WO2016160926A1 - Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack - Google Patents

Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack Download PDF

Info

Publication number
WO2016160926A1
WO2016160926A1 PCT/US2016/024921 US2016024921W WO2016160926A1 WO 2016160926 A1 WO2016160926 A1 WO 2016160926A1 US 2016024921 W US2016024921 W US 2016024921W WO 2016160926 A1 WO2016160926 A1 WO 2016160926A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
hae
administered
subject
weeks
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/024921
Other languages
English (en)
French (fr)
Inventor
Yung CHYUNG
Burt Adelman
Daniel J. Sexton
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dyax Corp
Original Assignee
Dyax Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=57005262&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2016160926(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to MX2017012423A priority Critical patent/MX2017012423A/es
Priority to HK18110329.1A priority patent/HK1250995A1/zh
Priority to EP16774069.5A priority patent/EP3286226A4/en
Priority to JP2017549388A priority patent/JP7008920B2/ja
Priority to KR1020177031279A priority patent/KR102607829B1/ko
Priority to NZ735659A priority patent/NZ735659B2/en
Priority to IL254292A priority patent/IL254292B1/en
Priority to IL305207A priority patent/IL305207A/en
Priority to KR1020257012913A priority patent/KR20250057946A/ko
Priority to CA2979713A priority patent/CA2979713A1/en
Priority to KR1020237040648A priority patent/KR102799778B1/ko
Priority to US15/562,671 priority patent/US20180298110A1/en
Priority to EA201792161A priority patent/EA201792161A1/ru
Priority to AU2016243160A priority patent/AU2016243160B2/en
Priority to CN201680018200.7A priority patent/CN107614532A/zh
Priority to EP21167802.4A priority patent/EP3916020A1/en
Priority to BR112017020864-4A priority patent/BR112017020864A2/en
Application filed by Dyax Corp filed Critical Dyax Corp
Publication of WO2016160926A1 publication Critical patent/WO2016160926A1/en
Priority to CONC2017/0009404A priority patent/CO2017009404A2/es
Anticipated expiration legal-status Critical
Priority to US17/500,214 priority patent/US20220169749A1/en
Priority to JP2021204200A priority patent/JP7309836B2/ja
Priority to AU2022203180A priority patent/AU2022203180B2/en
Priority to JP2023110592A priority patent/JP2023130442A/ja
Priority to AU2025271115A priority patent/AU2025271115A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02Inorganic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12Carboxylic acids; Salts or anhydrides thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/10Antioedematous agents; Diuretics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • Plasma kallikrein is a serine protease component of the contact system and a potential drug target for different inflammatory, cardiovascular, infectious (sepsis) and oncology diseases (Sainz I.M. et al., Thromb Haemost 98, 77-83, 2007).
  • the contact system is activated by either factor Xlla upon exposure to foreign or negatively charged surfaces or on endothelial cell surfaces by
  • prolylcarboxypeptidases (Sainz I.M. et al., Thromb Haemost 98, 77-83, 2007).
  • Activation of the plasma kallikrein amplifies intrinsic coagulation via its feedback activation of factor XII and enhances inflammation via the production of the proinflammatory nonapeptide bradykinin.
  • plasma kallikrein is largely responsible for the generation of bradykinin in the vasculature.
  • C I -inhibitor protein C l-INH
  • HAE hereditary angioedema
  • the present disclosure is, in part, based on the results derived from clinical studies showing that doses of DX-2930, an antibody binding to the active form of human plasma kallikrein, (e.g. , 30 mg, 100 mg, 300 mg or 400 mg administered every two weeks) showed unexpected effectiveness in preventing HAE attack or reducing the rate of HAE attack in human patients. Further, DX-2930 treatment did not show evidence of dose-limiting toxicity when administered to humans. Overall, the results obtained from the instant study were unexpected since DX-2930 is the first completely specific plasma kallikrein inhibitor that has shown high efficacy in HAE treatment. This demonstrates that plasma kallikrein is central to disease pathogenesis.
  • one aspect of the present disclosure features a method of preventing HAE attack or reducing the rate of HAE attack (e.g. , type I, II, or III HAE), the method comprising administering to a subject in need thereof an antibody binding to the active form of human plasma kallikrein (e.g., DX-2930) in an effective amount (e.g. , about 30 mg -400 mg, about 100 mg - 400 mg, about 100 mg - 300 mg, or about 300 mg - 400 mg).
