were prepared in a formulation buffer at 100 ± 10 mg/ml and the viscosities were measured at room temperature (Example 2.6). The viscosities were 5.1, 7.2, and 7.2 centipoise, respectively. The values are within the range that enables ease of administration via a small diameter needle attached to a syringe.
Example 14.5: Further Assessment of Physicochemical Properties of Anti-VEGF-A/Anti- PDGF-BB DVD-Ig Molecules (Thermal Stability Assessment)
[0424] Based on the earlier physicochemical screen (Example 14.1), three anti-VEGF- A/anti-PDGF-BB DVD-Ig molecules (4G8.3-GS-9E8.4, 4G8.3-SL-9E8.4, and 9E10.1-GS-33675) were selected for further characterization. The molecules were prepared in a formulation buffer at 1 mg/ml according to Example 2.3 and the thermal stabilities were determined according to Example 2.2. The midpoint temperatures of the first transition of unfolding are 52°C, 51°C, and 62°C, respectively. The temperatures at which the first transitions began to appear are 44°C, 42°C, and 62°C, respectively. The data indicate that 9E10.1-GS-33675 has a significantly greater thermal stability than the other two DVD-Ig molecules. Example 14.6: Physicochemical Properties of an Anti-VEGF/anti-PDGF DVD-Ig Molecule (PR-1610561)
[0425] Testing of PR-1610561 revealed high thermostability (Tonset = 62°C), solubility at least at 76 mg/ml, and a viscosity at 100 mg/ml at room temperature of 7.2 centipoise, which is within the range that enables ease of administration via a small diameter needle attached to a syringe. PR-1610561 has appropriate storage stability in a universal buffer and freeze-thaw stability.
Example 14.76: Intact and Reduced Molecular Weight Determination
[0426] Q-TOF LC-MS can detect mass differences between proteins that can result from mis-sense mutations, post-translational modifications, truncations, and other covalent changes that affect protein molecular weight. Table 82 shows the intact molecular weight and deglycosylated intact molecular weight of all three DVD-Ig molecules. Table 83 shows the molecular weights of light chain, heavy chain and deglycosylated heavy chain. The observed molecular weights of the three DVD-Ig molecules match well with the theoretical values with difference of less than 3 Dalton, which is well within the expected range of the error for the instrument.
Table 82. Intact molecular weight
Figure imgf000429_0001
Table 83. Reduced molecular weight
Figure imgf000429_0002
Example 14.8: Oligosaccharide Profiles By Fc Molecular Weight
[0427] DVD-Ig molecules contain N-linked oligosaccharides in the Fc region of the heavy chain. Fc molecular weight measurement can provide a semi-quantitative analysis of the oligosaccharide profiles. Table 84 shows the results of oligosaccharide profiles by Fc molecular weight. The oligosaccharide profiles of all three DVD-Ig molecules were similar to what is normally observed for mAbs, with 70-73% Gal 0F and 21-24% Gal 1F. The level of high mannose species was very low in all three samples. No significant level of aglycosylated species was detected.
Table 84. Oligosaccharide Profiles By Fc Molecular Weight
Figure imgf000430_0001
Example 14.9: Charge Heterogeneity by Weak Cation Exchange Chromatography and Imaged Isoelectric Focusing
[0428] Weak cation exchange (WCX) chromatography separates molecules on the basis of the differences in their net surface charge. Variation in the extent of C terminal processing and certain post-translational modifications can lead to different species of an antibody with different charge distributions. Molecules that vary in their charge properties will exhibit different degrees of interaction with ion exchange resins, thus different elution profiles. Each chromatogram is characterized by a predominant peak (“main”) and species eluting before (“acidic”) or after (“basic”). The relative abundances of these species types are shown in Table 85.
Table 85. Results of Weak Cation Exchange Chromatography Analysis
Figure imgf000430_0002
[0429] Imaged capillary isoelectric focusing (icIEF) is a technique that separates proteins on the basis of their isoelectric points or pI values. Different proteins have different pI and peak profiles, which makes icIEF an ideal identity assay. In icIEF, proteins with different pI values focus into distinctive bands in a linear pH gradient formed by ampholytes after applying high voltage. Table 86 shows the theoretical pI (calculated based on amino acid sequence) and the observed pI values measured by imaged icIEF. Also shown in Table 86 are the relative abundances of different charge species detected by imaged icIEF.
Table 86. Results of Imaged Isoelectric Focusing
Figure imgf000431_0001
Example 15: Pharmacokinetic Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules
Example 15.1: Pharmacokinetic Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules Intravenously Administered In huFcRN Transgenic Mice
[0430] Studies were conducted in accordance with the AbbVie IACUC guidelines. Anti-VEGF/anti-PDGF DVD-Ig molecules PR-1572102 (lot 2211502), PR-1572105 (lot 2211597), or PR-1610561 (lot 2213329) were administered to huFcRn B6.Cg transgenic mice (5/group) at 5 mg/kg by slow intravenous bolus dose injection. Blood samples were collected from each mouse at 1, 24 and 96 hours and 7, 10, 14 and 21 days post dose. All samples were stored at -80°C until analysis. DVD-Ig serum concentrations were measured using a Meso Scale Discovery (MSD) electrochemiluminescence (ECL) Ligand Binding Assay. Biotinylated VEGF ligand was coated onto streptavidin MSD plates for capture of anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules from blood samples, and detection was achieved with a sulfo-tag goat anti- human IgG antibody. Concentrations were calculated by four-parameter logistic fit using XLfit4. Pharmacokinetic parameters were calculated with Non-compartmental analysis using
Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
[0431] All three anti-VEGF/PDGF DVD-Ig molecules carrying the H435A substitution had serum concentrations rapidly clear, with measurable concentrations only to 24 hours. These results are in agreement with the rapid clearance observed with other H435A modified antibody and DVD-Ig molecules in human FcRn transgenic mice.
Example 15.2: Pharmacokinetic Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules Intravitreously Administered in Rabbit
[0432] Studies were conducted in accordance with the Abbott IACUC guidelines. Female New Zealand White rabbits were used for the ocular pharmacokinetic characterization of Anti-VEGF-A/anti-PDGF-BB DVD-Igs: PR-1572102, PR-1572105 and PR-1610561. Animals (4 animals) were split into two cohorts of two for determination of ocular pharmacokinetics. Samples of aqueous humour were taken at 4, 24, 48, 72, 120, 168, 336 and 504 hours post dosing. With cohort 1 providing samples at 4, 48, 120 and 168 hours, and cohort 2 providing samples at 24, 72, 336 and 504 hours, post dosing. Drug levels in the eye were determined from
concentrations in aqueous humour as a surrogate for the vitreous concentrations. Vitreous was harvested from each animal as a terminal sample after their last aqueous humour sample. The proportion of aqueous to vitreous concentration was determined from these terminal time points. Blood samples for the harvest of serum used to estimate systemic exposure after vitreous dosing were also collected at 4, 24, 48, 72, 120, and 168 hours post dosing from all animals, and at 336 and 504 hours from the animals in cohort 2. Test articles were dosed into the vitreous compartment at a range of 0.25 to 0.50 mg per eye with a dose volume of no more than 0.050 mL. Only the right eye of each animal was dosed. Prior to dosing, animals were anesthetized with xylazine/ketamine. The eye was prepared by first applying topical analgesic drops (procaine HCl Ophthalmic solution, 0.5%), then the injections site was swabbed with a saturated povidone- iodine swabstick (10% solution equivalent to 1% available iodine) prior to injection. The intravitreal dose was administered with a 26 gauge needle. The point of entry for the injection was 1-2 mm from the limbus through the sclera. After injection, a sterile cotton eye spear was placed on the injection site and held for 30 seconds to prevent leakage. Animals were anesthetized for aqueous fluid collection. At the selected time points after dosing, the aqueous fluid was collected using a 30 gauge needle inserted through the cornea. The needle was advanced just past the bevel and fluid was collected. The samples provided approximately 0.05- 0.1 mL of aqueous humour per sampling period. At the selected time points after dosing, blood samples were obtained from an ear vein or artery. Hemostasis following collection was achieved by the application of manual pressure and topical clotting factor or tissue glue as needed. The samples were from 0.5-1 ml in volume, and were allowed to clot for harvest of serum. Aqueous, vitreous and serum samples were stored at -80°C, and submitted for drug level determinations.
[0433] All DVD-Ig serum concentrations were measured using a GYROS method employing biotinylated VEGF ligand for capture, and Alexa Flour 647 goat anti-human IgG detection. Concentrations were calculated by four-parameter logistic fit using XLfit4.
Pharmacokinetic parameters were calculated with Non-compartmental analysis using
Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
Table 87. Ocular Half Lives in Rabbit from Analysis of Aqueous Humor
Figure imgf000432_0001
Example 15.3: Pharmacokinetic Properties of Anti-VEGF-A/anti-PDGF-BB DVD-Ig Molecules Intravenously Administered in Cynomolgus Monkey
[0434] Studies are conducted in accordance with the AbbVie IACUC guidelines. Female cynomolgus are used for the systemic pharmacokinetic characterization of Anti-VEGF- A/anti-PDGF-BB DVD-Igs, including PR-1572102, PR-1572105 and PR-1610561 after intravenous dosing. Monkeys are dosed intravenously at 5 mg/kg by slow bolus into the saphenous vein over approximately 2 minutes with a volume of 0.5 mL/kg. Samples are taken for determination of the pharmacokinetics of the test compounds at 0, 0.08, 4, 8, 24, 72, 168, 240, 336, 504 and 672 hours post dosing. At the selected time points after dosing, blood samples are obtained from a femoral vein. Hemostasis following collection is achieved by the application of manual pressure and topical clotting factor or tissue glue as needed. The samples may be approximately 1 ml in volume, and are allowed to clot for harvest of serum. Serum samples are stored at -80°C, and submitted for drug level determinations.
[0435] DVD-Ig serum concentrations are measured using either a GYROS or a MSD method. GYROS employs biotinylated VEGF ligand for capture, and Alexa Flour 647 goat anti- human IgG detection. MSD employs biotinylated VEGF ligand for capture, and Sulfo-tag goat anti-human IgG or sulfo-tag VEGF for detection. Concentrations are calculated by four- parameter logistic fit using XLfit4. Pharmacokinetic parameters are calculated with Non- compartmental analysis using Pharmacokinetics Laboratory Automation Software for
Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
Example 15.4: Pharmacokinetic Properties of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules Intravitreously Administered in Cynomolgus Monkey.
[0436] Studies are conducted in accordance with the AbbVie IACUC guidelines. Female cynomolgus are used for the ocular pharmacokinetic characterization of Anti-VEGF- A/anti-PDGF-BB DVD-Igs, including PR-1572102, PR-1572105 and PR-1610561. Animals (4 animals) are split into two cohorts of two for determination of ocular pharmacokinetics. Samples of aqueous humour are taken at 4, 24, 48, 72, 120, 168, 336 and 504 hours post dosing. With cohort 1 providing samples at 4, 48, 120 and 168 hours, and cohort 2 providing samples at 24, 72, 336 and 504 hours, post dosing. Drug levels in the eye are determined from concentrations in aqueous humour as a surrogate for the vitreous concentrations. Blood samples for the harvest of serum used to estimate systemic exposure after vitreous dosing are also collected at 4, 24, 48, 72, 120, and 168 hours post dosing from all animals, and at 336 and 504 hours from the animals in cohort 2. Test articles are dosed into the vitreous compartment at a range of 0.25 to 0.50 mg per eye with a dose volume of no more than 0.050 mL. Only the right eye of each animal is dosed. Prior to dosing, animals are anesthetized with xylazine/ketamine. The eye is prepared by first applying topical analgesic drops (procaine HCl Ophthalmic solution, 0.5%), then the injections site is swabbed with a saturated povidone-iodine swabstick (10% solution equivalent to 1% available iodine) prior to injection. The intravitreal dose is administered with a 26 gauge needle. The point of entry for the injection is 1-2 mm from the limbus through the sclera. After injection, a sterile cotton eye spear is placed on the injection site and held for 30 seconds to prevent leakage. Animals are anesthetized for aqueous fluid collection. At the selected time points after dosing, the aqueous fluid is collected using a 30 gauge needle inserted through the cornea. The needle is advanced just past the bevel and fluid was collected. The samples provide approximately 0.05- 0.1 mL of aqueous humour per sampling period. At the selected time points after dosing, blood samples are obtained from an ear vein or artery. Hemostasis following collection is achieved by the application of manual pressure and topical clotting factor or tissue glue as needed. The samples are approximately 1 ml in volume, and are allowed to clot for harvest of serum.
Aqueous, vitreous and serum samples are stored at -80°C, and submitted for drug level determinations.
[0437] DVD-Ig serum concentrations are measured using either a GYROS or a MSD method. GYROS employs biotinylated VEGF ligand for capture, and Alexa Flour 647 goat anti- human IgG detection. MSD employs biotinylated VEGF ligand for capture, and Sulfo-tag goat anti-human IgG or sulfo-tag VEGF for detection. Concentrations are calculated by four-parameter logistic fit using XLfit4. Pharmacokinetic parameters are calculated with Non-compartmental analysis using Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
Example 16: Efficacy of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules Human VEGF Transgenic Mice
Example 16.1: Efficacy of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules to Inhibit Subretinal Neovascularization in Rho/huVEGF Transgenic Mice
[0438] Transgenic mice in which the rhodopsin promoter drives expression of human VEGF165 in photoreceptors (Rho-VEGF mice) have onset of VEGF expression at P7 and starting at P10, develop sprouts of NV from the deep capillary bed of the retina that grow through the photoreceptor layer and form an extensive network of new vessels in the subretinal space. Since the new vessels originate from retinal capillaries and not choroidal vessels, it is technically a model of retinal angiomatous proliferation (RAP) which occurs in roughly 30% of patients with neovascular AMD, but in general it mimics critical features of wet AMD. At P14, hemizygous Rho-VEGF mice were given an intraocular injection of test reagents. At P21, the mice were euthanized, and eyes were fixed in 10% phosphate-buffered formalin for 2 hours. Retinas were dissected, blocked with 5% normal swine serum in PBS for 1 hour, stained with FITC-conjugated GSA, a vascular stain, for 2 hours to stain vascular cells, flat mounted with the photoreceptor side up, and examined by fluorescence microscopy. The area of subretinal NV was measured with image analysis by an investigator blinded with respect to treatment group. The other eye will provide information regarding systemic effect of an intraocular injection.
[0439] In the study below, nine treatment groups were evaluated: DVD-Ig Control (DVD 889), Eylea, Anti VEGF mAb, Anti PDGF mAb, Anti VEGF + Anti PDGF (combination Ab treatment), Anti-VEGF/anti-PDGF DVD-Ig. Only eye measurements in the experimental eye were analyzed and reported here using one way ANOVA analysis. Posthoc comparison of treatment vs the DVD control groups was analysed by Dunnett’s test. Results are shown in See Fig.4 and in Table 88 below. Further, differences in PDGF neutralization potencies and the molecular size of the DVD-Ig versus IgG did not have an effect in this model.
[0440] An overall ANOVA F-test for significance was used and the data was shown to be significant (p<.0001). Comparison of the test groups to the DVD-Ig control group shows that the difference from all the groups was significant (Dunnet test p<.0001). PR-1610561 was significantly more effective at inhibiting subretinal neovascularization in Rho/huVEGF transgenic mice than Eylea (Tukey HSD test pvalue = 0.0031). PR-1610561 was more effective, but not significantly different from, the anti-VEGF and anti-PDGF (potency matched mAbs) combination group.
Table 88. Inhibition Efficacy of Anti-VEGF-A, Anti-PDGF-BB, Anti-VEGF-A + Anti- PDGF-BB, and Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules to Subretinal
Neovascularization in Rho/huVEGF Trans enic Mice
Figure imgf000435_0001
Example 16.2: Efficacy of Anti-VEGF-A/Anti-PDGF-BB DVD-Ig Molecules in Tet- Opsin-Human VEGF165 Double–Transgenic Mice
[0441] When given injections of doxycycline, Tet-opsin-VEGF double-transgenic mice with Dox-inducible expression of VEGF express 10-fold higher levels of human VEGF165 than Rho-VEGF–transgenic mice and develop severe NV and exudative retinal detachments within 3 to 5 days. Tet-opsin-VEGF mice provide a severe model where mice develop exudative retinal detachments and only the most effective agents have a significant impact. Double-hemizygous Tet-opsin-VEGF mice were given intraocular injections of test reagent in the right eyes. For the next 3 days, the mice were also administered a daily subcutaneous injection of 50 mg/kg doxycycline. At the 4th day, mice were euthanized and fundus photographs taken with Micron III retinal imaging microscope (Phoenix Research Laboratories, Pleasanton, CA). Also, OCT images were taken by Bioptigen Image-guided OCT (Envisu R4110, Bioptigen Inc. Morrisville, NC). Then eyes were frozen in optimal cutting temperature embedding solution. Ten-micron ocular serial sections were cut through the entire eye, stained with H&E stain and examined by light microscopy. After that mean length of the retinal detachment per section was measured with image analysis by an investigator blinded with respect to treatment group. The percentage of the detached retina was computed. Retinal detachment was graded as no detachment (0); partial retinal detachment (1); or total retinal detachment (2).
[0442] Anti-VEGF-A, anti-PDGF-BB, and the combination of anti-VEGF-A and anti- PDGF-BB were tested for their ability to suppress retinal detachment (RD) in tet-opsin-VEGF double transgenic mice. Results showed differences among the 3 test groups (P=0.01, Kruskal- Wallis test). Based on the RD number, the combination of anti-VEGF-A and anti-PDGF-BB (7 NRD, 1 PRD, 0 TRD), and the anti-VEGF-A alone (5 NRD, 0 PRD, 0 TRD) groups were more effective than anti-PDGF-BB alone (2 NRD, 2 PRD, 2 TRD) in preventing RD in Tet-opsin- VEGF double transgenic mice.
[0443] The differences in efficacy between PR-1610561, Eylea, and control IgG were compared next in tet-opsin-VEGF mice. Differences were also found among the 3 groups (P=0.01, Kruskal-Wallis test). PR-1610561 (10 NRD, 0 PRD, 1 TRD) and Eylea (4 NRD, 3 PRD, 1 TRD) were more effective than IgG control (2 NRD, 2 PRD, 2 TRD) in preventing RD in Tet-opsin-VEGF double transgenic mice. The data is summarized in Table 89 below.
Table 89. The efficacy of test articles in tet-opsin-VEGF double transgenic mice
Figure imgf000436_0001
[0444] The effects of PR-1610561 in a tet/opsin/huVEGF double transgenic mouse retinal detachment model were also analyzed by another grading system (Table 89A). 1 µl of reagent was injected into one eye, followed by subcutaneous injection of doxycycline at 500 mg/kg once a day for three days, and then fundus images and OCTs were done at day 4. Retinal detachment was graded as no detachment (0); no retinal detachment but at least one sign selected from dilated retinal vessels, retinal edema, or hemorrhage (1); one or less than one quadrant of retinal detachment (2); two or three quandrants of retinal detachment or shallow pan retinal detachment (3); or severe bullous retinal detachment (4).
Table 89A. Efficacy of Anti-VEGF, Anti-PDGF, Anti-VEGF + Anti-PDGF, and Anti-VEGF/Anti-PDGF DVD-Ig Molecules in Tet/Opsin/huVEGF Double
Transgenic Mice
Figure imgf000437_0001
[0445] The results in the tables above show that PR-1610561 has similar efficacy to a combination of anti-VEGF-A and anti-PDGF-BB, and is superior to Aflibercept alone in suppressing subretinal neovascularization in Rho/huVEGF transgenic mice. PR-1610561 is also superior to the combination of Aflibercept and anti-PDGF-BB in the prevention of vascular leakage in Rho/huVEGF transgenic mice.
Example 16.3: Effects of Anti-VEGF/Anti-PDGF on Ocular Neovascularization and Vascular Permeability/Perfusion
[0446] This study compared the effects of intraocular injections of anti-VEGF/anti- PDGF DVD-Ig molecules, anti-VEGF mAb alone, anti-PDGF alone, and a combination of antibodies.
[0447] DVD-Ig molecules and DVD-Ig Fab fragments were selected for evaluation, first in Rho/VEGF mice and then in Tet/opsin/VEGF double transgenic mice.
[0448] Studies used rho/VEGF and Tet/opsin/VEGF mouse models as described in Example 16.1. The compounds evaluated are shown in Table 90 below. About 20 mice were included per experiment, where one eye was injected with agent and the other eye was not injected.
Figure imgf000437_0002
Figure imgf000438_0001
[0449] Transgenic mice in which the rhodopsin promoter drives expression of VEGF in photoreceptors (rho/VEGF mice) develop retinal angiomatous proliferation (RAP) which originates from the deep capillary bed of the retina and grows through the photoreceptor layer to reach the subretinal spaces. The transgenic mice were utilized to determine the effects of DVD-Ig molecules on subretinal neovascularization. The rho/VEGF mice have an onset of VEGF expression at P7 and, starting at P10, develop sprouts of NV from the deep capillary bed of the retina that grow through the photoreceptor layer and form an extensive network of new vessels in the subretinal space. At P14, hemizygous Rho-VEGF mice were given an intraocular injection of test reagents. At P21, the mice were euthanized, and eyes were fixed in 10% phosphate-buffered formalin for 2 hours. Retinas were dissected, blocked with 5% normal swine serum in PBS for 1 hour, stained with FITC-conjugated GSA for 2 hours to stain vascular cells, flat mounted with the photoreceptor side up, and examined by fluorescence microscopy. The area of subretinal NV was measured with image analysis by an investigator blinded with respect to treatment group.
[0450] Compared with the control DVD-Ig molecule, DVD-Ig-1 and DVD-Ig-3 significantly decreased choroidal neovascularization (CNV) (p=0.02, 0.04), whereas DVD-Ig-2 did not show much effect. Compared with the IgG control, the combined administration of anti- VEGF IgG and anti-PDGF-BB IgG significantly decreased CNV (p=0.045), while administration of anti-VEGF IgG or anti-PDGF IgG alone did not significantly reduce subretinal NV. No other difference was observed in eyes injected with Avastin, anti-PDGF-BB aptamer, or a mixture of Avastin and anti-PDGF-BB aptamer. Significantly decreased subretinal NV was found after administration of DVD-Ig-1 and DVD-Ig-3, when compared to the mixture of Avastin and the anti-PDGF-BB aptamer. No other difference was found between DVD-Ig reagents and the combined administration of anti-VEGF-IgG and anti-PDGF IgG. Fig.5.
[0451] No difference was found in the untreated eyes of mice injected with anti- VEGF/anti-PDGF DVD-Ig molecules, control DVD-Ig, anti-VEGF mAb alone, anti-PDGF alone, and a combination of antibodies (ANOVA, P>0.05), indicating there was no clear systemic effect of intraocular injection. Fig.6.
[0452] Tet/opsin/VEGF mice express higher levels of VEGF in photoreceptors than rho/VEGF mice, resulting in severe NV and vascular leakage with exudative retinal detachment. The efficacy of intraocular injections of anti-VEGF/anti-PDGF DVD-Ig molecules in this transgenic mouse was also evaluated. Mice were given intraocular injections of test reagent in the right eye. For the next 3 days, the mice were also administered a daily subcutaneous injection of 50 mg/kg doxycycline. At the 4th days, mice were euthanized and fundus photographs were taken with Micron III retinal imaging microscope (Phoenix Research Laboratories, Pleasanton, CA). OCT images were taken by Bioptigen Image-guided OCT (Envisu R4110, Bioptigen Inc.
Morrisville, NC). Then eyes were frozen in optimal cutting temperature embedding solution. Ten-micron ocular serial sections were cut through the entire eye, stained with H&E stain and examined by light microscopy. Mean length of the retinal detachment per section was measured with image analysis by an investigator blinded with respect to treatment group. The percentage of the retina that was detached was computed.
[0453] Five mice in each test group were injected with DVD-Ig reagents separately. In DVD-Ig-1 injected eyes, two were not detached and three were partially detached, while three eyes were totally detached and two partially detached in the uninjected eye. In DVD-Ig-3 injected eyes, one was not detached, two were partially detached, and two were totally detached, while all the uninjected eyes were totally detached. In the DVD-Ig-2 injected eyes, one was not detached and four were totally detached, while one eye was partially detached and four eyes were totally detached in the uninjected eye. In the IgG control group, one injected eye was not detached, one eye was partially detached, and three eyes were totally detached, while all eyes were totally detached in the uninjected eye. Fig.7.
[0454] Thus, DVD-Ig-1 and DVD-Ig-3 appeared to perform at least as well as a combination of anti-VEGF mAb and anti-PDGF mAb for the measured parameters, while requiring the administration of only one compound.
Example 17: Generation and Identification of Various Molecular Formats Optimal for Applications in Ocular Diseases
[0455] Several attributes were considered in the design of a therapeutic biologic for the treatment of wet AMD:
[0456] PK, efficacy and frequency of administration: Longer ocular duration may support less frequent intravitreous injection. The size of the administered molecule may play a role in determining ocular half-life. This is supported by consistently longer ocular half-life for the current anti-VEGF agents with larger molecular size in humans and in experimental animals. Bevacizumab, which has a larger molecular size (150 kDa) than ranibizumab (49 kDa), also seems to have more robust duration of efficacy in both Rho/huVEGF and tet/huVEGF transgenic mice, the two models used for preclinical efficacy.
[0457] FcRn and Fc γR binding and safety: Fc neonatal receptor (FcRn), which plays a role for long circulating half-life of IgG molecules in serum, may or may not play an important role in determining ocular half-life. The molecules with wild type FcRn binding, however, will have long systemic half-life and may increase safety risk due to unnecessary systemic exposure of intravitreously injected molecules. FcRn is also perceived to play a role in active efflux of IgGs across blood-retina barrier. This may lead to shortened ocular retention time for the
intravitreously inject molecules. Effector functions are not needed for the efficacy of anti-wet AMD agents. But both VEGF-A and PDGF-BB may be associated with extracellular matrix when they are initially synthesized and secreted. The ECM-associated VEGF-A and PDGF-BB therefore may potentially mediate effector functions.
[0458] Affinity, valency and potency: Both VEGF-A and PDGF-BB are
homodimeric molecules. If a monovalent molecular format similar to that of ranibizumab (Fab) is used for bispecific molecules targeting VEGF and PDGF for the treatment of wet AMD, high affinity may be needed to maintain binding and potent neutralization of both VEGF-A and PDGF- BB.
[0459] Manufacturability: Any viable format needs to have acceptable expression, purification, formulation properties to accommodate DS and DP manufacturing.
[0460] Various binding protein formats disclosed herein may satisfy these
characteristics:
(1) Full length DVD-Ig [L234A, L235A] (200 kDa, lacks binding to FcgRs)
(2) Full length DVD-Ig [L234A, L235A, H435A] (200 kDa, lacks binding to FcgRs and FcRn) (3) Half DVD-Ig (100 kDa, lacks binding to FcgRs and FcRn)
(4) DVD-Fab (75 kDa, no Fc)
Example 17.1: Generation of Various Molecular Formats Including DVD-Ig
[L234A, L235A], DVD-Ig [L234A, L235A and H435A], DVD-Ig [L234A, L235A and H435R], Half DVD-Ig and DVD-Fab
[0461] This example evaluates the impact of Fc mutations on the PK properties of DVD-Ig binding proteins. DVD-038 was used a tool molecule to study various DVD-Ig formats, including a half-DVD-Ig (DVD038 [L234A, L235A] Half-DVD), full DVD-Ig binding proteins having three constant domain mutations (DVD038 [L234A, L235A and H435A] and DVD038 [L234A, L235A and H435R]), and a full DVD-Ig binding protein having two constant domain mutations (DVD038 [L234A, L235A]). The data below was used to evaluate options for producing a VEGF/PDGF binding protein structure with good drug-like properties and exhibiting high ocular duration but low systemic circulation. DVD038 is a dual variable domain binding protein that binds HER2 and VEGF.
[0462] To prepare mutants of DVD038, overlapping PCR was used with primers designed to include the desired mutations. PCR products were digested and ligated into the cloning vector. Bacterial transformation was performed to identify positive clones and constructs were harvested and purified for use in mammalian transfection using standard protocols known in the art. [0463] All variants were transiently transfected into 10L of HEK 2936E suspension cell cultures in a Wave-bag with a ratio of 60% to 40% light to heavy chain construct. 0.5 mg/mL PEI was used to transfect the cells. Supernatants were harvested after 11 days by centrifugation at 16000g for 20 minutes followed by filtration using Pall Serum Capsule and Pall AcroPak 1000. All except DVD-Fab were purified on MabSelectSuRe resin (GE Healthcare, 17-5438-04).
Following equilibration with PBS pH 7.4, the supernatant was loaded on the resin and washed with PBS pH 7.4. DVD-Ig protein was eluted with 50 mM Glycine, 50 mM NaCl pH 3.5. DVD- Fab was purified using Protein G Sepharose 4 FF resin (GE Healthcare, 17-0618-04). Elution was performed with Immunopure IgG elution buffer (Pierce, 1851520). Fractions containing DVD-Ig were pooled and dialyzed in 30 mM Histidine pH 6, 8% sucrose overnight at 4oC.
Example 17.2: Binding of Various Formats to FcRns from Different Species
[0464] As described in Example 1.2, all variants of DVD038, except for DVD038 Fab which does not have an Fc region, were analyzed for their binding to FcRns from different species. The data is summarized in Table 91 below.
Table 91. Binding of Various Formats to FcRns from Different Species
Figure imgf000441_0001
= no s gn cant n ng
Example 17.3: Pharmacokinetic Properties of Different Formats in huFcRn Transgenic Mice Administered Intravenously
[0465] Studies were conducted in accordance with the Abbott IACUC guidelines. DVD038 (L234A, L235A) (PR-1565009), DVD038 (L234A, L235A, H435R) (PR-1564681), and DVD038 (L234A, L235A, H435A) (PR-1565689) were administered to huFcRn transgenic mice (5/group) at 6.7 mg/kg by slow intravenous bolus dose injection. Blood samples were collected from each mouse at 1, 24 and 96 hours and 7, 10, 14 and 21 days post dose. All samples were stored at -80°C until analysis. DVD-Ig serum concentrations were measured using a Meso Scale Discovery (MSD) electrochemiluminescence (ECL) Ligand Binding Assay. Biotinylated VEGF ligand was coated onto streptavidin MSD plates for capture of anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules from blood samples, and detection was achieved with a sulfo-tag goat anti- human IgG antibody. Concentrations were calculated by four-parameter logistic fit using XLfit4. Pharmacokinetic parameters were calculated with Non-compartmental analysis using
Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
Table 92. PK in huFcRn Transgenic Mice
Figure imgf000442_0001
 
The results demonstrate a trend for increased clearance and shorter half-life for DVD constructs with reduced or lack of Fc binding in huFcRn transgenic mice.
Example 17.4: Pharmacokinetic Properties of Different Formats in CD-1 Mice Administered Intravenously
[0466] Studies were conducted in accordance with the Abbott IACUC guidelines. DVD038 (L234A, L235A) (PR-1565009), DVD038 (L234A, L235A, H435R) (PR-1564681), DVD038 (L234A, L235A, H435A) (PR-1565689), DVD038 half DVD-Ig (L234A, L235A) (PR- 1578399) and DVD-Fab (PR-1574215) were administered to CD-1 mice (5/group) at 6.7 mg/kg by slow intravenous bolus dose injection. Blood samples were collected from each mouse at 1, 24 and 96 hours and 7, 10, 14 and 21 days post dose. All samples were stored at -80°C until analysis. DVD-Ig serum concentrations were measured using a Meso Scale Discovery (MSD) electrochemiluminescence (ECL) Ligand Binding Assay. Biotinylated VEGF ligand was coated onto streptavidin MSD plates for capture of anti-VEGF-A/anti-PDGF-BB DVD-Ig molecules from blood samples, and detection was achieved with a sulfo-tag goat anti-human IgG antibody. Concentrations were calculated by four-parameter logistic fit using XLfit4. Pharmacokinetic parameters were calculated with Non-compartmental analysis using Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie).
Table 93. PK in CD-1 Mice
Figure imgf000442_0002
Results demonstrate a trend for increased clearance and shorter half-life for DVD constructs with reduced or lack of Fc binding in CD-1 mice. Molecules composed of a fragment of immunoglobulin structure are cleared fastest.
Example 17.5: Pharmacokinetic Properties of Different Formats in Rabbits
Administered Intravitreously
[0467] Studies were conducted in accordance with the AbbVie IACUC guidelines. Female New Zealand White rabbits were used for the ocular pharmacokinetic characterization of formats DVD038 (PR-1565009, lot 2131983), DVD038 H435A (PR-1565689, lot 2131481), DVD038 Dhab (PR-1578399, lot 2149586) and DVDFab (PR-1574215, lot 2143755). Animals (4 animals) were split into two cohorts of two for determination of ocular pharmacokinetics. Samples of aqueous humour were taken at 48, 168, 336 and 504 hours post dosing. With cohort 1 providing samples at 48 and 168 hours, and cohort 2 providing samples at 336 and 504 hours, post dosing. Drug levels in the eye were determined from concentrations in aqueous humour. Blood samples for the harvest of serum used to estimate systemic exposure after vitreous dosing were also collected at 4, 24, 48, 72, 120, 168 hours post dosing from all animals, and at 336 and 504 hours from the animals in cohort 2. Test articles were dosed into the vitreous compartment at 0.50 mg per eye with a volume of no more than 0.050 mL. Only the right eye of each animal was dosed. Prior to dosing, animals were anesthetized with xylazine/ketamine. The eye was prepared by first applying topical analgesic drops (procaine HCl Ophthalmic solution, 0.5%), then the injections site was swabbed with a saturated povidone-iodine swab stick (10% solution equivalent to 1% available iodine) prior to injection. The intravitreal dose was administered with a 26 gauge needle. The point of entry for the injection was 1-2 mm from the limbus through the sclera. After injection, a sterile cotton eye spear was placed on the injection site and held for 30 seconds to prevent leakage. Animals were anesthetized for aqueous fluid collection. At the selected time points after dosing, the aqueous fluid was collected using a 30 gauge needle inserted through the cornea. The needle was advanced just past the bevel and fluid was collected. The samples provided approximately 0.05-0.1 mL of aqueous humour per sampling period. At the selected time points after dosing, blood samples were obtained from an ear vein or artery. Hemostasis following collection was achieved by the application of manual pressure and topical clotting factor or tissue glue as needed. The samples were from 0.5-1 ml in volume, and were allowed to clot for harvest of serum. Aqueous, vitreous and serum samples were stored at -80°C, and submitted for drug level determinations.
[0468] The serum, and aqueous humour concentrations for these molecules were measured using either a GYROS or a MSD method. GYROS employs a biotinylated VEGF ligand for capture, and Alexa Flour 647 goat anti-human IgG detection. MSD employs biotinylated VEGF ligand for capture, and Sulfo-tag goat anti-human IgG or sulfo-tag VEGF for detection. Results were comparable between the two methods. Concentrations were calculated by four-parameter logistic fit using XLfit4. Pharmacokinetic parameters were calculated with Non-compartmental analysis using Pharmacokinetics Laboratory Automation Software for Management and Analysis (PLASMA) (Version 2.6.12, SParCS, AbbVie). Results from the experiment are shown in Table 94.
Table 94. Ocular Half Lives in Rabbit from Analysis of Aqueous Humor
Figure imgf000444_0001
[0469] Population analysis of the pooled data sets was performed on the composite profile from multiple animals at each dose level. The analysis provided parameter estimates with reasonable variability (CV<30%). The larger molecular weight constructs show a weak trend towards a longer ocular half-life.
Table 95. Exemplary DVD-Ig Binding Proteins And Component Subunits
Figure imgf000444_0002
Figure imgf000445_0001
Figure imgf000446_0001
Figure imgf000447_0001
Figure imgf000448_0001
Figure imgf000449_0001
Figure imgf000450_0001
Figure imgf000451_0001
Figure imgf000452_0002
Table 96. Sequences of Exemplary DVD-Ig Binding Proteins
Figure imgf000452_0001
Figure imgf000453_0001
Figure imgf000454_0001
Figure imgf000455_0001
Figure imgf000456_0001
Figure imgf000457_0001
Figure imgf000458_0001
Figure imgf000459_0001
Figure imgf000460_0001
Figure imgf000461_0001
Figure imgf000462_0001
Figure imgf000463_0001
Figure imgf000464_0001
Figure imgf000465_0001
Figure imgf000466_0001
Figure imgf000467_0001
Figure imgf000468_0001
Figure imgf000469_0001
Figure imgf000470_0001
Figure imgf000471_0001
Figure imgf000472_0001
Figure imgf000473_0001
Figure imgf000474_0001
Figure imgf000475_0001
Figure imgf000476_0001
Example 18: PR-1610561 Cell Lines
[0470] Chimeric, humanized, and affinity matured antibodies, and DVD-Ig binding proteins were expressed using pHybE vectors. Transient expression of PR-1610561 in HEK cells was also achieved using a vector similar to pHybE-hCg1,z,non-a,mut(234,235) V2. See US Patent No.8,187,836.
[0471] CHO cell lines producing PR-1610561 have been generated. The growth and productivity of the CHO cell lines were similar to those of other DVD-Ig molecules. All cell lines passed a screening for acceptable product quality by MS, SEC, and CIEX. CHO cell lines were produced using pBJ and pCD plasmid vectors encoding the amino acid sequences of PR-1610561. See US 2014/0295497.
Example 19: Epitope Binning
[0472] Antibodies and binding proteins disclosed herein are tested in a label-free cell- based competition assay in order to determine which antibodies and binding proteins are capable of binding to the same antigen (e.g., VEGF, PDGF, or one of their receptors) simultaneously. If antibodies or binding proteins are not able to bind simultaneously (therefore possibly competing for the same or similar epitope), those antibodies or binding proteins are assigned to the same “epitope bin.” If antibodies or binding proteins are capable of binding simultaneously and therefore do not compete for antigen binding, those antibodies or binding proteins are assigned to different epitope bins. Incorporation by Reference
[0473] The contents of all cited references (including literature references, patents, patent applications, and websites) that maybe cited throughout this application are hereby expressly incorporated by reference in their entirety for any purpose, as are the references cited therein. To the extent those references contradict or are inconsistent with any statements in this application, the text of the application will control. The disclosure will employ, unless otherwise indicated, conventional techniques of immunology, molecular biology and cell biology, and pathology, which are well known in the art.
Equivalents
[0474] The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting of the inventions described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are therefore intended to be embraced herein.