  • the antibody is administered every two to four weeks for at least two times.
  • the antibody is administered at 300 mg or 400 mg every 2 weeks to four weeks (e.g. , every two weeks or every four weeks).
  • the antibody can be administered by subcutaneous administration.
  • the subject is a human patient experiencing at least two HAE attack per year (e.g., at least one HAE attack within 6 month prior to the first administration, at least 2 HAE attacks within 3 months prior to the first administration, or at least 9 HAE attacks within 3 months prior to the first administration).
  • the HAE can be type I HAE or type II HAE.
  • the method described herein is for prophylactic treatment of HAE.
  • the antibody used in any of the methods described herein may be an antibody (e.g., a full-length antibody or an antigen-binding fragment) that binds the same epitope as DX-2930 or competes against DX-2930 for binding to active human plasma kallikrein.
  • the antibody comprises the same heavy chain and light chain CDRs.
  • the antibody is DX-2930.
  • Any of the antibody as described herein (e.g., DX-2930) may be formulated in a pharmaceutical composition, which comprises a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises sodium phosphate, citric acid, histidine, sodium chloride, and Tween 80.
  • the antibody e.g. , DX- 2930
  • the antibody is formulated in 30 mM sodium phosphate, 8.6 mM citric acid, 50 mM histidine, 90 mM sodium chloride, and 0.01% Tween 80, pH 6.0.
  • the present disclosure features a method of treating HAE (e.g., type I, II, or III), the method comprising administering to a subject in need thereof an antibody binding to the active form of human plasma kallikrein (e.g., DX- 2930) in an effective amount (e.g., 100-400 mg, 100-300 mg, 150 mg or 300 mg), wherein the DX-2930 antibody is administered in a dosage regimen having a loading period (e.g., first administered every week such as for at least one week), a
  • maintenance period e.g. , subsequently administered every two to four weeks
  • follow-on period optionally a follow-on period
  • the antibody is administered to the subject at 100 to 300 mg (e.g., 150 mg or 300 mg) during the loading period.
  • the loading period may be two weeks.
  • the antibody may be administered at day 0, day 7, and day 14 at, e.g., 150 mg or 300 mg.
  • the antibody is administered to the subject at 100 to 300 mg (e.g., 150 mg or 300 mg) during the maintenance period.
  • the maintenance period may last for 10 weeks.
  • the antibody can be administered at day 28, day 42, day 56, day 70 and day 84.
  • the method may further comprise administering to the subject the antibody after the maintenance period once every two to four weeks (e.g. , every two weeks or every four weeks).
  • the antibody is administered at 100 to 400 mg (e.g., 100 mg to 300 mg, for example, 150 mg or 300 mg).
  • the antibody can be administered by subcutaneous administration.
  • the subject is a human patient suffering from, suspected of having, or at risk for HAE attack.
  • the method described herein is for prophylactic treatment of HAE.
  • the subject may be a human patient who experienced at least 2 attacks per year (e.g. , at least one attack per 4 weeks) prior to the treatment.
  • the antibody is administered for preventing HAE attack or for reducing the rate of HAE attack.
  • the antibody e.g. , DX-2930
  • the antibody is first administered every week for one, two or three weeks and subsequently administered every two, three or four weeks. In some embodiments, the antibody (e.g., DX-2930) is subsequently administered every two weeks for ten weeks. In some embodiments, the subject has at least one attack every four weeks prior to the first administration.
  • the antibody to be used in any of the methods described herein may be an antibody that binds the same epitope as DX-2930 or competes against DX-2930 for binding to active human plasma kallikrein.
  • the antibody comprises the same heavy chain and light chain CDRs.
  • the antibody is DX-2930.
  • compositions for use in treating HAE e.g., preventing HAE attack or reducing the rate of HAE attack
  • the pharmaceutical composition comprising any of the anti- kallikrein antibodies described herein and a pharmaceutically acceptable carrier, wherein the pharmaceutical composition is administered to a subject following any of the treatment regimens described herein; and (b) use of the pharmaceutical composition for manufacturing a medicament for the treatment of HAE.
  • Use of the antibodies for the intended purposes could be performed under the treating regimens as described herein.
  • FIGURE 1 shows DX-2930 plasma drug levels following subcutaneous dosing in HAE patients in the phase lb study.