Claims

We claim:
1. A binding protein comprising first and second polypeptide chains, each independently comprising VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first variable domain;
VD2 is a second variable domain;
C is a constant domain;
X1 is a linker;
X2 is an Fc region; and
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site,
wherein the binding protein is capable of binding VEGF, wherein the variable domains that form a functional target binding site for VEGF comprise:
Figure imgf000478_0001
Figure imgf000479_0001
Figure imgf000480_0001
2. The binding protein of claim 1, wherein the binding protein is also capable of binding PDGF. 3. The binding protein of claim 2, wherein the variable domains that form a functional target binding site for PDGF comprise:
Figure imgf000480_0002
Figure imgf000481_0001
(iii) a CDR-H3 comprising X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 (SEQ ID NO: >>), wherein
Figure imgf000481_0002
(iv) a CDR CDR-L1 comprising X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13 (SEQ ID NO: >>), wherein
Figure imgf000481_0003
Figure imgf000482_0001
4. The binding protein of any one of claims 1-3, further comprising human framework sequences.
5. A binding protein comprising first and second polypeptide chains, each independently comprising VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first variable domain; VD2 is a second variable domain;
C is a constant domain;
X1 is a linker;
X2 is an Fc region; and
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site,
wherein the binding protein is capable of binding PDGF, wherein the variable domains that form a functional target binding site for PDGF comprise:
(i) a CDR-H1 comprising X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 (SEQ ID NO: >>), wherein
Figure imgf000483_0001
Figure imgf000484_0001
(v) a CDR-L2 comprising X1-X2-X3-X4-X5-X6-X7 (SEQ ID NO: >>), wherein
Figure imgf000485_0001
6. The binding protein of claim 5, wherein the binding protein is also capable of binding VEGF. 7. The binding protein of claim 6, wherein the variable domains that form a functional target binding site for VEGF comprise:
(i) a CDR-H1 comprising X1-X2-X3-X4-X5-X6-X7-X8-X9-X10 (SEQ ID NO: >>), wherein
Figure imgf000485_0002
Figure imgf000486_0001
Figure imgf000487_0001
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site,
wherein the binding protein is capable of binding VEGF, wherein the variable domains that form a functional target binding site for VEGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 27 or 38-42.
10. The binding protein of claim 9, wherein the variable domains that form a functional target binding site for VEGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 27 or 38-42.
11. The binding protein of claim 9 or 10, wherein the binding protein is also capable of binding PDGF.
12. The binding protein of claim 9, wherein the variable domains that form a functional target binding site for PDGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 28 or 46-50.
13. The binding protein of claim 9 or 10, wherein the variable domains that form a functional target binding site for PDGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 28 or 46-50.
14. A binding protein comprising first and second polypeptide chains, each independently
comprising VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first variable domain;
VD2 is a second variable domain;
C is a constant domain;
X1 is a linker;
X2 is an Fc region; and
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site, wherein the binding protein is capable of binding PDGF, wherein the variable domains that form a functional target binding site for PDGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 28 or 46-50.
15. The binding protein of claim 14, wherein the variable domains that form a functional target binding site for PDGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 28 or 46-50.
16. The binding protein of claim 14 or 15, wherein the binding protein is also capable of binding VEGF.
17. The binding protein of claim 14, wherein the variable domains that form a functional target binding site for VEGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 27 or 38-42.
18. The binding protein of claim 14 or 15, wherein the variable domains that form a functional target binding site for VEGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 27 or 38-42.
19. A binding protein comprising first and second polypeptide chains, each independently
comprising VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first variable domain;
VD2 is a second variable domain;
C is a constant domain;
X1 is a linker;
X2 is an Fc region; and
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site,
wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise:
CDRs 1-3 from SEQ ID NO: 17 and CDRs-1-3 from SEQ ID NO: 18,
CDRs 1-3 from SEQ ID NO: 19 and CDRs-1-3 from SEQ ID NO: 20,
CDRs 1-3 from SEQ ID NO: 21 and CDRs-1-3 from SEQ ID NO: 22,
CDRs 1-3 from SEQ ID NO: 23 and CDRs-1-3 from SEQ ID NO: 24,
CDRs 1-3 from SEQ ID NO: 25 and CDRs-1-3 from SEQ ID NO: 26,
CDRs 1-3 from SEQ ID NO: 27 and CDRs-1-3 from SEQ ID NO: 28,
CDRs 1-3 from SEQ ID NO: 29 and CDRs-1-3 from SEQ ID NO: 30,
CDRs 1-3 from SEQ ID NO: 31 and CDRs-1-3 from SEQ ID NO: 32,
CDRs 1-3 from SEQ ID NO: 33 and CDRs-1-3 from SEQ ID NO: 34,
CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, CDRs 1-3 from SEQ ID NO: 37 and CDRs-1-3 from SEQ ID NO: 38,
CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40,
CDRs 1-3 from SEQ ID NO: 41 and CDRs-1-3 from SEQ ID NO: 42, or CDRs 1-3 from SEQ ID NO: 43 and CDRs-1-3 from SEQ ID NO: 44, and b. the variable domains that form a functional target binding site for PDGF comprise:
CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2, CDRs 1-3 from SEQ ID NO: 3 and CDRs-1-3 from SEQ ID NO: 4, CDRs 1-3 from SEQ ID NO: 5 and CDRs-1-3 from SEQ ID NO: 6, CDRs 1-3 from SEQ ID NO: 7 and CDRs-1-3 from SEQ ID NO: 8, CDRs 1-3 from SEQ ID NO: 9 and CDRs-1-3 from SEQ ID NO: 10,
CDRs 1-3 from SEQ ID NO: 11 and CDRs-1-3 from SEQ ID NO: 12,
CDRs 1-3 from SEQ ID NO: 13 and CDRs-1-3 from SEQ ID NO: 14,
CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs-1-3 from SEQ ID NO: 212.
20. A binding protein comprising first and second polypeptide chains, each independently
comprising VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first variable domain;
VD2 is a second variable domain;
C is a constant domain;
X1 is a linker;
X2 is an Fc region; and
n is 0 or 1,
wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site, and wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise a sequence selected from the group consisting of SEQ ID NO: 17-44 and b. the variable domains that form a functional target binding site for PDGF comprise a sequence selected from the group consisting of SEQ ID NO: 1-16, 211, and 212. 21. The binding protein of any one of claims 19-20, wherein:
a. the variable domains that form a functional target binding site for VEGF comprise:
SEQ ID NO: 17 and SEQ ID NO: 18,
SEQ ID NO: 19 and SEQ ID NO: 20,
SEQ ID NO: 21 and SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24,
SEQ ID NO: 25 and SEQ ID NO: 26,
SEQ ID NO: 27 and SEQ ID NO: 28,
SEQ ID NO: 29 and SEQ ID NO: 30,
SEQ ID NO: 31 and SEQ ID NO: 32,
SEQ ID NO: 33 and SEQ ID NO: 34,
SEQ ID NO: 35 and SEQ ID NO: 36,
SEQ ID NO: 37 and SEQ ID NO: 38,
SEQ ID NO: 39 and SEQ ID NO: 40,
SEQ ID NO: 41 and SEQ ID NO: 42, or
SEQ ID NO: 43 and SEQ ID NO: 44, and
b. the variable domains that form a functional target binding site for PDGF comprise:
SEQ ID NO: 1 and SEQ ID NO: 2,
SEQ ID NO: 3 and SEQ ID NO: 4,
SEQ ID NO: 5 and SEQ ID NO: 6,
SEQ ID NO: 7 and SEQ ID NO: 8,
SEQ ID NO: 9 and SEQ ID NO: 10,
SEQ ID NO: 11 and SEQ ID NO: 12,
SEQ ID NO: 13 and SEQ ID NO: 14,
SEQ ID NO: 15 and SEQ ID NO: 16, or
SEQ ID NO: 211 and SEQ ID NO: 212.
22. The binding protein of any one of claims 1-21, wherein the first polypeptide chain comprises a first VD1-(X1)n-VD2-C-X2, wherein
VD1 is a first heavy chain variable domain;
VD2 is a second heavy chain variable domain;
C is a heavy chain constant domain;
X1 is a linker;
X2 is an Fc;
n is 0 or 1, and
wherein the second polypeptide chain comprises a second VD1-(X1)n-VD2-C, wherein
VD1 is a first light chain variable domain;
VD2 is a second light chain variable domain;
C is a light chain constant domain;
X1 is a linker;
n is 0 or 1; and
the second polypeptide chain does not comprise an Fc, wherein the VD1 domains on the first and second polypeptide chains form a first functional target binding site and the VD2 domains on the first and second polypeptide chains form a second functional target binding site.
23. The binding protein of any one of claims 1-22, wherein the X1 linkers on the first and second polypeptide chains independently comprise any one or more of the sequences listed in Table 55.
24. The binding protein of any one of claims 19-22, wherein the binding protein is capable of binding VEGF and PDGF, and wherein the binding protein comprises any one of:
Figure imgf000492_0001
Figure imgf000493_0001
PR-1571836 (comprising SEQ ID NOs: 247 and 248),
PR-1577053 (comprising SEQ ID NOs: 249 and 250), or
PR-1577056 (comprising SEQ ID NOs: 251 and 252). 25. The binding protein of any one of claims 19-24, wherein:
(i) the binding protein is capable of binding VEGF with a KD of at most about 1.5 x 10-11 M, as measured by surface plasmon resonance, or capable of inhibiting human VEGF with an IC50 of at most about 0.213 nM, as measured in a VEGF neutralization assay, and/or
(ii) the binding protein is capable of binding PDGF with a KD of at most about 2.1 x 10-10 M, as measured by surface plasmon resonance, or capable of inhibiting PDGF with an IC50 of at most about 0.035 nM, as measured in a PDGF neutralization assay.
26. The binding protein of any one of claims 1-25, wherein the Fc region is a variant sequence Fc region.
27. The binding protein of any one of claims 1-26, wherein the binding protein comprises:
a) a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprise a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and
(b) a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. 28. The binding protein of claim 19 wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise:
CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, and b. the variable domains that form a functional target binding site for PDGF comprise:
CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16.
29. The binding protein of claim 28, wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise:
SEQ ID NO: 35 and SEQ ID NO: 36, and
b. the variable domains that form a functional target binding site for PDGF comprise:
SEQ ID NO: 15 and SEQ ID NO: 16.
30. The binding protein of claim 28 or 29, wherein the binding protein is capable of binding VEGF and PDGF, and wherein the binding protein comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132).
31. The binding protein of any one of claims 28-30, wherein the binding protein comprises: a) a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and
(b) a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. 32. The binding protein of any one of claims 28-31, wherein the binding protein is capable of binding:
(i) VEGF with a KD of at most about 1.8 x 10-12 M, as measured by surface plasmon resonance, or capable of inhibiting human VEGF with an IC50 of at most about 0.097 nM measured in a VEGF neutralization assay, and/or
(ii) PDGF with a KD of at most about 4.5 x 10-13 M, as measured by surface plasmon resonance, or capable of inhibiting PDGF with an IC50 of at most about 0.032 nM, as measured in a PDGF neutralization assay.
33. The binding protein of claim 19, wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise:
CDRs 1-3 from SEQ ID NO: 17 and CDRs-1-3 from SEQ ID NO: 18, and b. the variable domains that form a functional target binding site for PDGF comprise:
CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2.
34. The binding protein of claim 33, wherein the binding protein is capable of binding VEGF and PDGF, wherein
a. the variable domains that form a functional target binding site for VEGF comprise:
SEQ ID NO: 17 and SEQ ID NO: 18,and
b. the variable domains that form a functional target binding site for PDGF comprise:
SEQ ID NO: 1 and SEQ ID NO: 2. 35. The binding protein of claim 33 or 34, wherein the binding protein is capable of binding VEGF and PDGF, and wherein the binding protein comprises PR-1572102 (comprising SEQ ID NOs: 88 and 89).
36. The binding protein of any one of claims 33-35, wherein the binding protein comprises: a) a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and
(b) a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. 37. The binding protein of any one of claims 33-36, wherein the binding protein is capable of binding:
(i) VEGF with a KD of at most about 1.3 x 10-11 M, as measured by surface plasmon resonance, or capable of inhibiting human VEGF with an IC50 of at most about 0.182 nM measured in a VEGF neutralization assay, and/or (ii) PDGF with a KD of at most about 1.3 x 10-11 M, as measured by surface plasmon resonance, or capable of inhibiting PDGF with an IC50 of at most about 0.139 nM, as measured in a PDGF neutralization assay. 38. The binding protein of claim 33 or 34, wherein the binding protein is capable of binding VEGF and PDGF, and wherein the binding protein comprises PR-1572105 (comprising SEQ ID NOs: 94 and 95). 39. The binding protein of claim 38, wherein the binding protein comprises:
a) a heavy chain constant region on the first polypeptide chain comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprising a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and
(b) a light chain constant region on the second polypeptide chain comprising a human kappa light chain constant region sequence. 40. The binding protein of any one of claims 33-34 or 38-39, wherein the binding protein is capable of binding:
(i) VEGF with a KD of at most about 1.1 x 10-11 M, as measured by surface plasmon resonance, or capable of inhibiting human VEGF with an IC50 of at most about 0.139 nM measured in a VEGF neutralization assay, and/or Ĩii) PDGF with a KD of at most about 1.3 x 10-11 M, as measured by surface plasmon resonance, or capable of inhibiting PDGF with an IC50 of at most about 0.096 nM, as measured in a PDGF neutralization assay. 41. The binding protein of any one of claims 1-40, comprising two first polypeptide chains and two second polypeptide chains, and four functional target binding sites.
42. The binding protein of any one of claims 1-41, wherein X1 is not CH1 or CL. 43. The binding protein of any one of claims 1-42, wherein the Fc region is an Fc region from an IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, or IgD, or a variant thereof. 44. The binding protein of any one of claims 1-43, wherein the binding protein is a crystallized binding protein. 45. A binding protein conjugate comprising a binding protein according to any one of claims 1- 44, the binding protein conjugate further comprising an immunoadhesion molecule, an imaging agent, a therapeutic agent, or a cytotoxic agent. 46. The binding protein conjugate of claim 45, wherein the imaging agent is a radiolabel, an enzyme, a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, or biotin. 47. The binding protein conjugate of claim 46, wherein the radiolabel is 3H 14
, C 35
, S, 90Y, 99Tc, 111In, 125I, 131I, 177Lu, 166Ho, or 153Sm. 48. The binding protein conjugate of claim 45, wherein the therapeutic or cytotoxic agent is an anti-metabolite, an alkylating agent, an antibiotic, a growth factor, a cytokine, an anti- angiogenic agent, an anti-mitotic agent, an anthracycline, toxin, or an apoptotic agent. 49. An isolated nucleic acid encoding the binding protein amino acid sequence of any one of claims 1-44. 50. A vector comprising the isolated nucleic acid according to claim 49. 51. The vector of claim 50, wherein the vector comprises pcDNA, pTT, pTT3, pEFBOS, pBV, pJV, pcDNA3.1 TOPO, pEF6, pHybE, TOPO, or pBJ. 52. A host cell comprising the vector of claim 50 or 51.
53. The host cell of claim 52, wherein the host cell is a prokaryotic cell, Escherichia coli, a eukaryotic cell, a protist cell, an animal cell, a plant cell, a fungal cell, a yeast cell, an Sf9 cell, a mammalian cell, an avian cell, an insect cell, a CHO cell or a COS cell. 54. A method of producing a binding protein, comprising culturing the host cell of claim 52 or 53 in culture medium under conditions sufficient to produce the binding protein. 55. A pharmaceutical composition comprising the binding protein according to any one of claims 1-44, and a pharmaceutically acceptable carrier. 56. The pharmaceutical composition of claim 55, further comprising at least one additional
therapeutic agent. 57. The pharmaceutical composition according to claim 56, wherein the additional therapeutic agent is an imaging agent, a cytotoxic agent, an angiogenesis inhibitor, a kinase inhibitor, a co-stimulation molecule blocker, an adhesion molecule blocker, an anti-cytokine antibody or functional fragment thereof, methotrexate, cyclosporin, rapamycin, FK506, a detectable label or reporter, a TNF antagonist, an antirheumatic, a muscle relaxant, a narcotic, a non-steroid anti-inflammatory drug (NSAID), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial, an antipsoriatic, a corticosteriod, an anabolic steroid, an erythropoietin, an immunization, an immunoglobulin, an immunosuppressive, a growth hormone, a hormone replacement drug, a radiopharmaceutical, an antidepressant, an antipsychotic, a stimulant, an asthma medication, a beta agonist, an inhaled steroid, an epinephrine or analog, a cytokine, or a cytokine antagonist. 58. A method of treating a subject for a disease or a disorder by administering the binding protein of any one of claims 1-44 to the subject. 59. The method of claim 58, wherein the disorder is arthritis, osteoarthritis, juvenile chronic
arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis,
spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch- Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, chlamydia, yersinia and salmonella associated arthropathy, spondyloarthopathy, atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free Disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired Immunodeficiency Syndrome, Acquired Immunodeficiency Related Diseases, Hepatitis B, Hepatitis C, common varied immunodeficiency (common variable
hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post- inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease,
dermatomyositis/polymyositis associated lung disease, Sjögren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycaemia, type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS,
glomerulonephritides, microscopic vasulitis of the kidneys, lyme disease, discoid lupus erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjörgren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, cholestasis, idiosyncratic liver disease, Drug-Induced hepatitis, Non-alcoholic Steatohepatitis, allergy and asthma, group B streptococci (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Th1 Type mediated diseases, acute and chronic pain (different forms of pain), and cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma) abetalipoproteinemia, Acrocyanosis, acute and chronic parasitic or infectious processes, acute leukemia, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinomas, aerial ectopic beats, AIDS dementia complex, alcohol-induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-l- antitrypsin deficiency, amyotrophic lateral sclerosis, anemia, angina pectoris, anterior horn cell degeneration, anti cd3 therapy, antiphospholipid syndrome, anti-receptor hypersensitivity reactions, aordic and peripheral aneuryisms, aortic dissection, arterial hypertension, arteriosclerosis, arteriovenous fistula, ataxia, atrial fibrillation (sustained or paroxysmal), atrial flutter, atrioventricular block, B cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt's lymphoma, burns, cardiac arrhythmias, cardiac stun syndrome, cardiac tumors,
cardiomyopathy, cardiopulmonary bypass inflammation response, cartilage transplant rejection, cerebellar cortical degenerations, cerebellar disorders, chaotic or multifocal atrial tachycardia, chemotherapy associated disorders, chronic myelocytic leukemia (CML), chronic alcoholism, chronic inflammatory pathologies, chronic lymphocytic leukemia (CLL), chronic obstructive pulmonary disease (COPD), chronic salicylate intoxication, colorectal carcinoma, congestive heart failure, conjunctivitis, contact dermatitis, cor pulmonale, coronary artery disease, Creutzfeldt-Jakob disease, culture negative sepsis, cystic fibrosis, cytokine therapy associated disorders, Dementia pugilistica, demyelinating diseases, dengue hemorrhagic fever, dermatitis, dermatologic conditions, diabetes, diabetes mellitus, diabetic ateriosclerotic disease, Diffuse Lewy body disease, dilated congestive cardiomyopathy, disorders of the basal ganglia, Down's Syndrome in middle age, drug- induced movement disorders induced by drugs which block CNS dopamine receptors, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottitis, epstein-barr virus infection, erythromelalgia, extrapyramidal and cerebellar disorders, familial hematophagocytic lymphohistiocytosis, fetal thymus implant rejection, Friedreich's ataxia, functional peripheral arterial disorders, fungal sepsis, gas gangrene, gastric ulcer, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallerrorden-Spatz disease, hashimoto's thyroiditis, hay fever, heart transplant rejection, hemachromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic thrombocytopenic purpura, hemorrhage, hepatitis A, His bundle arryhthmias, HIV infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders, hypersensitity reactions,
hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic- pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, Asthenia, infantile spinal muscular atrophy, inflammation of the aorta, influenza a, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia- reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection,
lymphederma, malaria, malignamt Lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic/idiopathic, migraine headache, mitochondrial multi.system disorder, mixed connective tissue disease, monoclonal gammopathy, multiple myeloma, multiple systems degenerations (Mencel Dejerine- Thomas Shy-Drager and Machado-Joseph), myasthenia gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodyplastic syndrome, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic I muscular atrophies , neutropenic fever, non- hodgkins lymphoma, occlusion of the abdominal aorta and its branches, occulsive arterial disorders, okt3 therapy,
orchitis/epidydimitis, orchitis/vasectomy reversal procedures, organomegaly, osteoporosis, pancreas transplant rejection, pancreatic carcinoma, paraneoplastic syndrome/hypercalcemia of malignancy, parathyroid transplant rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherlosclerotic disease, peripheral vascular disorders, peritonitis, pernicious anemia, pneumocystis carinii pneumonia, pneumonia, POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal gammopathy, and skin changes syndrome), post perfusion syndrome, post pump syndrome, post-MI cardiotomy syndrome, preeclampsia, Progressive supranucleo Palsy, primary pulmonary hypertension, radiation therapy, Raynaud's phenomenon and disease, Raynoud's disease, Refsum's disease, regular narrow QRS tachycardia, renovascular hypertension, reperfusion injury, restrictive cardiomyopathy, sarcomas, scleroderma, senile chorea, Senile Dementia of Lewy body type, seronegative arthropathies, shock, sickle cell anemia, skin allograft rejection, skin changes syndrome, small bowel transplant rejection, solid tumors, specific arrythmias, spinal ataxia, spinocerebellar degenerations, streptococcal myositis, structural lesions of the cerebellum, Subacute sclerosing panencephalitis, Syncope, syphilis of the cardiovascular system, systemic anaphalaxis, systemic inflammatory response syndrome, systemic onset juvenile rheumatoid arthritis, T-cell or FAB ALL, Telangiectasia, thromboangitis obliterans, thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, ,vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital-associated hemaphagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still’s disease, anaphylaxis, anti-phospholipid antibody syndrome, aplastic anemia, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic ischemia, cicatricial pemphigoid, clinically isolated syndrome (cis) with risk for multiple sclerosis, childhood onset psychiatric disorder, dacryocystitis, dermatomyositis, diabetic retinopathy, disk herniation, disk prolaps, drug induced immune hemolytic anemia, endometriosis, endophthalmitis, episcleritis, erythema multiforme, erythema multiforme major, gestational pemphigoid, Guillain-Barré syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson’s disease, idiopathic interstitial pneumonia, IgE-mediated allergy, immune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, IPF/UIP, iritis, keratitis, keratoconjunctivitis sicca, Kussmaul disease or Kussmaul- Meier disease, Landry's paralysis, Langerhan's cell histiocytosis, livedo reticularis, macular degeneration, microscopic polyangiitis, morbus bechterev, motor neuron disorders, mucous membrane pemphigoid, multiple organ failure, myelodysplastic syndrome, myocarditis, nerve root disorders, neuropathy, non-A non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, pauciarticular JRA, peripheral artery occlusive disease (PAOD), peripheral vascular disease (PVD), peripheral artery, disease (PAD), phlebitis, polyarteritis nodosa (or periarteritis nodosa), polychondritis, polymyalgia rheumatica, poliosis, polyarticular JRA, polyendocrine deficiency syndrome, polymyositis, post-pump syndrome, primary Parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), prostatitis, pure red cell aplasia, primary adrenal insufficiency, recurrent neuromyelitis optica, restenosis, rheumatic heart disease, sapho (synovitis, acne, pustulosis, hyperostosis, and osteitis), scleroderma, secondary amyloidosis, shock lung, scleritis, sciatica, secondary adrenal insufficiency, silicone associated connective tissue disease, sneddon-wilkinson dermatosis, spondilitis ankylosans, Stevens-Johnson syndrome (SJS), systemic inflammatory response syndrome, temporal arteritis, toxoplasmic retinitis, toxic epidermal necrolysis, transverse myelitis, TRAPS (tumor necrosis factor receptor, type 1 allergic reaction, type II diabetes, usual interstitial pneumonia (UIP), vernal conjunctivitis, viral retinitis, Vogt-Koyanagi- Harada syndrome (VKH syndrome), wet macular degeneration, wound healing, age related macular degeneration (AMD), diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, exudative AMD, iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal
neovascularization, vitreal neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, or an inflammatory disease of the eye. 60. The method of claim 58 or 59, wherein the disorder is
a. an autoimmune disorder, asthma, macular degeneration, keratoconjunctivitis sicca, blepharitis, keratitis, ocular inflammation, age-related macular degeneration, Crohn's disease, ulcerative colitis, inflammatory bowel disease (IBD), insulin dependent diabetes mellitus, rheumatoid arthritis, osteoarthritis, systemic lupus erythematosus (SLE), multiple sclerosis, sepsis, a neurodegenerative disease, wet macular degeneration, dry macular degeneration, or an oncological disorder,
b. age related macular degeneration (AMD), wet AMD, dry AMD, vascular retinopathy, diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, exudative AMD, iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal neovascularization, vitreal neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, or inflammatory diseases of the eye, and/or
c. ocular inflammation, age related macular degeneration (AMD), wet ADM, dry AMD, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, cancer, colitis, or rheumatoid arthritis. 61. The method of any one of claims 58-60, wherein the binding protein is formulated for
parenteral, intravitreous, subcutaneous, intramuscular, intravenous, intrarticular,
intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal, or transdermal administration, and optionally wherein the binding protein is formulated for intravitreous administration, and optionally wherein the binding is administered intravitreously at a dose of about 0.1-5, or about 0.1-1, or about 0.1-0.3, or about 0.25 mg, and optionally wherein the administered binding protein has an ocular half-life of about 4.6 days. 62. Use of the binding protein of any one of claims 1-44 in the manufacture of a medicament for treating a subject for a disease or a disorder. 63. The use according to claim 62, wherein the disorder is arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis,
spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch- Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, chlamydia, yersinia and salmonella associated arthropathy, spondyloarthopathy, atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free Disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired Immunodeficiency Syndrome, Acquired Immunodeficiency Related Diseases, Hepatitis B, Hepatitis C, common varied immunodeficiency (common variable
hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post- inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease,
dermatomyositis/polymyositis associated lung disease, Sjögren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycaemia, type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS,
glomerulonephritides, microscopic vasulitis of the kidneys, lyme disease, discoid lupus erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjörgren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, cholestasis, idiosyncratic liver disease, Drug-Induced hepatitis, Non-alcoholic Steatohepatitis, allergy and asthma, group B streptococci (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Th1 Type mediated diseases, acute and chronic pain (different forms of pain), and cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma) abetalipoproteinemia, Acrocyanosis, acute and chronic parasitic or infectious processes, acute leukemia, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinomas, aerial ectopic beats, AIDS dementia complex, alcohol-induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-l- antitrypsin deficiency, amyotrophic lateral sclerosis, anemia, angina pectoris, anterior horn cell degeneration, anti cd3 therapy, antiphospholipid syndrome, anti-receptor hypersensitivity reactions, aordic and peripheral aneuryisms, aortic dissection, arterial hypertension, arteriosclerosis, arteriovenous fistula, ataxia, atrial fibrillation (sustained or paroxysmal), atrial flutter, atrioventricular block, B cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt's lymphoma, burns, cardiac arrhythmias, cardiac stun syndrome, cardiac tumors,
cardiomyopathy, cardiopulmonary bypass inflammation response, cartilage transplant rejection, cerebellar cortical degenerations, cerebellar disorders, chaotic or multifocal atrial tachycardia, chemotherapy associated disorders, chronic myelocytic leukemia (CML), chronic alcoholism, chronic inflammatory pathologies, chronic lymphocytic leukemia (CLL), chronic obstructive pulmonary disease (COPD), chronic salicylate intoxication, colorectal carcinoma, congestive heart failure, conjunctivitis, contact dermatitis, cor pulmonale, coronary artery disease, Creutzfeldt-Jakob disease, culture negative sepsis, cystic fibrosis, cytokine therapy associated disorders, Dementia pugilistica, demyelinating diseases, dengue hemorrhagic fever, dermatitis, dermatologic conditions, diabetes, diabetes mellitus, diabetic ateriosclerotic disease, Diffuse Lewy body disease, dilated congestive cardiomyopathy, disorders of the basal ganglia, Down's Syndrome in middle age, drug- induced movement disorders induced by drugs which block CNS dopamine receptors, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottitis, epstein-barr virus infection, erythromelalgia, extrapyramidal and cerebellar disorders, familial hematophagocytic lymphohistiocytosis, fetal thymus implant rejection, Friedreich's ataxia, functional peripheral arterial disorders, fungal sepsis, gas gangrene, gastric ulcer, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallerrorden-Spatz disease, hashimoto's thyroiditis, hay fever, heart transplant rejection, hemachromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic thrombocytopenic purpura, hemorrhage, hepatitis A, His bundle arryhthmias, HIV infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders, hypersensitity reactions,
hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic- pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, Asthenia, infantile spinal muscular atrophy, inflammation of the aorta, influenza a, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia- reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection,
lymphederma, malaria, malignamt Lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic/idiopathic, migraine headache, mitochondrial multi.system disorder, mixed connective tissue disease, monoclonal gammopathy, multiple myeloma, multiple systems degenerations (Mencel Dejerine- Thomas Shy-Drager and Machado-Joseph), myasthenia gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodyplastic syndrome, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic I muscular atrophies , neutropenic fever, non- hodgkins lymphoma, occlusion of the abdominal aorta and its branches, occulsive arterial disorders, okt3 therapy,
orchitis/epidydimitis, orchitis/vasectomy reversal procedures, organomegaly, osteoporosis, pancreas transplant rejection, pancreatic carcinoma, paraneoplastic syndrome/hypercalcemia of malignancy, parathyroid transplant rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherlosclerotic disease, peripheral vascular disorders, peritonitis, pernicious anemia, pneumocystis carinii pneumonia, pneumonia, POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal gammopathy, and skin changes syndrome), post perfusion syndrome, post pump syndrome, post-MI cardiotomy syndrome, preeclampsia, Progressive supranucleo Palsy, primary pulmonary hypertension, radiation therapy, Raynaud's phenomenon and disease, Raynoud's disease, Refsum's disease, regular narrow QRS tachycardia, renovascular hypertension, reperfusion injury, restrictive cardiomyopathy, sarcomas, scleroderma, senile chorea, Senile Dementia of Lewy body type, seronegative arthropathies, shock, sickle cell anemia, skin allograft rejection, skin changes syndrome, small bowel transplant rejection, solid tumors, specific arrythmias, spinal ataxia, spinocerebellar degenerations, streptococcal myositis, structural lesions of the cerebellum, Subacute sclerosing panencephalitis, Syncope, syphilis of the cardiovascular system, systemic anaphalaxis, systemic inflammatory response syndrome, systemic onset juvenile rheumatoid arthritis, T-cell or FAB ALL, Telangiectasia, thromboangitis obliterans, thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, ,vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital-associated hemaphagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still’s disease, anaphylaxis, anti-phospholipid antibody syndrome, aplastic anemia, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic ischemia, cicatricial pemphigoid, clinically isolated syndrome (cis) with risk for multiple sclerosis, childhood onset psychiatric disorder, dacryocystitis, dermatomyositis, diabetic retinopathy, disk herniation, disk prolaps, drug induced immune hemolytic anemia, endometriosis, endophthalmitis, episcleritis, erythema multiforme, erythema multiforme major, gestational pemphigoid, Guillain-Barré syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson’s disease, idiopathic interstitial pneumonia, IgE-mediated allergy, immune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, IPF/UIP, iritis, keratitis, keratoconjunctivitis sicca, Kussmaul disease or Kussmaul- Meier disease, Landry's paralysis, Langerhan's cell histiocytosis, livedo reticularis, macular degeneration, microscopic polyangiitis, morbus bechterev, motor neuron disorders, mucous membrane pemphigoid, multiple organ failure, myelodysplastic syndrome, myocarditis, nerve root disorders, neuropathy, non-A non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, pauciarticular JRA, peripheral artery occlusive disease (PAOD), peripheral vascular disease (PVD), peripheral artery, disease (PAD), phlebitis, polyarteritis nodosa (or periarteritis nodosa), polychondritis, polymyalgia rheumatica, poliosis, polyarticular JRA, polyendocrine deficiency syndrome, polymyositis, post-pump syndrome, primary Parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), prostatitis, pure red cell aplasia, primary adrenal insufficiency, recurrent neuromyelitis optica, restenosis, rheumatic heart disease, sapho (synovitis, acne, pustulosis, hyperostosis, and osteitis), scleroderma, secondary amyloidosis, shock lung, scleritis, sciatica, secondary adrenal insufficiency, silicone associated connective tissue disease, sneddon-wilkinson dermatosis, spondilitis ankylosans, Stevens-Johnson syndrome (SJS), systemic inflammatory response syndrome, temporal arteritis, toxoplasmic retinitis, toxic epidermal necrolysis, transverse myelitis, TRAPS (tumor necrosis factor receptor, type 1 allergic reaction, type II diabetes, usual interstitial pneumonia (UIP), vernal conjunctivitis, viral retinitis, Vogt-Koyanagi- Harada syndrome (VKH syndrome), wet macular degeneration, wound healing, age related macular degeneration (AMD), diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, exudative AMD, iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal
neovascularization, vitreal neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, or an inflammatory disease of the eye. 64. The use according to claim 62 or 63 wherein the disorder is
a. an autoimmune disorder, asthma, macular degeneration, keratoconjunctivitis sicca, blepharitis, keratitis, ocular inflammation, Crohn's disease, ulcerative colitis, inflammatory bowel disease (IBD), insulin dependent diabetes mellitus, rheumatoid arthritis, osteoarthritis, systemic lupus erythematosus (SLE), multiple sclerosis, sepsis, a neurodegenerative disease, wet macular degeneration, dry macular degeneration, or an oncological disorder, and/or b. age related macular degeneration (AMD), diabetic retinopathy, diabetic macular edema, central retinal vein occlusion, corneal neovascularization, exudative AMD, iris neovascularization, neovascular glaucoma, post-surgical fibrosis in glaucoma, proliferative vitreoretinopathy (PVR), choroidal neovascularization, optic disc neovascularization, retinal neovascularization, vitreal neovascularization, pannus, pterygium, macular edema, diabetic macular edema (DME), vascular retinopathy, retinal degeneration, uveitis, or an inflammatory disease of the eye. 65. The use according to any one of claims 62-64, wherein the binding protein is formulated for intravitreous, parenteral, subcutaneous, intravitreous, intramuscular, intravenous, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal, or transdermal administration, and optionally wherein the binding protein is formulated for intravitreous administration, and optionally wherein the binding is administered intravitreously at a dose of about 0.1-5, or about 0.1-1, or about 0.1-0.3, or about 0.25 mg, and optionally wherein the administered binding protein has an ocular half-life of about 4.6 days. 66. A method of detecting the presence, amount, or concentration of at least one target or
fragment thereof in a test sample by an immunoassay,
wherein the immunoassay comprises contacting the test sample with at least one binding protein and at least one detectable label, and
wherein the at least one binding protein comprises the binding protein of any one of claims 1-44. 67. The method of claim 66, further comprising:
(i) contacting the test sample with the at least one binding protein, wherein the binding protein binds to an epitope on the target or fragment thereof so as to form a first complex;
(ii) contacting the complex with the at least one detectable label, wherein the detectable label binds to the binding protein or an epitope on the target or fragment thereof that is not bound by the binding protein to form a second complex; and
(iii) detecting the presence, amount, or concentration of the target or fragment thereof in the test sample based on the signal generated by the detectable label in the second complex, wherein the presence, amount, or concentration of the target or fragment thereof is directly correlated with the signal generated by the detectable label.
68. The method of claim 66, further comprising:
(i) contacting the test sample with the at least one binding protein, wherein the binding protein binds to an epitope on the target or fragment thereof so as to form a first complex;
(ii) contacting the complex with the at least one detectable label, wherein the detectable label competes with the target or fragment thereof for binding to the binding protein so as to form a second complex; and
(iii) detecting the presence, amount, or concentration of the target or fragment thereof in the test sample based on the signal generated by the detectable label in the second complex, wherein the presence, amount, or concentration of the target or fragment thereof is indirectly correlated with the signal generated by the detectable label.
69. A kit for assaying a test sample for the presence, amount, or concentration of a target or fragment thereof in the sample, the kit comprising (a) instructions for assaying the test sample for the target or fragment thereof and (b) at least one binding protein comprising the binding protein of any one of claims 1-44. 70. A method of quantitating the conformational stability of a variable domain from any one of the binding proteins in claims 1-44 using differential scanning calorimetry (DSC), wherein the highest peak in a DSC thermogram is the midpoint of the unfolding transition or process of an antibody’s binding region (VH-VL) due to increasing temperature; and
the corresponding temperature of that highest peak is a quantitation of the stability of that region. 71. The method of claim 70, wherein the thermal stability of the VH-VL region of a parental antibody corresponds to the thermal stability of the binding domains incorporated into the DVD-Ig format. 72. The method of claim 70, wherein the temperature predicts the conformation stability of the DVD‐Ig outer variable domain (OVD) when the VH-VL region of the parental antibody is incorporated into the DVD‐Ig molecule as the outer variable domain. 73. The method of any one of claims 70-72, wherein the VH-VL region of the parental antibody is ranked for incorporation into the DVD-Ig format so as to maximize the stability of the DVD‐Ig molecule.
74. The method of any one of claims 70-73, wherein the conformational stability of a DVD‐Ig binding protein correlates with storage stability (shelf‐life) of the binding protein. 75. The method of claim 70, wherein the conformational stability of the DVD-Ig binding protein predicts other DVD-Ig binding proteins in terms of storage stability (shelf‐life). 76. An antibody or antigen binding fragment thereof capable of binding VEGF, wherein the antibody or antigen binding fragment comprises
Figure imgf000511_0001
Figure imgf000512_0001
Figure imgf000513_0001
77. The antibody or antigen binding fragment of claim 76, further comprising human framework sequences.
78. The antibody or antigen fragment of claim 76 or 77, wherein the antibody or antigen binding fragment comprises heavy chain CDRs 1-3 and light chain chain CDRs 1-3 having at least about 80%, 90%, 95%, or 99% homology to GYTFTNYGMY (CDR-H1),
WINTETGKPTYADDFKG (CDR-H2), TNYYYRSYIFYFDY (CDR-H3),
RASESVSTHMH (CDR-L1), GASNLES (CDR-L2), and QQSWNDPFT (CDR-L3).
79. The antibody or antigen fragment of any one of claims 76-78, wherein the antibody or antigen binding fragment comprises GYTFTNYGMY (CDR-H1), WINTETGKPTYADDFKG (CDR-H2), TNYYYRSYIFYFDY (CDR-H3), RASESVSTHMH (CDR-L1), GASNLES (CDR-L2), and QQSWNDPFT (CDR-L3).
80. An antibody or antigen binding fragment thereof capable of binding VEGF, wherein the antibody or antigen binding fragment comprises a CDR set comprising heavy chain CDRs 1-3 and light chain CDRs 1-3 having at least about 80%, 90%, 95%, or 99% homology to a CDR set selected from any of those in Tables A, 27 or 38-42.
81. The antibody or antigen binding fragment of claim 80, wherein the antibody or antigen
binding fragment comprises a CDR set comprising heavy chain CDRs 1-3 and light chain CDRs 1-3 selected from any of those in Tables A, 27 or 38-42.
82. The antibody or antigen binding fragment of claim 80 or 81, further comprising human
framework sequences.
83. The antibody or antigen binding fragment of claim 80, wherein the antibody or antigen
binding fragment comprises a heavy chain variable domain and paired light chain variable domain having at least about 80%, 90%, 95%, or 99% homology to any of the paired variable domains in Tables A, 27 or 38-42.
84. The antibody or antigen binding fragment of claim 80, wherein the antibody or antigen binding fragment comprises a heavy chain variable domain and paired light chain variable domain selected from any of the paired variable domains in Tables A, 27 or 38-42.
85. An antibody or antigen binding fragment thereof capable of binding PDGF, wherein the antibody or antigen binding fragment comprises
Figure imgf000514_0001
Figure imgf000515_0001
Figure imgf000516_0001
86. The antibody or antigen binding fragment of claim 85, further comprising human framework sequences.
87. The antibody or antigen fragment of claim 85 or 86, wherein the antibody or antigen binding fragment comprises heavy chain CDRs 1-3 and light chain CDRs 1-3 having at least about 80%, 90%, 95%, or 99% homology to GFSLSTYGMGVG (CDR-H1),
NIWWDDDKYYNPSLKN (CDR-H2), IESIGTTYSFDY (CDR-H3), ERSSGDIGDSYVS (CDR-L1), ADDQRPS (CDR-L2), and QSYDINIDIV (CDR-L3).
88. The antibody or antigen fragment of any one of claims 85-87, wherein the antibody or antigen binding fragment comprises GFSLSTYGMGVG (CDR-H1), NIWWDDDKYYNPSLKN (CDR-H2), IESIGTTYSFDY (CDR-H3), ERSSGDIGDSYVS (CDR-L1), ADDQRPS (CDR- L2), and QSYDINIDIV (CDR-L3).
89. An antibody or antigen binding fragment thereof capable of binding PDGF, wherein the antibody or antigen binding fragment comprises a CDR set comprising heavy chain CDRs 1-3 and light chain CDRs 1-3 having at least about 80%, 90%, 95%, or 99% homology to a CDR set selected from any of those in Tables A, 28 or 46-50.
90. The antibody or antigen binding fragment of claim 89, wherein the antibody or antigen
binding fragment comprises a CDR set comprising heavy chain CDRs 1-3 and light chain CDRs 1-3 selected from any of those in Tables A, 28 or 46-50.
91. The antibody or antigen binding fragment of claim 89 or 90, further comprising human
framework sequences.
92. The antibody or antigen binding fragment of claim 89, wherein the antibody or antigen
binding fragment comprises a heavy chain variable domain and paired light chain variable domain having at least about 80%, 90%, 95%, or 99% homology to any of the paired variable domains in Tables A, 28 or 46-50.
93. The antibody or antigen binding fragment of claim 89, wherein the antibody or antigen binding fragment comprises a heavy chain variable domain and paired light chain variable domain selected from any of the paired variable domains in Tables A, 28 or 46-50. 94. The antibody or antigen binding fragment of any one of claims 76-93, comprising an Fc
region from an IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, or IgD, or a variant thereof. 95. The antibody or antigen binding fragment of any one of claims 76-94, wherein the Fc region is a variant sequence Fc region.
96. The antibody or antigen binding fragment of any one of claims 76-95, wherein the antibody or antigen binding fragment comprises:
a) a heavy chain constant region comprising a human IgG1 heavy chain sequence modified by one or more amino acid changes, wherein the changes comprise substitution of leucines at positions 234 and 235 with alanines, and optionally also comprise a substitution of histidine at position 435 with alanine, wherein the amino acid positions are numbered using EU index numbering; and
(b) a light chain constant region comprising a human kappa light chain constant region sequence.
97. A binding protein comprising heavy and light chain variable domains forming a functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise:
Figure imgf000517_0001
Figure imgf000518_0001
Figure imgf000519_0001
98. The binding protein of claim 97, wherein the binding protein is also capable of binding
PDGF.
99. The binding protein of claim 98, wherein the binding protein comprises heavy and light chain variable domains that form a functional binding site for PDGF, comprising:
(i) a CDR-H1 comprising X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 (SEQ ID NO: >>), wherein
Figure imgf000519_0002
Figure imgf000520_0001
Figure imgf000521_0001
100. The binding protein of any one of claims 97-99, further comprising human framework sequences.
101. A binding protein comprising heavy and light chain variable domains forming a functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise:
Figure imgf000522_0001
Figure imgf000523_0001
Figure imgf000524_0001
Figure imgf000525_0001
Figure imgf000526_0001
104. The binding protein of any one of claims 101-103, further comprising human framework sequences.
105. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise a set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 27 or 38-42.
106. The binding protein of claim 105, wherein the variable domains that form a functional binding site for VEGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 27 or 38-42.
107. The binding protein of claim 105 or 106, wherein the binding protein is also capable of binding PDGF.
108. The binding protein of claim 107, wherein the binding protein comprises heavy and light chain variable domains forming a functional binding site for PDGF, and the variable domains that form the functional binding site for PDGF comprise a set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 28 or 46- 50.
109. The binding protein of claim 108, wherein the variable domains that form a functional target binding site for PDGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 28 or 46-50.
110. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise a set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 28 or 46-50.
111. The binding protein of claim 110, wherein the variable domains that form a functional binding site for PDGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 28 or 46-50.
112. The binding protein of claim 110 or 111, wherein the binding protein is also capable of binding VEGF.
113. The binding protein of claim 112, wherein the binding protein comprises heavy and light chain variable domains forming a functional binding site for VEGF, and the variable domains that form the functional binding site for VEGF comprise a set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of the CDR sets listed in Tables A, 27 or 38- 42.
114. The binding protein of claim 112 or 113, wherein the variable domains that form a
functional binding site for VEGF comprise a heavy chain and paired light chain selected from any of those listed in Tables A, 27 or 38-42.
115. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein
a. the variable domains that form a functional binding site for VEGF comprise:
CDRs 1-3 from SEQ ID NO: 17 and CDRs-1-3 from SEQ ID NO: 18,
CDRs 1-3 from SEQ ID NO: 19 and CDRs-1-3 from SEQ ID NO: 20,
CDRs 1-3 from SEQ ID NO: 21 and CDRs-1-3 from SEQ ID NO: 22,
CDRs 1-3 from SEQ ID NO: 23 and CDRs-1-3 from SEQ ID NO: 24,
CDRs 1-3 from SEQ ID NO: 25 and CDRs-1-3 from SEQ ID NO: 26,
CDRs 1-3 from SEQ ID NO: 27 and CDRs-1-3 from SEQ ID NO: 28,
CDRs 1-3 from SEQ ID NO: 29 and CDRs-1-3 from SEQ ID NO: 30,
CDRs 1-3 from SEQ ID NO: 31 and CDRs-1-3 from SEQ ID NO: 32,
CDRs 1-3 from SEQ ID NO: 33 and CDRs-1-3 from SEQ ID NO: 34,
CDRs 1-3 from SEQ ID NO: 35 and CDRs-1-3 from SEQ ID NO: 36, CDRs 1-3 from SEQ ID NO: 37 and CDRs-1-3 from SEQ ID NO: 38, CDRs 1-3 from SEQ ID NO: 39 and CDRs-1-3 from SEQ ID NO: 40, CDRs 1-3 from SEQ ID NO: 41 and CDRs-1-3 from SEQ ID NO: 42, or CDRs 1-3 from SEQ ID NO: 43 and CDRs-1-3 from SEQ ID NO: 44, and b. the variable domains that form a functional binding site for PDGF comprise:
CDRs 1-3 from SEQ ID NO: 1 and CDRs-1-3 from SEQ ID NO: 2,
CDRs 1-3 from SEQ ID NO: 3 and CDRs-1-3 from SEQ ID NO: 4,
CDRs 1-3 from SEQ ID NO: 5 and CDRs-1-3 from SEQ ID NO: 6,
CDRs 1-3 from SEQ ID NO: 7 and CDRs-1-3 from SEQ ID NO: 8,
CDRs 1-3 from SEQ ID NO: 9 and CDRs-1-3 from SEQ ID NO: 10,
CDRs 1-3 from SEQ ID NO: 11 and CDRs-1-3 from SEQ ID NO: 12, CDRs 1-3 from SEQ ID NO: 13 and CDRs-1-3 from SEQ ID NO: 14, CDRs 1-3 from SEQ ID NO: 15 and CDRs-1-3 from SEQ ID NO: 16, or CDRs 1-3 from SEQ ID NO: 211 and CDRs-1-3 from SEQ ID NO: 212.
116. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein
a. the variable domains that form a functional binding site for VEGF comprise a sequence selected from the group consisting of SEQ ID NO: 17-44 and b. the variable domains that form a functional binding site for PDGF comprise a sequence selected from the group consisting of SEQ ID NO: 1-16, 211, and 212. 117. The binding protein of any one of claims 115-116, wherein:
a. the variable domains that form a functional binding site for VEGF comprise:
SEQ ID NO: 17 and SEQ ID NO: 18,
SEQ ID NO: 19 and SEQ ID NO: 20,
SEQ ID NO: 21 and SEQ ID NO: 22,
SEQ ID NO: 23 and SEQ ID NO: 24,
SEQ ID NO: 25 and SEQ ID NO: 26,
SEQ ID NO: 27 and SEQ ID NO: 28,
SEQ ID NO: 29 and SEQ ID NO: 30,
SEQ ID NO: 31 and SEQ ID NO: 32,
SEQ ID NO: 33 and SEQ ID NO: 34,
SEQ ID NO: 35 and SEQ ID NO: 36,
SEQ ID NO: 37 and SEQ ID NO: 38,
SEQ ID NO: 39 and SEQ ID NO: 40, SEQ ID NO: 41 and SEQ ID NO: 42, or
SEQ ID NO: 43 and SEQ ID NO: 44, and
b. the variable domains that form a functional binding site for PDGF comprise:
SEQ ID NO: 1 and SEQ ID NO: 2,
SEQ ID NO: 3 and SEQ ID NO: 4,
SEQ ID NO: 5 and SEQ ID NO: 6,
SEQ ID NO: 7 and SEQ ID NO: 8,
SEQ ID NO: 9 and SEQ ID NO: 10,
SEQ ID NO: 11 and SEQ ID NO: 12,
SEQ ID NO: 13 and SEQ ID NO: 14,
SEQ ID NO: 15 and SEQ ID NO: 16, or
SEQ ID NO: 211 and SEQ ID NO: 212.
118. The binding protein of any one of claims 97-117, wherein the binding protein is an
antibody or an antigen binding fragment thereof, a monoclonal antibody, a humanized antibody, a human antibody, a bispecific antibody, a bispecific binding protein, a multispecific binding protein, a DVD-Ig binding protein, a CrossMab binding protein, a diabody, a tandem single-chain Fv molecule, a bispecific diabody, a single-chain diabody molecule, or a di-diabody.
119. The binding protein of claim 118, wherein the binding protein comprises PR-1610561 (comprising SEQ ID NOs: 131 and 132) or PR-1572102 (comprising SEQ ID NOs: 88 and 89) or PR-1572105 (comprising SEQ ID NOs: 94 and 95) or PR1611292 (comprising SEQ ID NOs: 141 and 142).
120. A binding protein that competes with a binding protein of any one of claims 1-44 for binding to one or more of VEGF, PDGF, a VEGF receptor, and a PDGF receptor.
121. A binding protein that competes with an antibody or antigen binding fragment of any one of claims 76-96 for binding to one or more of VEGF, PDGF, a VEGF receptor, and a PDGF receptor.
122. A binding protein that competes with a binding protein of any one of claims 97-119 for binding to one or more of VEGF, PDGF, a VEGF receptor, and a PDGF receptor.
123. A binding protein that binds to the same epitope of VEGF, PDGF, a VEGF receptor, and/or a PDGF receptor as a binding protein of any one of claims 1-44.
124. A binding protein that binds to the same epitope of VEGF, PDGF, a VEGF receptor, and/or a PDGF receptor as an antibody or antigen binding fragment of any one of claims 76- 96.
125. A binding protein that binds to the same epitope of VEGF, PDGF, a VEGF receptor, and/or a PDGF receptor as a binding protein of any one of claims 97-119.
126. The binding protein of any one of claims 120-125, wherein the binding is an antibody or an antigen binding fragment thereof, a monoclonal antibody, a humanized antibody, a human antibody, a bispecific antibody, a bispecific binding protein, a multispecific binding protein, a DVD-Ig binding protein, a CrossMab binding protein, a diabody, a tandem single-chain Fv molecule, a bispecific diabody, a single-chain diabody molecule, or a di-diabody.
127. An antibody or antigen binding fragment thereof comprising heavy and light chain
variable domains forming a functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36, or comprise SEQ ID NO: 35 and SEQ ID NO: 36.
128. An antibody or antigen binding fragment thereof comprising heavy and light chain
variable domains forming a functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18, or comprise SEQ ID NO: 17 and SEQ ID NO: 18.
129. An antibody or antigen binding fragment thereof comprising heavy and light chain
variable domains forming a functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40, or comprise SEQ ID NO: 39 and SEQ ID NO: 40.
130. An antibody or antigen binding fragment thereof comprising heavy and light chain
variable domains forming a functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2, or comprise SEQ ID NO: 1 and SEQ ID NO: 2.
131. An antibody or antigen binding fragment thereof comprising heavy and light chain
variable domains forming a functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16, or comprise SEQ ID NO: 15 and SEQ ID NO: 16.
132. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36.
133. The binding protein of claim 132, wherein the binding protein also comprises heavy and light chain variable domains forming a functional binding site for PDGF, and wherein the variable domains that form a functional binding site for PDGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50.
134. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18.
135. The binding protein of claim 134, wherein the binding protein also comprises heavy and light chain variable domains forming a functional binding site for PDGF, and wherein the variable domains that form a functional binding site for PDGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50.
136. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF, wherein the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40.
137. The binding protein of claim 136, wherein the binding protein also comprises heavy and light chain variable domains forming a functional binding site for PDGF, and wherein the variable domains that form a functional binding site for PDGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 1.4.1-1.4.7, 28, and 46-50.
138. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2.
139. The binding protein of claim 138, wherein the binding protein also comprises heavy and light chain variable domains forming a functional binding site for VEGF, and wherein the variable domains that form a functional binding site for VEGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1-2.4.9, 27, and 38-42.
140. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for PDGF, wherein the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16.
141. The binding protein of claim 140, wherein the binding protein also comprises heavy and light chain variable domains forming a functional binding site for VEGF, and wherein the variable domains that form a functional binding site for VEGF comprise a CDR set of heavy chain CDRs 1-3 and paired light chain CDRs 1-3 selected from any of Tables A, 2.4.1-2.4.9, 27, and 38-42.
142. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein: (a) the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 35 and CDRs 1-3 from SEQ ID NO: 36; and
(b) the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16.
143. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein:
(a) the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 17 and CDRs 1-3 from SEQ ID NO: 18; and
(b) the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 1 and CDRs 1-3 from SEQ ID NO: 2.
144. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein:
(a) the variable domains that form a functional binding site for VEGF comprise CDRs 1-3 from SEQ ID NO: 39 and CDRs 1-3 from SEQ ID NO: 40; and
(b) the variable domains that form a functional binding site for PDGF comprise CDRs 1-3 from SEQ ID NO: 15 and CDRs 1-3 from SEQ ID NO: 16.
145. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein:
(a) the variable domains that form a functional binding site for VEGF comprise SEQ ID NO: 35 and SEQ ID NO: 36; and
(b) the variable domains that form a functional binding site for PDGF comprise SEQ ID NO: 15 and SEQ ID NO: 16.
146. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein:
(a) the variable domains that form a functional binding site for VEGF comprise SEQ ID NO: 17 and SEQ ID NO: 18; and
(b) the variable domains that form a functional binding site for PDGF comprise SEQ ID NO: 1 and SEQ ID NO: 2.
147. A binding protein comprising heavy and light chain variable domains forming a
functional binding site for VEGF and heavy and light chain variable domains forming a functional binding site for PDGF, wherein:
(a) the variable domains that form a functional binding site for VEGF comprise SEQ ID NO: 39 and SEQ ID NO: 40; and Ĩb) the variable domains that form a functional binding site for PDGF comprise SEQ ID NO: 15 and SEQ ID NO: 16.
148. A binding protein capable of binding VEGF and PDGF, wherein the binding protein comprises a DVD-Ig heavy chain variable domain of SEQ ID NO: 131 and a DVD-Ig light chain variable domain of SEQ ID NO: 132.
149. A binding protein capable of binding VEGF and PDGF, wherein the binding protein comprises a DVD-Ig heavy chain variable domain of SEQ ID NO: 88 and a DVD-Ig light chain variable domain of SEQ ID NO: 89.
150. A binding protein capable of binding VEGF and PDGF, wherein the binding protein comprises a DVD-Ig heavy chain variable domain of SEQ ID NO: 94 and a DVD-Ig light chain variable domain of SEQ ID NO: 95.
151. A binding protein capable of binding VEGF and PDGF, wherein the binding protein comprises a DVD-Ig heavy chain variable domain of SEQ ID NO: 141 and a DVD-Ig light chain variable domain of SEQ ID NO: 142.
152. A binding protein capable of binding VEGF and PDGF, comprising SEQ ID NO: 131 and SEQ ID NO: 132.
153. A binding protein capable of binding VEGF and PDGF, comprising SEQ ID NO: 88 and SEQ ID NO: 89.
154. A binding protein capable of binding VEGF and PDGF, comprising SEQ ID NO: 94 and SEQ ID NO: 95.
155. A binding protein capable of binding VEGF and PDGF, comprising SEQ ID NO: 141 and SEQ ID NO: 142.
PCT/US2016/037710 2015-06-15 2016-06-15 Binding proteins against vegf, pdgf, and/or their receptors Ceased WO2016205427A2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562175546P 2015-06-15 2015-06-15
US62/175,546 2015-06-15
US201662291964P 2016-02-05 2016-02-05
US62/291,964 2016-02-05