  • FIGURE 2 shows fluorogenic activity assay of HAE patient samples from the phase lb study.
  • FIGURE 3 is a Western blot analysis of SCAT 169 plasma from HAE patients from the phase lb study.
  • FIGURE 4 is a Western blot analysis of citrated plasma from HAE patients from the phase lb study.
  • FIGURE 5 is a Western blot analysis of citrated plasma activated ex vivo with FXIIa from HAE patients from the phase lb study.
  • FIGURE 6 shows the primary efficacy assessment period for patients in different dosing cohorts.
  • A. 300 mg cohort.
  • B. 400 mg cohort. Red bars show the interval assessed for efficacy.
  • FIGURE 7 shows the reduction in HAE attack rate in patients treated with 300 mg, 400 mg, combined (300 and 400 mg) or placebo.
  • Baseline was defined as historical HAE attacks over last 3 months prior to dosing. The data includes patients with a baseline rate of > 2 attacks in the last 3 months. Day 8 to 50 attack rates were unadjusted for baseline rates. Percent reduction in HAE attack rate over placebo and p-value were calculated based upon Mixed Model Repeated Measurements with Analysis of Variance (baseline attack rate as covariate) and assuming Poisson distribution..
  • FIGURE 8 shows the incidence of HAE attacks in placebo-treated subjects.
  • the X-axis shows the study day number.
  • FIGURE 9 shows the mean DX-2930 concentration and HAE attack incidence following 30 mg dosage.
  • FIGURE 10 shows the mean DX-2930 concentration and HAE attack incidence following 100 mg dosage.
  • FIGURE 11 shows the mean DX-2930 concentration and HAE attack incidence following 300 mg dosage.
  • FIGURE 12 shows the mean DX-2930 concentration and HAE attack incidence following 400 mg dosage. Excludes one patient who received only one dose (in order to derive the mean pharmacokinetic curve).
  • FIGURE 13 shows DX-2930 concentration and HAE attacks in patients with historical attack rate > 9 attacks/3 months.
  • A. a placebo patient.
  • B. a patient treated with 300 mg.
  • C.-F. patients treated with 400 mg.
  • FIGURE 14 shows an exemplary dosing regimen comprising a loading period and a maintenance period, which may be followed by an extended treatment period or a washout period.
  • antibody refers to a protein that includes at least one
  • an antibody can include a heavy (H) chain variable region (abbreviated herein as VH or HV), and a light (L) chain variable region (abbreviated herein as VL or LV).
  • an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions.
  • the term "antibody” encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab') 2 , Fd fragments, Fv fragments, scFv, and domain antibodies (dAb) fragments (de Wildt et al., Eur J Immunol. 1996; 26(3):629-39)) as well as complete antibodies.
  • An antibody can have the structural features of IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof).
  • Antibodies may be from any source, but primate (human and non-human primate) and primatized are preferred.
  • VH and VL regions can be further subdivided into regions of
  • CDRs complementarity determining regions
  • FRs framework regions
  • the extent of the framework region and CDRs have been defined (see, Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91- 3242, and Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917). Kabat definitions are used herein.
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • an "immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain such that one or more CDR regions are positioned in a conformation suitable for an antigen binding site.
  • the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
  • the sequence may omit one, two or more N- or C-terminal amino acids, internal amino acids, may include one or more insertions or additional terminal amino acids, or may include other alterations.
  • immunoglobulin variable domain sequence can associate with another
  • the V H or V L chain of the antibody can further include all or part of a heavy or light chain constant region, to thereby form a heavy or light immunoglobulin chain, respectively.
  • the antibody is a tetramer of two heavy heavy chain
  • the heavy chain constant region includes three immunoglobulin domains, CHI, CH2 and CH3.
  • the light chain constant region includes a CL domain.
  • the variable region of the heavy and light chains contains a binding domain that interacts with an antigen.
  • the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • the light chains of the immunoglobulin may be of types kappa or lambda. In one embodiment, the antibody is glycosylated.
  • An antibody can be functional for antibody-dependent cytotoxicity and/or complement-mediated cytotoxicity.
  • One or more regions of an antibody can be human or effectively human.
  • one or more of the variable regions can be human or effectively human.
  • one or more of the CDRs can be human, e.g., HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and/or LC CDR3.
  • Each of the light chain (LC) and/or heavy chain (HC) CDRs can be human.
  • HC CDR3 can be human.