Publications (2)

Publication Number Publication Date
WO2016205427A2 true WO2016205427A2 (en) 2016-12-22
WO2016205427A3 WO2016205427A3 (en) 2017-02-09

Family

ID=56297111

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/037710 Ceased WO2016205427A2 (en) 2015-06-15 2016-06-15 Binding proteins against vegf, pdgf, and/or their receptors

Country Status (4)

Country Link
US (1) US9840554B2 (en)
TW (1) TW201710286A (en)
UY (1) UY36731A (en)
WO (1) WO2016205427A2 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017119435A1 (en) * 2016-01-06 2017-07-13 株式会社オーダーメードメディカルリサーチ High-affinity anti-vegf antibody
WO2018119474A3 (en) * 2016-12-23 2018-08-09 Remd Biotherapeutics, Inc. Immunotherapy using antibodies that bind programmed death 1 (pd-1)
CN110381999A (en) * 2017-01-06 2019-10-25 埃尔萨里斯生物技术公司 In conjunction with the compound and application thereof of people CD160
US11008387B2 (en) 2016-01-06 2021-05-18 Order-Made Medical Research Inc. Antibody inhibiting binding of VEGF to NRP1
US20230295346A1 (en) * 2017-08-16 2023-09-21 Bristol -Myers Squibb Company Prodruggable antibodies, prodrugs thereof, and methods of use and making
EP4158034A4 (en) * 2020-06-02 2024-07-03 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. GENETICALLY MODIFIED NON-HUMAN ANIMALS HAVING A LIGHT-CHAIN IMMUNOGLOBULIN LOCUS
WO2024185721A1 (en) * 2023-03-03 2024-09-12 Karydo TherapeutiX株式会社 Antibody or antigen-binding fragment thereof

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
EP3448874A4 (en) 2016-04-29 2020-04-22 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11939385B2 (en) 2017-05-16 2024-03-26 ALX Oncology Inc. Activatable antibodies and methods of use thereof
CR20190550A (en) * 2017-06-05 2020-04-05 Janssen Biotech Inc ANTIBODIES THAT SPECIFICALLY BIND PD-1 AND METHODS OF USE
WO2019173334A1 (en) * 2018-03-05 2019-09-12 The Schepens Eye Research Institute, Inc. Engineered vegf variants for retinal neuroprotection, promotion of axon growth and axon regeneration
JP7547350B2 (en) 2019-01-22 2024-09-09 クレムソン・ユニバーシティ・リサーチ・ファウンデーション Anti-elastin antibodies and methods of use
CN113939541A (en) * 2019-05-15 2022-01-14 科马布有限公司 Improved lambda antibodies
CN112513097B (en) * 2019-07-11 2021-10-29 武汉友芝友生物制药有限公司 tetravalent symmetric bispecific antibody
WO2022133318A2 (en) * 2020-12-18 2022-06-23 Single Cell Technology, Inc. Anti-sars corona virus-2 nucleocapsid protein antibodies

Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5006309A (en) 1988-04-22 1991-04-09 Abbott Laboratories Immunoassay device with liquid transfer between wells by washing
US5063081A (en) 1988-11-14 1991-11-05 I-Stat Corporation Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor
US5089424A (en) 1988-06-14 1992-02-18 Abbott Laboratories Method and apparatus for heterogeneous chemiluminescence assay
US5294404A (en) 1991-06-03 1994-03-15 Abbott Laboratories Reagent pack for immunoassays
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
WO2001077342A1 (en) 2000-04-11 2001-10-18 Genentech, Inc. Multivalent antibodies and uses therefor
US20040018577A1 (en) 2002-07-29 2004-01-29 Emerson Campbell John Lewis Multiple hybrid immunoassay
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
US7070959B1 (en) 1999-06-08 2006-07-04 Regeneron Pharmaceuticals, Inc. Modified chimeric polypeptides with improved pharmacokinetic properties
US7169901B2 (en) 1997-04-07 2007-01-30 Genentech, Inc. Anti-VEGF antibodies
US7262028B2 (en) 2002-07-18 2007-08-28 Crucell Holland B.V. Recombinant production of mixtures of antibodies
US7419821B2 (en) 2002-03-05 2008-09-02 I-Stat Corporation Apparatus and methods for analyte measurement and immunoassay
US20090311253A1 (en) 2008-06-03 2009-12-17 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
US7682833B2 (en) 2003-09-10 2010-03-23 Abbott Point Of Care Inc. Immunoassay device with improved sample closure
US7723099B2 (en) 2003-09-10 2010-05-25 Abbott Point Of Care Inc. Immunoassay device with immuno-reference electrode
US8187836B2 (en) 2008-01-15 2012-05-29 Abbott Laboratories Mammalian expression vectors and uses thereof