  • One or more of the framework regions can be human, e.g., FR1, FR2, FR3, and/or FR4 of the HC and/or LC.
  • the Fc region can be human. In one embodiment, all the framework regions are human, e.g.
  • the human sequences are germline sequences, e.g., encoded by a germline nucleic acid.
  • the framework (FR) residues of a selected Fab can be converted to the amino-acid type of the corresponding residue in the most similar primate germline gene, especially the human germline gene.
  • One or more of the constant regions can be human or effectively human.
  • At least 70, 75, 80, 85, 90, 92, 95, 98, or 100% of an immunoglobulin variable domain, the constant region, the constant domains (CHI, CH2, CH3, and/or CL1), or the entire antibody can be human or effectively human.
  • All or part of an antibody can be encoded by an immunoglobulin gene or a segment thereof.
  • exemplary human immunoglobulin genes include the kappa, lambda, alpha (IgAl and IgA2), gamma (IgGl, IgG2, IgG3, IgG4), delta, epsilon and mu constant region genes, as well as the many immunoglobulin variable region genes.
  • Full-length immunoglobulin "light chains" (about 25 KDa or about 214 amino acids) are encoded by a variable region gene at the NH2-terminus (about 110 amino acids) and a kappa or lambda constant region gene at the COOH-terminus.
  • Full-length immunoglobulin "heavy chains" (about 50 KDa or about 446 amino acids), are similarly encoded by a variable region gene (about 116 amino acids) and one of the other aforementioned constant region genes, e.g., gamma (encoding about 330 amino acids).
  • the length of human HC varies considerably because HC CDR3 varies from about 3 amino-acid residues to over 35 amino-acid residues.
  • antigen-binding fragment of a full length antibody refers to one or more fragments of a full-length antibody that retain the ability to specifically bind to a target of interest.
  • binding fragments encompassed within the term "antigen-binding fragment” of a full length antibody and that retain functionality include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341 :544-546), which consists of a VH domain; and (vi) an isolated
  • CDR complementarity determining region
  • Antibody fragments can be obtained using any appropriate technique including conventional techniques known to those with skill in the art.
  • the term "monospecific antibody” refers to an antibody that displays a single binding specificity and affinity for a particular target, e.g., epitope.
  • This term includes a "monoclonal antibody” or “monoclonal antibody composition,” which as used herein refers to a preparation of antibodies or fragments thereof of single molecular composition, irrespective of how the antibody was generated.
  • Antibodies are "germlined” by reverting one or more non-germline amino acids in framework regions to corresponding germline amino acids of the antibody, so long as binding properties are substantially retained.
  • the inhibition constant (Ki) provides a measure of inhibitor potency; it is the concentration of inhibitor required to reduce enzyme activity by half and is not dependent on enzyme or substrate concentrations.
  • the apparent Ki (Ki,app) is obtained at different substrate concentrations by measuring the inhibitory effect of different concentrations of inhibitor (e.g., inhibitory binding protein) on the extent of the reaction (e.g., enzyme activity); fitting the change in pseudo-first order rate constant as a function of inhibitor concentration to the Morrison equation (Equation 1) yields an estimate of the apparent Ki value.
  • the Ki is obtained from the y-intercept extracted from a linear regression analysis of a plot of Ki,app versus substrate concentration.
  • binding affinity refers to the apparent association constant or KA.
  • the KA is the reciprocal of the dissociation constant (KD).
  • a binding antibody may, for example, have a binding affinity of at least 105, 106, 107, 108, 109, 1010 and 1011 M- l for a particular target molecule, e.g. , plasma kallikrein. Higher affinity binding of a binding antibody to a first target relative to a second target can be indicated by a higher KA (or a smaller numerical value KD) for binding the first target than the KA (or numerical value KD) for binding the second target. In such cases, the binding antibody has specificity for the first target (e.g., a protein in a first
  • Differences in binding affinity can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 105 fold.
  • Binding affinity can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g. , using a fluorescence assay).
  • Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be used to measure the concentration of bound and free binding protein as a function of binding protein (or target) concentration.
  • the concentration of bound binding protein ([Bound]) is related to the concentration of free binding protein ([Free]) and the concentration of binding sites for the binding protein on the target where (N) is the number of binding sites per target molecule by the following equation:
  • binding antibody refers to an antibody that can interact with a target molecule. This term is used interchangeably with “ligand.”