Family Cites Families (379)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CU22545A1 (en) 1994-11-18 1999-03-31 Centro Inmunologia Molecular OBTAINING A CHEMICAL AND HUMANIZED ANTIBODY AGAINST THE RECEPTOR OF THE EPIDERMAL GROWTH FACTOR FOR DIAGNOSTIC AND THERAPEUTIC USE
EP0092918B1 (en) 1982-04-22 1988-10-19 Imperial Chemical Industries Plc Continuous release formulations
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
FR2556739A1 (en) 1983-12-19 1985-06-21 Pasteur Institut CELL LINES SECRETING MONOCLONAL ANTIBODIES AGAINST PG E2, PREPARATION THEREOF, ANTIBODIES OBTAINED AND THEIR APPLICATION
US4753894A (en) 1984-02-08 1988-06-28 Cetus Corporation Monoclonal anti-human breast cancer antibodies
US4943533A (en) 1984-03-01 1990-07-24 The Regents Of The University Of California Hybrid cell lines that produce monoclonal antibodies to epidermal growth factor receptor
US5128326A (en) 1984-12-06 1992-07-07 Biomatrix, Inc. Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same
US6492107B1 (en) 1986-11-20 2002-12-10 Stuart Kauffman Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
DE229046T1 (en) 1985-03-30 1987-12-17 Marc Genf/Geneve Ballivet METHOD FOR OBTAINING DNA, RNS, PEPTIDES, POLYPEPTIDES OR PROTEINS BY DNA RECOMBINANT METHOD.
ATE71934T1 (en) 1985-06-07 1992-02-15 Ici America Inc SELECTED DIFLUOROUS COMPOUNDS.
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
US5618920A (en) 1985-11-01 1997-04-08 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US4699784A (en) 1986-02-25 1987-10-13 Center For Molecular Medicine & Immunology Tumoricidal methotrexate-antibody conjugate
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
JP3040121B2 (en) 1988-01-12 2000-05-08 ジェネンテク,インコーポレイテッド Methods of treating tumor cells by inhibiting growth factor receptor function
EP0436597B1 (en) 1988-09-02 1997-04-02 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
AU643427B2 (en) 1988-10-31 1993-11-18 Immunex Corporation Interleukin-4 receptors
EP0368684B2 (en) 1988-11-11 2004-09-29 Medical Research Council Cloning immunoglobulin variable domain sequences.
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
AU652539B2 (en) 1989-05-16 1994-09-01 Medical Research Council Co-expression of heteromeric receptors
CA2016842A1 (en) 1989-05-16 1990-11-16 Richard A. Lerner Method for tapping the immunological repertoire
CA2016841C (en) 1989-05-16 1999-09-21 William D. Huse A method for producing polymers having a preselected activity
AU6430190A (en) 1989-10-10 1991-05-16 Pitman-Moore, Inc. Sustained release composition for macromolecular proteins
CA2071867A1 (en) 1989-11-06 1991-05-07 Edith Mathiowitz Method for producing protein microspheres
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5780225A (en) 1990-01-12 1998-07-14 Stratagene Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules
AU7247191A (en) 1990-01-11 1991-08-05 Molecular Affinities Corporation Production of antibodies using gene libraries
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
DE69120146T2 (en) 1990-01-12 1996-12-12 Cell Genesys Inc GENERATION OF XENOGENIC ANTIBODIES
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
AT396939B (en) 1990-05-29 1993-12-27 Alois Dipl Ing Dr Jungbauer COMPLEX VIRAL ANTIQUE OF HIV-1 BINDING RECOMBINANT PROTEIN
DK0585287T3 (en) 1990-07-10 2000-04-17 Cambridge Antibody Tech Process for producing specific binding pair elements
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
CA2090126C (en) 1990-08-02 2002-10-22 John W. Schrader Methods for the production of proteins with a desired function
JP3306063B2 (en) 1990-08-24 2002-07-24 イグジス, インコーポレイテッド Method for synthesizing oligonucleotides having random codons
US5698426A (en) 1990-09-28 1997-12-16 Ixsys, Incorporated Surface expression libraries of heteromeric receptors
US5780279A (en) 1990-12-03 1998-07-14 Genentech, Inc. Method of selection of proteolytic cleavage sites by directed evolution and phagemid display
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
JP3298879B2 (en) 1990-12-20 2002-07-08 イグジス,インコーポレイテッド Optimization of binding proteins
EP1820858B1 (en) 1991-03-01 2009-08-12 Dyax Corporation Chimeric protein comprising micro-protein having two or more disulfide bonds and embodiments thereof
CA2082160C (en) 1991-03-06 2003-05-06 Mary M. Bendig Humanised and chimeric monoclonal antibodies
US6277969B1 (en) 1991-03-18 2001-08-21 New York University Anti-TNF antibodies and peptides of human tumor necrosis factor
EP1857553A1 (en) 1991-03-18 2007-11-21 New York University Monoclonal and chimeric antibodies specific for human tumor necrosis factor
US5656272A (en) 1991-03-18 1997-08-12 New York University Medical Center Methods of treating TNF-α-mediated Crohn's disease using chimeric anti-TNF antibodies
ATE414768T1 (en) 1991-04-10 2008-12-15 Scripps Research Inst LIBRARIES OF HETERODIMER RECEPTORS USING PHAGEMIDS
US5795965A (en) 1991-04-25 1998-08-18 Chugai Seiyaku Kabushiki Kaisha Reshaped human to human interleukin-6 receptor
CA2109528A1 (en) 1991-05-01 1992-11-02 Gregory A. Prince A method for treating infectious respiratory diseases
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
DE4118120A1 (en) 1991-06-03 1992-12-10 Behringwerke Ag TETRAVALENT BISPECIFIC RECEPTORS, THEIR PRODUCTION AND USE
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
WO1992022324A1 (en) 1991-06-14 1992-12-23 Xoma Corporation Microbially-produced antibody fragments and their conjugates
DE4122599C2 (en) 1991-07-08 1993-11-11 Deutsches Krebsforsch Phagemid for screening antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
EP0605522B1 (en) 1991-09-23 1999-06-23 Medical Research Council Methods for the production of humanized antibodies
ATE207080T1 (en) 1991-11-25 2001-11-15 Enzon Inc MULTIVALENT ANTIGEN-BINDING PROTEINS
PT1024191E (en) 1991-12-02 2008-12-22 Medical Res Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
EP0571613B1 (en) 1991-12-13 2003-09-17 Xoma Corporation Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5912015A (en) 1992-03-12 1999-06-15 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
ES2301158T3 (en) 1992-07-24 2008-06-16 Amgen Fremont Inc. XENOGENIC ANTIBODY PRODUCTION.
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5736137A (en) 1992-11-13 1998-04-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
DK0752248T3 (en) 1992-11-13 2000-11-13 Idec Pharma Corp Therapeutic use of chimeric and radiolabeled antibodies against human B lymphocyte restricted differentiation antibody
US5934272A (en) 1993-01-29 1999-08-10 Aradigm Corporation Device and method of creating aerosolized mist of respiratory drug
AU6132994A (en) 1993-02-02 1994-08-29 Scripps Research Institute, The Methods for producing antibody libraries using universal or randomized immunoglobulin light chains
US6491916B1 (en) 1994-06-01 2002-12-10 Tolerance Therapeutics, Inc. Methods and materials for modulation of the immunosuppresive activity and toxicity of monoclonal antibodies
WO1995001997A1 (en) 1993-07-09 1995-01-19 Smithkline Beecham Corporation RECOMBINANT AND HUMANIZED IL-1β ANTIBODIES FOR TREATMENT OF IL-1 MEDIATED INFLAMMATORY DISORDERS IN MAN
WO1995009917A1 (en) 1993-10-07 1995-04-13 The Regents Of The University Of California Genetically engineered bispecific tetravalent antibodies
EP0659766A1 (en) 1993-11-23 1995-06-28 Schering-Plough Human monoclonal antibodies against human cytokines and methods of making and using such antibodies
US5565352A (en) 1993-11-24 1996-10-15 Arch Development Corporation Deubiquitinating enzyme: compositions and methods
WO1995015982A2 (en) 1993-12-08 1995-06-15 Genzyme Corporation Process for generating specific antibodies
EP0733102A1 (en) 1993-12-10 1996-09-25 Abbott Laboratories Reagents and methods for the detection of methotrexate
GB9401182D0 (en) 1994-01-21 1994-03-16 Inst Of Cancer The Research Antibodies to EGF receptor and their antitumour effect
DE69534347T2 (en) 1994-01-31 2006-05-24 Trustees Of Boston University, Boston Libraries of polyclonal antibodies
ZA95960B (en) 1994-03-14 1995-10-10 Genetics Inst Use of interleukin-12 antagonists in the treatment of autoimmune diseases
PT699237E (en) 1994-03-17 2003-07-31 Merck Patent Gmbh ANTI-EGFR CHAIN FVS AND ANTI-EGFR ANTIBODIES
IL109632A (en) 1994-05-11 2007-03-08 Yeda Res & Dev Modulators of the function of tnf receptors
US5516637A (en) 1994-06-10 1996-05-14 Dade International Inc. Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage
DE69534530T2 (en) 1994-08-12 2006-07-06 Immunomedics, Inc. FOR B-CELL LYMPHOMA AND LEUKEMIA SPECIMEN IMMUNOCONJUGATES AND HUMAN ANTIBODIES
ATE252894T1 (en) 1995-01-05 2003-11-15 Univ Michigan SURFACE-MODIFIED NANOPARTICLES AND METHODS FOR THEIR PRODUCTION AND USE
GB9504344D0 (en) 1995-03-03 1995-04-19 Unilever Plc Antibody fragment production
US6091001A (en) 1995-03-29 2000-07-18 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
US6130364A (en) 1995-03-29 2000-10-10 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US6019968A (en) 1995-04-14 2000-02-01 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
AU705616B2 (en) 1995-04-21 1999-05-27 Cell Genesys, Inc. Generation of large genomic DNA deletions
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
JPH11507535A (en) 1995-06-07 1999-07-06 イムクローン システムズ インコーポレイテッド Antibodies and antibody fragments that suppress tumor growth
US7060808B1 (en) 1995-06-07 2006-06-13 Imclone Systems Incorporated Humanized anti-EGF receptor monoclonal antibody
WO1997007788A2 (en) 1995-08-31 1997-03-06 Alkermes Controlled Therapeutics, Inc. Composition for sustained release of an agent
BR9606706A (en) 1995-10-16 1999-04-06 Unilever Nv Bispecific or bivalent antibody fragment analog use process to produce the same
US6090382A (en) 1996-02-09 2000-07-18 Basf Aktiengesellschaft Human antibodies that bind human TNFα
US6331431B1 (en) 1995-11-28 2001-12-18 Ixsys, Inc. Vacuum device and method for isolating periplasmic fraction from cells
JP2978435B2 (en) 1996-01-24 1999-11-15 チッソ株式会社 Method for producing acryloxypropyl silane
MX336813B (en) 1996-02-09 2016-02-02 Abbvie Biotechnology Ltd Human antibodies that bind human tnf alpha.
ATE508733T1 (en) 1996-03-04 2011-05-15 Penn State Res Found MATERIALS AND METHODS FOR INCREASE CELLULAR INTERNALIZATION
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
NZ331688A (en) 1996-03-28 2000-02-28 Univ Johns Hopkins Soluble divalent and multivalent heterodimeric analogs of proteins
WO1997038102A1 (en) 1996-04-04 1997-10-16 Unilever Plc Multivalent and multispecific antigen-binding protein
US5874064A (en) 1996-05-24 1999-02-23 Massachusetts Institute Of Technology Aerodynamically light particles for pulmonary drug delivery
US5985309A (en) 1996-05-24 1999-11-16 Massachusetts Institute Of Technology Preparation of particles for inhalation
US5855913A (en) 1997-01-16 1999-01-05 Massachusetts Instite Of Technology Particles incorporating surfactants for pulmonary drug delivery
US6699658B1 (en) 1996-05-31 2004-03-02 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
US6986890B1 (en) 1996-11-21 2006-01-17 Kyowa Hakko Kogyo Co., Ltd. Anti-human VEGF receptor Flt-1 monoclonal antibody
US7258857B2 (en) 1996-11-22 2007-08-21 The Trustees Of Columbia University In The City Of New York Rage-related methods for treating inflammation
CA2722378C (en) 1996-12-03 2015-02-03 Amgen Fremont Inc. Human antibodies that bind tnf.alpha.
CA2277801C (en) 1997-01-16 2002-10-15 Massachusetts Institute Of Technology Preparation of particles for inhalation
ATE332368T1 (en) 1997-01-21 2006-07-15 Gen Hospital Corp SELECTION OF PROTEINS USING RNA-PROTEIN FUSIONS
US6057098A (en) 1997-04-04 2000-05-02 Biosite Diagnostics, Inc. Polyvalent display libraries
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
KR100816621B1 (en) 1997-04-07 2008-03-24 제넨테크, 인크. Anti-VEGF Antibodies
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
WO1999006834A2 (en) 1997-08-04 1999-02-11 Ixsys, Incorporated Methods for identifying ligand specific binding molecules
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
SE512663C2 (en) 1997-10-23 2000-04-17 Biogram Ab Active substance encapsulation process in a biodegradable polymer
DK1027439T3 (en) 1997-10-27 2010-05-10 Bac Ip Bv Multivalent antigen-binding proteins
US7179892B2 (en) 2000-12-06 2007-02-20 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
AU2978899A (en) 1998-03-03 1999-09-20 Abgenix, Inc. Cd147 binding molecules as therapeutics
US20020029391A1 (en) 1998-04-15 2002-03-07 Claude Geoffrey Davis Epitope-driven human antibody production and gene expression profiling
DK1071700T3 (en) 1998-04-20 2010-06-07 Glycart Biotechnology Ag Glycosylation modification of antibodies to enhance antibody-dependent cellular cytotoxicity
NZ507557A (en) 1998-05-06 2003-10-31 Genentech Inc Protein purification by ion exchange chromatography
WO1999066903A2 (en) 1998-06-24 1999-12-29 Advanced Inhalation Research, Inc. Large porous particles emitted from an inhaler
EP1105427A2 (en) 1998-08-17 2001-06-13 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
CZ302706B6 (en) 1998-12-23 2011-09-14 Pfizer Inc. Human monoclonal antibody, pharmaceutical composition containing thereof, cell line producing the antibody, isolated molecule encoding heavy or light chain of said antibody, host cell containing said isolated molecule and use of said antibody
PL209392B1 (en) 1999-01-15 2011-08-31 Genentech Inc Polypeptide variants with altered effector function
HUP0200575A3 (en) 1999-03-25 2004-11-29 Abbott Gmbh & Co Kg Human antibodies that bind human il-12 and methods for producing
CA2704600C (en) 1999-04-09 2016-10-25 Kyowa Kirin Co., Ltd. A method for producing antibodies with increased adcc activity
CN1119415C (en) 1999-06-04 2003-08-27 长春迈灵生物工程有限公司 Clone and expression of anti-CA125 bifunctional genetically engineered antibody
US6531580B1 (en) 1999-06-24 2003-03-11 Ixsys, Inc. Anti-αvβ3 recombinant human antibodies and nucleic acids encoding same
BR0012196A (en) 1999-06-25 2002-03-19 Genentech Inc Method of treating a tumor in mammals using maytansinoid conjugates and anti-erbb receptor antibody and industrialized article
AU1456101A (en) 1999-11-03 2001-05-14 Maxygen, Inc. Antibody diversity generation
CA2399148A1 (en) 2000-02-10 2001-08-16 Abbott Laboratories Antibodies that bind human interleukin-18 and methods of making and using
AU783679B2 (en) 2000-02-24 2005-11-24 Genentech Inc. Caspase activated prodrugs therapy
ATE419354T1 (en) 2000-02-25 2009-01-15 Us Gov Health & Human Serv SCFV MOLECULES AGAINST EGFRVIII WITH IMPROVED CYTOTOXICITY AND YIELD, IMMUNOTOXINS BASED THEREOF, AND METHODS OF USE THEREOF
US7094566B2 (en) 2000-03-16 2006-08-22 Amgen Inc., IL-17 receptor like molecules and uses thereof
US20040038339A1 (en) 2000-03-24 2004-02-26 Peter Kufer Multifunctional polypeptides comprising a binding site to an epitope of the nkg2d receptor complex
AU5943201A (en) 2000-05-03 2001-11-12 Amgen Inc Modified peptides as therapeutic agents
BR0110927A (en) 2000-05-19 2003-03-11 Scancell Ltd Antibody, nucleic acid, vector, cell, method of making an antibody, pharmaceutical composition, use of an antibody or nucleic acid, and method for treating or prophylaxis of cancer
ES2252261T3 (en) 2000-06-28 2006-05-16 Glycofi, Inc. METHODS TO PRODUCE MODIFIED GLICOPROTEINS.
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
KR100919593B1 (en) 2000-06-29 2009-09-29 아보트 러보러터리즈 Dual specificity antibodies and methods of making them and composition comprising them
CA2410551A1 (en) 2000-06-30 2002-01-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw (Vib) Heterodimeric fusion proteins
US20090081234A1 (en) 2000-08-07 2009-03-26 George Heavner Anti-tnf antibodies, compositions, methods and uses for treatment of depression and related conditions
UA81743C2 (en) 2000-08-07 2008-02-11 Центокор, Инк. HUMAN MONOCLONAL ANTIBODY WHICH SPECIFICALLY BINDS TUMOR NECROSIS FACTOR ALFA (TNFα), PHARMACEUTICAL MIXTURE CONTAINING THEREOF, AND METHOD FOR TREATING ARTHRITIS
GB0020685D0 (en) 2000-08-22 2000-10-11 Novartis Ag Organic compounds
CA2422881A1 (en) 2000-10-13 2002-04-18 Uab Research Foundation Human anti-epidermal growth factor receptor single-chain antibodies
ATE338124T1 (en) 2000-11-07 2006-09-15 Hope City CD19-SPECIFIC TARGETED IMMUNE CELLS
PE20020574A1 (en) 2000-12-06 2002-07-02 Wyeth Corp HUMANIZED ANTIBODIES THAT RECOGNIZE THE AMYLOID PEPTIDE BETA
US6818392B2 (en) 2000-12-06 2004-11-16 Abbott Laboratories Monoclonal antibodies to human immunodeficiency virus and uses thereof
KR20030074693A (en) 2000-12-28 2003-09-19 알투스 바이올로직스 인코포레이티드 Crystals of whole antibodies and fragments thereof and methods for making and using them
ME00502B (en) 2001-01-05 2011-10-10 Amgen Fremont Inc Antibodies to insulin-like growth factor i receptor
US7667004B2 (en) 2001-04-17 2010-02-23 Abmaxis, Inc. Humanized antibodies against vascular endothelial growth factor
US20100056762A1 (en) 2001-05-11 2010-03-04 Old Lloyd J Specific binding proteins and uses thereof
AU2002314825A1 (en) 2001-05-30 2002-12-09 Centocor, Inc. Anti-p40 immunoglobulin derived proteins, compositions, methods and uses
CA2975521A1 (en) 2001-05-30 2002-12-05 Genentech, Inc. Anti-ngf antibodies for the treatment of various disorders
CA2450285C (en) 2001-06-13 2016-08-02 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (egfr)
US20060073141A1 (en) 2001-06-28 2006-04-06 Domantis Limited Compositions and methods for treating inflammatory disorders
US20040241745A1 (en) 2001-07-31 2004-12-02 Tasuku Honjo Substance specific to pd-1
CA2451998A1 (en) 2001-08-17 2003-02-27 Eli Lilly And Company Anti-a.beta. antibodies
US7247304B2 (en) 2001-08-23 2007-07-24 Genmab A/S Methods of treating using anti-IL-15 antibodies
US20030226155A1 (en) 2001-08-30 2003-12-04 Biorexis Pharmaceutical Corporation Modified transferrin-antibody fusion proteins
US7241873B2 (en) 2001-09-25 2007-07-10 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Recombinant anti-osteopontin antibody and use thereof
DK2093286T3 (en) 2001-10-01 2013-05-13 Dyax Corp Multi-chain, eukaryotic display vectors and applications thereof
US7214660B2 (en) 2001-10-10 2007-05-08 Neose Technologies, Inc. Erythropoietin: remodeling and glycoconjugation of erythropoietin
CA2463879C (en) 2001-10-25 2012-12-04 Genentech, Inc. Glycoprotein compositions
AU2002346373A1 (en) 2001-11-09 2003-05-19 Idec Pharmaceuticals Corporation Anti-cd80 antibody having adcc activity for adcc mediated killing of b cell lymphoma cells alone or in combination with other therapies
PT2308888T (en) 2001-11-14 2017-05-03 Janssen Biotech Inc Anti-il-6 antibodies, compositions, methods and uses
US7452539B2 (en) 2001-12-19 2008-11-18 Genentech, Inc. Stabilizing polypeptides which have been exposed to urea
CA2473144C (en) 2002-02-05 2013-05-28 Genentech, Inc. Protein purification
WO2003068801A2 (en) 2002-02-11 2003-08-21 Genentech, Inc. Antibody variants with faster antigen association rates
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
WO2003086458A1 (en) 2002-04-12 2003-10-23 Medimmune, Inc. Recombinant anti-interleukin-9 antibodies
JP2006512891A (en) 2002-04-18 2006-04-20 ジェネンコー・インターナショナル・インク Production of functional antibodies in filamentous fungi
WO2003102132A2 (en) 2002-04-26 2003-12-11 Genetech, Inc. Non-affinity purification of proteins
US20030206898A1 (en) 2002-04-26 2003-11-06 Steven Fischkoff Use of anti-TNFalpha antibodies and another drug
AU2003231554A1 (en) 2002-04-30 2003-11-17 Kyowa Hakko Kogyo Co., Ltd. Antibody to human insulin-like growth factor
EP1506286B1 (en) 2002-05-24 2014-03-19 Merck Sharp & Dohme Corp. Neutralizing human anti-igfr antibody
US7241733B2 (en) 2002-06-28 2007-07-10 Centocor, Inc. Mammalian EPO mimetic CH1 deleted mimetibodies, compositions, methods and uses
US9321832B2 (en) 2002-06-28 2016-04-26 Domantis Limited Ligand
AU2003244817B2 (en) 2002-06-28 2010-08-26 Domantis Limited Antigen-binding immunoglobulin single variable domains and dual-specific constructs
US20040033228A1 (en) 2002-08-16 2004-02-19 Hans-Juergen Krause Formulation of human antibodies for treating TNF-alpha associated disorders
NZ542784A (en) 2002-08-19 2008-07-31 Astrazeneca Ab Antibodies directed to monocyte chemo-attractant protein-1 (MCP-1) and uses thereof
HUE033623T2 (en) 2002-09-11 2017-12-28 Genentech Inc Protein purification
US7820166B2 (en) 2002-10-11 2010-10-26 Micromet Ag Potent T cell modulating molecules
US7285269B2 (en) 2002-12-02 2007-10-23 Amgen Fremont, Inc. Antibodies directed to tumor necrosis factor
TWI335821B (en) 2002-12-16 2011-01-11 Genentech Inc Immunoglobulin variants and uses thereof
DK2270048T3 (en) 2002-12-24 2016-01-18 Rinat Neuroscience Corp Anti-NGF antibodies and methods for their use
US7569364B2 (en) 2002-12-24 2009-08-04 Pfizer Inc. Anti-NGF antibodies and methods using same
EP1585768A2 (en) 2003-01-23 2005-10-19 Genentech, Inc. Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture
JP3803790B2 (en) 2003-02-17 2006-08-02 株式会社東北テクノアーチ Novel diabody-type bispecific antibody
NZ542873A (en) 2003-03-05 2008-07-31 Halozyme Inc Soluble, neutral-active hyaluronidase activity glycoprotein (sHASEGP) that is produced with high yield in a mammalian expression system by introducing nucleic acids that lack a narrow region encoding amino acids in the carboxy terminus of the human PH20 cDNA
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
CA2524305C (en) 2003-05-01 2015-12-08 Imclone Systems Incorporated Fully human antibodies directed against the human insulin-like growth factor-1 receptor
JP2008501621A (en) 2003-05-31 2008-01-24 マイクロメット アクツィエン ゲゼルシャフト Pharmaceutical composition comprising a bispecific anti-CD3, anti-CD19 antibody construct for treating a B cell related disease
TWI476206B (en) 2003-07-18 2015-03-11 Amgen Inc a specific binding agent for hepatocyte growth factor
DK3095793T3 (en) 2003-07-28 2020-05-25 Genentech Inc Reduction of leaching of protein A during a protein A affinity chromatography
US20050026881A1 (en) 2003-07-31 2005-02-03 Robinson Cynthia B. Combination of dehydroepiandrosterone or dehydroepiandrosterone-sulfate with an anti-IgE antibody for treatment of asthma or chronic obstructive pulmonary disease
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US7662928B2 (en) 2003-08-08 2010-02-16 The Research Foundation Of State University Of New York Anti-FcRn antibodies for treatment of auto/allo immune conditions
WO2005035575A2 (en) 2003-08-22 2005-04-21 Medimmune, Inc. Humanization of antibodies
AU2004266159A1 (en) 2003-08-22 2005-03-03 Biogen Idec Ma Inc. Improved antibodies having altered effector function and methods for making the same
US20060134105A1 (en) 2004-10-21 2006-06-22 Xencor, Inc. IgG immunoglobulin variants with optimized effector function
JP2007526022A (en) 2003-10-24 2007-09-13 メドトロニック・インコーポレーテッド Techniques for treating neurological disorders by diminishing the production of pro-inflammatory mediators
US7968684B2 (en) 2003-11-12 2011-06-28 Abbott Laboratories IL-18 binding proteins
US7754500B2 (en) 2003-11-21 2010-07-13 Anp Technologies, Inc. Asymmetrically branched polymer conjugates and microarray assays
AU2004297616B2 (en) 2003-12-04 2008-12-18 Xencor, Inc. Methods of generating variant proteins with increased host string content and compositions thereof
US7235641B2 (en) 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
ITRM20030601A1 (en) 2003-12-24 2005-06-25 Lay Line Genomics Spa METHOD FOR THE HUMANIZATION OF HUMANIZED ANTIBODIES AND ANTIBODIES WITH IT OBTAINED.
US20080254033A1 (en) 2004-01-21 2008-10-16 Kristen Pierce Pharmaceutical Compositions Containing Antagonists to Lrp4, Lrp8 or Megalin for Treatment of Diseases
WO2005087812A1 (en) * 2004-03-05 2005-09-22 Ludwig Institute For Cancer Research Multivalent antibody materials and methods for vegf/pdgf family of growth factors
US7794713B2 (en) 2004-04-07 2010-09-14 Lpath, Inc. Compositions and methods for the treatment and prevention of hyperproliferative diseases
AU2005249360B2 (en) 2004-04-12 2011-07-21 Medimmune, Llc Anti-IL-9 antibody formulations and uses thereof
AU2005233387B2 (en) 2004-04-15 2011-05-26 Glycofi, Inc. Production of galactosylated glycoproteins in lower eukaryotes
CA2566647A1 (en) 2004-05-13 2005-12-22 Imclone Systems Incorporated Inhibition of macrophage-stimulating protein receptor (ron)
WO2006001965A2 (en) 2004-05-24 2006-01-05 Abgenix, Inc. Reducing the risk of human anti-human antibodies through v gene manipulation
CA2569509C (en) 2004-06-03 2014-08-12 Novimmune S.A. Anti-cd3 antibodies and methods of use thereof
EP1786918A4 (en) 2004-07-17 2009-02-11 Imclone Systems Inc Novel tetravalent bispecific antibody
WO2006015373A2 (en) 2004-08-04 2006-02-09 Amgen Inc Antibodies to dkk-1
CA2575402A1 (en) 2004-08-05 2006-02-09 Genentech, Inc. Humanized anti-cmet antagonists
GB0417487D0 (en) 2004-08-05 2004-09-08 Novartis Ag Organic compound
AU2005285347A1 (en) 2004-08-19 2006-03-23 Genentech, Inc. Polypeptide variants with altered effector function
GB0419424D0 (en) 2004-09-02 2004-10-06 Viragen Scotland Ltd Transgene optimisation
WO2006026759A2 (en) 2004-09-03 2006-03-09 Genentech, Inc. Humanized anti-beta7 antagonists and uses therefor
WO2006037604A1 (en) 2004-10-01 2006-04-13 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Novel antibodies directed to the mammalian eag1 ion channel protein
JO3000B1 (en) 2004-10-20 2016-09-05 Genentech Inc Antibody Formulations.
WO2006047350A2 (en) 2004-10-21 2006-05-04 Xencor, Inc. IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION
AU2005299716B2 (en) 2004-10-22 2012-09-06 Amgen Inc. Methods for refolding of recombinant antibodies
US20060253100A1 (en) 2004-10-22 2006-11-09 Medtronic, Inc. Systems and Methods to Treat Pain Locally
US7423128B2 (en) 2004-11-03 2008-09-09 Amgen Fremont Inc. Anti-properdin antibodies, and methods for making and using same
AU2005313971B2 (en) 2004-12-08 2011-10-13 Immunomedics, Inc. Methods and compositions for immunotherapy and detection of inflammatory and immune-dysregulatory disease, infectious disease, pathologic angiogenesis and cancer
CA2589017A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Amyloid beta antibodies for use in improving cognition
ZA200705695B (en) 2004-12-21 2009-02-25 Astrazeneca Ab Antibodies directed to angiopoietin-2 and uses thereof
EP2361933A3 (en) 2005-01-26 2012-05-02 Amgen Fremont Inc. Antibodies against interleukin-1 beta
HUE025945T2 (en) 2005-02-15 2016-07-28 Univ Duke Anti-cd19 antibodies and uses in oncology
US8048992B2 (en) 2005-02-28 2011-11-01 Institute For Antibodies Co., Ltd. Anti-IgSF4 antibody and utilization of the same
MX2007011735A (en) 2005-03-24 2008-03-14 Thrombogenics Nv Novel anti-plgf antibody.
CA2604032C (en) 2005-04-06 2017-08-22 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
EP1877075A4 (en) 2005-04-25 2008-07-30 Pfizer ANTIBODIES DIRECTED AGAINST MYOSTATIN
US7592429B2 (en) 2005-05-03 2009-09-22 Ucb Sa Sclerostin-binding antibody
EP1885755A4 (en) 2005-05-05 2009-07-29 Univ Duke TREATMENTS OF AUTOIMMUNE DISEASES BY ANTI-CD19 ANTIBODIES
CA2607697C (en) 2005-05-10 2015-01-06 Biogen Idec Ma Inc. Treating and evaluating inflammatory disorders
MEP35408A (en) 2005-05-27 2011-02-10 Biogen Idec Inc Tweak binding antibodies
WO2006130429A2 (en) 2005-05-27 2006-12-07 Biogen Idec Ma Inc. Treatment of cancer
ITRM20050290A1 (en) 2005-06-07 2006-12-08 Lay Line Genomics Spa USE OF MOLECULES ABLE TO INHIBIT THE BOND BETWEEN NGF AND ITS TRKA RECEPTOR AS AN EXTENDED EFFECT ANALGESICS.
CN101208429A (en) 2005-06-24 2008-06-25 诺维信公司 Lipase for pharmaceutical use
SI2452694T1 (en) 2005-06-30 2019-05-31 Janssen Biotech, Inc. Anti-IL-23 antibodies, compositions, methods and uses
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US20070041905A1 (en) 2005-08-19 2007-02-22 Hoffman Rebecca S Method of treating depression using a TNF-alpha antibody
US20090215992A1 (en) 2005-08-19 2009-08-27 Chengbin Wu Dual variable domain immunoglobulin and uses thereof
NZ612578A (en) 2005-08-19 2014-11-28 Abbvie Inc Dual variable domain immunoglobin and uses thereof
AU2006290433B2 (en) 2005-08-26 2012-06-07 Roche Glycart Ag Modified antigen binding molecules with altered cell signaling activity
US7906116B2 (en) 2005-09-01 2011-03-15 Parkash Gill Methods for using and identifying modulators of Delta-like 4
CA3008270A1 (en) 2005-09-21 2007-03-29 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
EP2230256A1 (en) 2005-09-23 2010-09-22 Walter Reed Army Institute of Research (WRAIR) Antibodies with simultaneous subsite specificities to protein and lipid epitopes
EP1940881B1 (en) 2005-10-11 2016-11-30 Amgen Research (Munich) GmbH Compositions comprising cross-species-specific antibodies and uses thereof
US20080299137A1 (en) 2005-10-28 2008-12-04 Novo Nordisk A/S Fusion Proteins That Bind Effector Lymphocytes And Target Cells
UA96139C2 (en) 2005-11-08 2011-10-10 Дженентек, Інк. Anti-neuropilin-1 (nrp1) antibody
TW200736277A (en) 2005-11-14 2007-10-01 Amgen Inc RANKL antibody-PTH/PTHrP chimeric molecules
EP1957541A2 (en) 2005-11-21 2008-08-20 Laboratoires Serono SA Compositions and methods of producing hybrid antigen binding molecules and uses thereof
US8691224B2 (en) 2005-11-30 2014-04-08 Abbvie Inc. Anti-Aβ globulomer 5F7 antibodies
DK1979001T3 (en) 2005-12-13 2012-07-16 Medimmune Ltd BINDING PROTEINS SPECIFIC TO INSULIN-LIKE GROWTH FACTORS AND APPLICATIONS THEREOF
AR056857A1 (en) 2005-12-30 2007-10-24 U3 Pharma Ag DIRECTED ANTIBODIES TO HER-3 (RECEIVER OF THE HUMAN EPIDERMAL GROWTH FACTOR-3) AND ITS USES
MX2008009494A (en) 2006-01-23 2009-01-07 Joseph P Errico Methods and compositions of targeted drug development.
BRPI0706788A2 (en) 2006-01-31 2011-04-05 Novartis Ag il-17 antagonist antibodies
US20070248599A1 (en) 2006-02-21 2007-10-25 Jordan Tang Treatment of alzheimer's disease with inhibitors of apoe binding to apoe receptor
CA2646508A1 (en) 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
WO2007109749A2 (en) 2006-03-21 2007-09-27 Wyeth Methods for preventing and treating amyloidogenic diseases
US20070232556A1 (en) 2006-03-31 2007-10-04 Montine Thomas J Methods and compositions for the treatment of neurological diseases and disorders
WO2007120651A2 (en) 2006-04-10 2007-10-25 Abbott Biotechnology Ltd. Uses and compositions for treatment of juvenile rheumatoid arthritis
KR20110079922A (en) 2006-04-14 2011-07-11 노파르티스 아게 Use of IL-1 Antibody for the Treatment of Ophthalmic Disorders
AR060487A1 (en) 2006-04-21 2008-06-18 Xoma Technology Ltd PHARMACEUTICAL COMPOSITIONS OF ANTI-BODY ANTAGONISTS ANTI-CD40
US20080118978A1 (en) 2006-04-28 2008-05-22 Takashi Sato Anti-tumor agent
CN101058609B (en) 2006-05-26 2011-04-13 神州细胞工程有限公司 Human antibody and expression thereof
AU2007254853B2 (en) 2006-06-02 2011-11-17 Aveo Pharmaceuticals, Inc. Hepatocyte growth factor (HGF) binding proteins
NZ572177A (en) 2006-06-06 2012-02-24 Genentech Inc Anti-dll4 antibodies and methods using same
EP2029159A2 (en) 2006-06-06 2009-03-04 Genentech, Inc. Compositions and methods for modulating vascular development
JP2009541275A (en) 2006-06-22 2009-11-26 ノボ・ノルデイスク・エー/エス Production of bispecific antibodies
WO2008005469A2 (en) 2006-06-30 2008-01-10 Schering Corporation Igfbp2 biomarker
EP2046833B9 (en) 2006-07-14 2014-02-19 AC Immune S.A. Humanized antibody against amyloid beta
PL2383297T3 (en) 2006-08-14 2013-06-28 Xencor Inc Optimized antibodies that target CD19
JP2010502224A (en) 2006-09-08 2010-01-28 アボット・ラボラトリーズ Interleukin-13 binding protein
DK2066694T3 (en) 2006-09-29 2016-02-08 Oncomed Pharm Inc Compositions and Methods for Diagnosing and Treating Cancer
ES2442258T3 (en) 2006-10-27 2014-02-10 Abbvie Biotechnology Ltd Anti-hTNF alpha crystalline antibodies
TW201716437A (en) 2006-11-02 2017-05-16 建南德克公司 Humanized anti-factor D antibodies and uses thereof
EP2120996A2 (en) 2006-12-20 2009-11-25 Vasgene Therapeutics, Inc. Methods for using and identifying modulators of delta-like 4
US7919594B2 (en) 2007-02-14 2011-04-05 Vaccinex, Inc. Human anti-CD100 antibodies
KR101598229B1 (en) 2007-02-16 2016-02-26 메리맥 파마슈티컬즈, 인크. Antibodies to ERBB3 and uses thereof
ME00832B (en) 2007-03-22 2012-03-20 Ucb Biopharma Sprl Binding proteins, including antibodies, antibody derivatives and antibody fragments, that specifically bind cd154 and uses thereof
AR066240A1 (en) 2007-04-23 2009-08-05 Wyeth Corp METHODS AND COMPOSITIONS TO TREAT AND MONITOR THE TREATMENT OF DISORDERS ASSOCIATED WITH IL-13
GB0708002D0 (en) 2007-04-25 2007-06-06 Univ Sheffield Antibodies
EP1997832A1 (en) 2007-05-29 2008-12-03 Ganymed Pharmaceuticals AG Monoclonal antibodies against Claudin-18 for treatment of cancer
ES2585702T3 (en) 2007-05-30 2016-10-07 Lpath, Inc Compositions and methods for lysophosphatidic acid binding
WO2009003142A1 (en) 2007-06-27 2008-12-31 The Board Of Trustees Of The Leland, Stanford Junior University Beta2-microglobulin and c reactive protein (crp) as biomarkers for peripheral artery disease
KR20100058509A (en) 2007-07-31 2010-06-03 메디뮨 엘엘씨 Multispecific epitope binding proteins and uses thereof
WO2009020654A1 (en) 2007-08-08 2009-02-12 Abbott Laboratories Compositions and methods for crystallizing antibodies
CA2696263C (en) 2007-08-15 2017-06-13 Bing Liu Monospecific and multispecific antibodies and method of use
EP2050764A1 (en) 2007-10-15 2009-04-22 sanofi-aventis Novel polyvalent bispecific antibody format and uses thereof
WO2009052400A1 (en) 2007-10-19 2009-04-23 Abbott Laboratories Antibodies that bind to mammalian ngal and uses thereof
BRPI0822049B1 (en) 2007-12-17 2021-11-16 Pfizer Limited PHARMACEUTICAL COMPOSITION COMPRISING ANTI-NGF ANTAGONIST ANTIBODY, KIT AND USE OF AN ANTINGF ANTIBODY
JP6157046B2 (en) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド Method for generating antibody Fc heterodimer molecules using electrostatic steering effect
US8962803B2 (en) 2008-02-29 2015-02-24 AbbVie Deutschland GmbH & Co. KG Antibodies against the RGM A protein and uses thereof
US20100260668A1 (en) 2008-04-29 2010-10-14 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
SG190572A1 (en) 2008-04-29 2013-06-28 Abbott Lab Dual variable domain immunoglobulins and uses thereof
EP2116556B1 (en) 2008-05-09 2016-03-23 AbbVie Deutschland GmbH & Co KG Antibodies to receptor of advanced glycation end products (RAGE) and uses thereof
TW201006485A (en) 2008-06-03 2010-02-16 Abbott Lab Dual variable domain immunoglobulins and uses thereof
US8741287B2 (en) 2008-06-18 2014-06-03 Abbott Laboratories PlGF-1 assay and kits and components thereof
CN102149825B (en) 2008-07-08 2015-07-22 Abbvie公司 Prostaglandin E2 dual variable domain immunoglobulins and uses thereof
TW201014602A (en) 2008-07-08 2010-04-16 Abbott Lab Prostaglandin E2 binding proteins and uses thereof
WO2010017103A2 (en) 2008-08-04 2010-02-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Fully human anti-human nkg2d monoclonal antibodies
KR20110076906A (en) 2008-09-30 2011-07-06 아보트 러보러터리즈 Improved RNA Display Method
US8268314B2 (en) 2008-10-08 2012-09-18 Hoffmann-La Roche Inc. Bispecific anti-VEGF/anti-ANG-2 antibodies
RU2011127198A (en) 2008-12-04 2013-01-10 Эбботт Лэборетриз IMMUNOGLOBULINS WITH DOUBLE VARIABLE DOMAINS AND THEIR APPLICATION
EP2396000A1 (en) 2009-02-11 2011-12-21 Bristol-Myers Squibb Company Combination vegfr2 therapy with temozolomide
TWI541021B (en) 2009-03-05 2016-07-11 艾伯維有限公司 Il-17 binding proteins
US20110008766A1 (en) 2009-05-01 2011-01-13 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
AR076508A1 (en) 2009-05-01 2011-06-15 Abbott Lab IMMUNOGLOBULIN WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
UY32808A (en) 2009-07-29 2011-02-28 Abbott Lab IMMUNOGLOBULINS AS A DUAL VARIABLE DOMAIN AND USES OF THE SAME
BR112012004546A8 (en) 2009-08-29 2017-12-05 Abbott Lab DLL4-BINDING PROTEIN THERAPEUTIC
WO2011028811A2 (en) 2009-09-01 2011-03-10 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
US20110172398A1 (en) 2009-10-02 2011-07-14 Boehringer Ingelheim International Gmbh Bispecific binding molecules for anti-angiogenesis therapy
BR112012008833A2 (en) 2009-10-15 2015-09-08 Abbott Lab double variable domain immunoglobulins and uses thereof
KR20120104542A (en) 2009-10-15 2012-09-21 아보트 러보러터리즈 Il-1 binding proteins
UY32979A (en) 2009-10-28 2011-02-28 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
WO2011084714A2 (en) 2009-12-17 2011-07-14 Biogen Idec Ma Inc. STABILIZED ANTI-TNF-ALPHA scFv MOLECULES OR ANTI-TWEAK scFv MOLECULES AND USES THEREOF
EP2525823A4 (en) 2010-01-22 2016-01-27 Hoffmann La Roche DELIVERY SYSTEM FOR DIAGNOSTIC AND THERAPEUTIC AGENTS
KR101853278B1 (en) 2010-03-02 2018-05-02 애브비 인코포레이티드 Therapeutic dll4 binding proteins
AR081246A1 (en) 2010-05-14 2012-07-18 Abbott Lab PROTEINS OF UNION TO IL-1
CA2803392A1 (en) 2010-06-24 2011-12-29 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
UY33492A (en) 2010-07-09 2012-01-31 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
EP3252072A3 (en) 2010-08-03 2018-03-14 AbbVie Inc. Dual variable domain immunoglobulins and uses thereof
JP2013539364A (en) 2010-08-26 2013-10-24 アッヴィ・インコーポレイテッド Dual variable domain immunoglobulins and uses thereof
MX2013004979A (en) 2010-11-02 2013-07-30 Abbott Lab Dual variable domain immunoglobulins and uses thereof.
UY33707A (en) 2010-11-04 2012-05-31 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
CA2818173C (en) 2010-11-30 2022-05-03 Genentech, Inc. Low affinity blood brain barrier receptor antibodies and uses therefor
PE20141060A1 (en) 2010-12-21 2014-09-26 Abbvie Inc IL-1 ALPHA AND BETA DUAL VARIABLE DOMAIN IMMUNOGLOBULINS AND THEIR USE
US20120201746A1 (en) 2010-12-22 2012-08-09 Abbott Laboratories Half immunoglobulin binding proteins and uses thereof
MX341578B (en) 2011-02-08 2016-08-25 Abbvie Inc Treatment of osteoarthritis and pain.
RU2013150331A (en) 2011-04-20 2015-05-27 Рош Гликарт Аг METHOD AND DEVICES FOR A pH-DEPENDENT PASSAGE OF A HEMATOENCEPHALIC BARRIER
LT3485903T (en) 2011-09-23 2023-02-27 Mereo Biopharma 5, Inc. Vegf/dll4 binding agents and uses thereof
RU2014121043A (en) 2011-10-24 2015-12-10 Эббви Инк. BISPECIFIC IMMUNO-BINDING AGENTS AIMED AGAINST TNF AND IL-17
HK1200322A1 (en) 2011-10-24 2015-08-07 Abbvie Inc. Immunobinders directed against sclerostin
PE20141545A1 (en) 2011-10-24 2014-11-26 Abbvie Inc IMMUNOBINDERS TARGETED AGAINST TNF
WO2013078135A2 (en) 2011-11-21 2013-05-30 Abbott Laboratories Il-1 binding proteins
US20140295497A1 (en) 2011-11-30 2014-10-02 Taymar E. Hartman Vectors and host cells comprising a modified sv40 promoter for protein expression
US20130195871A1 (en) 2011-12-30 2013-08-01 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
TW201333035A (en) 2011-12-30 2013-08-16 Abbvie Inc Dual specific binding proteins directed against IL-13 and/or IL-17
UY34556A (en) 2011-12-30 2013-07-31 Abbvie Inc DUAL VARIABLE DOMAIN OF IMMUNOGLOBULINS AND THEIR USES
EP3369746A1 (en) 2012-01-27 2018-09-05 AbbVie Deutschland GmbH & Co KG Composition and method for diagnosis and treatment of diseases associated with neurite degeneration
WO2013177062A2 (en) 2012-05-21 2013-11-28 Genentech, Inc. Methods for improving safety of blood-brain barrier transport
HUE045144T2 (en) 2012-08-29 2019-12-30 Hoffmann La Roche Véragygát-shuttle
TW202037609A (en) 2012-11-01 2020-10-16 美商艾伯維有限公司 Anti-vegf/dll4 dual variable domain immunoglobulins and uses thereof
CN105431453A (en) 2012-11-01 2016-03-23 艾伯维公司 Stable dual variable domain immunoglobulin protein formulations
WO2014089209A2 (en) 2012-12-04 2014-06-12 Abbvie, Inc. Blood-brain barrier (bbb) penetrating dual specific binding proteins
WO2014106015A2 (en) 2012-12-28 2014-07-03 Abbvie, Inc. Multivalent binding protein compositions
US20140235476A1 (en) 2012-12-28 2014-08-21 Abbvie, Inc. Multivalent binding protein compositions and methods for identifying variants of same
EP2938634A2 (en) 2012-12-28 2015-11-04 AbbVie Inc. Dual specific binding proteins having a receptor sequence
US20140213772A1 (en) 2012-12-28 2014-07-31 Abbvie, Inc. Cross-over dual variable domain immunoglobulin constructs
US20140213771A1 (en) 2012-12-28 2014-07-31 Abbvie, Inc. Multi-specific binding proteins
US9458244B2 (en) 2012-12-28 2016-10-04 Abbvie Inc. Single chain multivalent binding protein compositions and methods
US9856319B2 (en) 2012-12-28 2018-01-02 Abbvie Inc. Monovalent binding proteins
CN105209491A (en) 2013-03-15 2015-12-30 艾伯维公司 Dual specific binding proteins directed against TNF[alpha]
WO2014144280A2 (en) 2013-03-15 2014-09-18 Abbvie Inc. DUAL SPECIFIC BINDING PROTEINS DIRECTED AGAINST IL-1β AND / OR IL-17
US11634502B2 (en) 2013-03-15 2023-04-25 Amgen Inc. Heterodimeric bispecific antibodies
KR20160037173A (en) 2013-08-02 2016-04-05 에프. 호프만-라 로슈 아게 Therapeutic fusion protein
US20150291689A1 (en) 2014-03-09 2015-10-15 Abbvie, Inc. Compositions and Methods for Treating Rheumatoid Arthritis
WO2015191934A2 (en) 2014-06-11 2015-12-17 Abbvie Inc. Blood-brain barrier (bbb) penetrating dual specific binding proteins for treating brain and neurological diseases
US10093733B2 (en) 2014-12-11 2018-10-09 Abbvie Inc. LRP-8 binding dual variable domain immunoglobulin proteins

Patent Citations (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5006309A (en) 1988-04-22 1991-04-09 Abbott Laboratories Immunoassay device with liquid transfer between wells by washing
US5089424A (en) 1988-06-14 1992-02-18 Abbott Laboratories Method and apparatus for heterogeneous chemiluminescence assay
US5063081A (en) 1988-11-14 1991-11-05 I-Stat Corporation Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor
US5294404A (en) 1991-06-03 1994-03-15 Abbott Laboratories Reagent pack for immunoassays
US7169901B2 (en) 1997-04-07 2007-01-30 Genentech, Inc. Anti-VEGF antibodies
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
US7070959B1 (en) 1999-06-08 2006-07-04 Regeneron Pharmaceuticals, Inc. Modified chimeric polypeptides with improved pharmacokinetic properties
WO2001077342A1 (en) 2000-04-11 2001-10-18 Genentech, Inc. Multivalent antibodies and uses therefor
US7419821B2 (en) 2002-03-05 2008-09-02 I-Stat Corporation Apparatus and methods for analyte measurement and immunoassay
US7262028B2 (en) 2002-07-18 2007-08-28 Crucell Holland B.V. Recombinant production of mixtures of antibodies
US7429486B2 (en) 2002-07-18 2008-09-30 Crucell Holland B.V. Recombinant production of mixtures of antibodies
US20040018577A1 (en) 2002-07-29 2004-01-29 Emerson Campbell John Lewis Multiple hybrid immunoassay
US7682833B2 (en) 2003-09-10 2010-03-23 Abbott Point Of Care Inc. Immunoassay device with improved sample closure
US7723099B2 (en) 2003-09-10 2010-05-25 Abbott Point Of Care Inc. Immunoassay device with immuno-reference electrode
US8187836B2 (en) 2008-01-15 2012-05-29 Abbott Laboratories Mammalian expression vectors and uses thereof
US20090311253A1 (en) 2008-06-03 2009-12-17 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
US9035027B2 (en) 2008-06-03 2015-05-19 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof

Non-Patent Citations (36)

* Cited by examiner, † Cited by third party
Title
ANTONIADES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 76, no. 4, 1979, pages 1809 - 1813
BARBAS ET AL., PROC. NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813
BURKE ET AL., ADVANCED DRUG DELIV. REV., vol. 58, no. 3, 2006, pages 437 - 446
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
DUROCHER ET AL., NUCLEIC ACIDS RES., vol. 30, no. 2, 2002, pages E9
ED HARLOW; DAVID LANE: "ANTIBODIES, A LABORATORY MANUAL", 1988, COLD SPRING HARBOR LABORATORY
FERRARA ET AL., ENDOCR. REV., vol. 18, 1997, pages 4 - 25
FERRARA ET AL., NAT. MED., vol. 9, 2003, pages 669 - 676
GIEGE; DUCRUIX: "CRYSTALLIZATION OF NUCLEIC ACIDS AND PROTEINS, A PRACTICAL APPROACH", vol. 20, 1999, OXFORD UNIVERSITY PRESS, pages: 1 - 16
HARLOW AND DAVID LANE: "ANTIBODIES, A LABORATORY MANUAL", 2014
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HILDEBRAND ET AL., SURFACE AND COATINGS TECHNOL., vol. 200, no. 22-23, 2006, pages 6318 - 6324
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, no. 14, 1993, pages 6444 - 6448
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 3319
JONSSON ET AL., ANN. BIOL. CLIN., vol. 51, 1993, pages 19 - 26
KABAT ET AL., ANN. NY ACAD. SCI., vol. 190, 1971, pages 382 - 391
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 132
LEUNG ET AL., SCIENCE, vol. 246, no. 4935, 1989, pages 1306 - 1309
MACCALLUM, J. MOL. BIOL., vol. 262, no. 5, 1996, pages 732 - 745
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARQUES: "Biodegradable Systems in Tissue Engineer", REGEN. MED., 2005, pages 377 - 397
MILLER ET AL., AM. J. PATHOL., vol. 145, no. 3, 1994, pages 574 - 584
MILLER ET AL., J. IMMUNOL., vol. 170, no. 9, 2003, pages 4854 - 4861
MILSTEIN; CUELLO, NATURE, vol. 305, no. 5934, 1983, pages 537 - 540
MIZUSHIMA; NAGATA, NUCLEIC ACIDS RES., vol. 18, 1990, pages 17
PADLAN, FASEB J., vol. 9, 1995, pages 133 - 139
POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SPIESS ET AL., MOL. IMMUNOL., vol. 67, 2015, pages 95 - 106
STAERZ ET AL., NATURE, vol. 314, no. 6012, 1985, pages 628 - 631
TZARTOS: "Epitope Mapping Protocols", vol. 66, 1998, HUMANA PRESS INC., article "Methods in Molecular Biology", pages: 55 - 66
WU, BIOMATERIALS, vol. 27, no. 11, 2006, pages 2450 - 2467
YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017119435A1 (en) * 2016-01-06 2017-07-13 株式会社オーダーメードメディカルリサーチ High-affinity anti-vegf antibody
US11008387B2 (en) 2016-01-06 2021-05-18 Order-Made Medical Research Inc. Antibody inhibiting binding of VEGF to NRP1
US11007259B2 (en) 2016-01-06 2021-05-18 Order-Made Medical Research Inc. High-affinity anti-VEGF antibody
US11872271B2 (en) 2016-01-06 2024-01-16 Order-Made Medical Research Inc. High-affinity anti-VEGF antibody KLHa505
WO2018119474A3 (en) * 2016-12-23 2018-08-09 Remd Biotherapeutics, Inc. Immunotherapy using antibodies that bind programmed death 1 (pd-1)
US11248049B2 (en) 2016-12-23 2022-02-15 Remd Biotherapeutics, Inc. Immunotherapy using antibodies that bind Programmed Death 1 (PD-1)
CN110381999A (en) * 2017-01-06 2019-10-25 埃尔萨里斯生物技术公司 In conjunction with the compound and application thereof of people CD160
CN110381999B (en) * 2017-01-06 2023-12-01 埃尔萨里斯生物技术公司 Compounds that bind human CD160 and uses thereof
US20230295346A1 (en) * 2017-08-16 2023-09-21 Bristol -Myers Squibb Company Prodruggable antibodies, prodrugs thereof, and methods of use and making
EP4158034A4 (en) * 2020-06-02 2024-07-03 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. GENETICALLY MODIFIED NON-HUMAN ANIMALS HAVING A LIGHT-CHAIN IMMUNOGLOBULIN LOCUS
WO2024185721A1 (en) * 2023-03-03 2024-09-12 Karydo TherapeutiX株式会社 Antibody or antigen-binding fragment thereof

Also Published As

Publication number Publication date
US9840554B2 (en) 2017-12-12
UY36731A (en) 2017-01-31
US20170015742A1 (en) 2017-01-19
WO2016205427A3 (en) 2017-02-09
TW201710286A (en) 2017-03-16

Similar Documents

Publication Publication Date Title
US9840554B2 (en) Antibodies against platelet-derived growth factor (PDGF)
US11518803B2 (en) Antagonist antibodies that bind to human TGFB1, TGFB2 and to TGFB3 and their use for the treatment of lung fibrosis
US10899842B2 (en) 4-1BB binding proteins and uses thereof
AU2012328917B2 (en) Bispecific immunobinders directed against TNF and IL-17
CN105037543B (en) Therapeutic DLL4 binding proteins
US9226983B2 (en) TNF-α binding proteins
CA2890263C (en) Anti-vegf/dll4 dual variable domain immunoglobulins and uses thereof
CA2728909A1 (en) Prostaglandin e2 binding proteins and uses thereof
WO2014144299A2 (en) DUAL SPECIFIC BINDING PROTEINS DIRECTED AGAINST TNFα
CA2862433A1 (en) Dual variable domain immunoglobulins and uses thereof
WO2014144280A2 (en) DUAL SPECIFIC BINDING PROTEINS DIRECTED AGAINST IL-1β AND / OR IL-17
AU2015200579A1 (en) TNF-alpha binding proteins
US10093733B2 (en) LRP-8 binding dual variable domain immunoglobulin proteins
AU2014202979A1 (en) Prostaglandin E2 binding proteins and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16734098

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16734098

Country of ref document: EP

Kind code of ref document: A2