  • a "plasma kallikrein binding antibody” refers to an antibody that can interact with (e.g., bind) plasma kallikrein, and includes, in particular, antibodies that preferentially or specifically interact with and/or inhibit plasma kallikrein. An antibody inhibits plasma kallikrein if it causes a decrease in the activity of plasma kallikrein as compared to the activity of plasma kallikrein in the absence of the antibody and under the same conditions.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g. , threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • one or more framework and/or CDR amino acid residues of a binding protein may include one or more mutations (e.g. , substitutions (e.g.,
  • a plasma kallikrein binding protein may have mutations (e.g. , substitutions (e.g., conservative substitutions or substitutions of non-essential amino acids), insertions, or deletions) (e.g. , at least one, two, three, or four, and/or less than 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, or 2 mutations) relative to a binding protein described herein, e.g., mutations which do not have a substantial effect on protein function.
  • the mutations can be present in framework regions, CDRs, and/or constant regions. In some embodiments, the mutations are present in a framework region.
  • the mutations are present in a CDR. In some embodiments, the mutations are present in a constant region. Whether or not a particular substitution will be tolerated, i.e., will not adversely affect biological properties, such as binding activity, can be predicted, e.g., by evaluating whether the mutation is conservative or by the method of Bowie, et al. (1990) Science 247: 1306-1310.
  • An "effectively human” immunoglobulin variable region is an immunoglobulin variable region
  • an "effectively human” antibody is an antibody that includes a sufficient number of human amino acid positions such that the antibody does not elicit an immunogenic response in a normal human.
  • an “epitope” refers to the site on a target compound that is bound by a binding protein (e.g., an antibody such as a Fab or full length antibody).
  • a binding protein e.g., an antibody such as a Fab or full length antibody.
  • the site can be entirely composed of amino acid components, entirely composed of chemical modifications of amino acids of the protein (e.g., glycosyl moieties), or composed of combinations thereof.
  • Overlapping epitopes include at least one common amino acid residue, glycosyl group, phosphate group, sulfate group, or other molecular feature.
  • a first binding antibody "binds to the same epitope" as a second binding antibody if the first binding antibody binds to the same site on a target compound that the second binding antibody binds, or binds to a site that overlaps (e.g., 50%, 60%, 70%, 80%, 90%, or 100% overlap, e.g. , in terms of amino acid sequence or other molecular feature (e.g., glycosyl group, phosphate group, or sulfate group)) with the site that the second binding antibody binds.
  • overlaps e.g., 50%, 60%, 70%, 80%, 90%, or 100% overlap, e.g. , in terms of amino acid sequence or other molecular feature (e.g., glycosyl group, phosphate group, or sulfate group)
  • a first binding antibody "competes for binding" with a second binding antibody if the binding of the first binding antibody to its epitope decreases (e.g., by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or more) the amount of the second binding antibody that binds to its epitope.
  • the competition can be direct (e.g. , the first binding antibody binds to an epitope that is the same as, or overlaps with, the epitope bound by the second binding antibody), or indirect (e.g. , the binding of the first binding antibody to its epitope causes a steric change in the target compound that decreases the ability of the second binding antibody to bind to its epitope).
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”).
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
  • the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 80%, 90%, 92%, 95%, 97%, 98%, or 100% of the length of the reference sequence.
  • the reference sequence may be the length of the immunoglobulin variable domain sequence.
  • a “humanized” immunoglobulin variable region is an immunoglobulin variable region that is modified to include a sufficient number of human framework amino acid positions such that the immunoglobulin variable region does not elicit an immunogenic response in a normal human. Descriptions of "humanized”
  • immunoglobulins include, for example, U.S. 6,407,213 and U.S. 5,693,762.
  • an “isolated” antibody refers to an antibody that is removed from at least 90% of at least one component of a natural sample from which the isolated antibody can be obtained.
  • Antibodies can be "of at least" a certain degree of purity if the species or population of species of interest is at least 5, 10, 25, 50, 75, 80, 90, 92, 95, 98, or 99% pure on a weight- weight basis.
  • a "patient,” “subject” or “host” (these terms are used interchangeably) to be treated by the subject method may mean either a human or non-human animal.
  • prekallikrein and "preplasma kallikrein” are used interchangeably herein and refer to the zymogen form of active plasma kallikrein, which is also known as prekallikrein.
  • homologous is used herein to refer to a first amino acid or nucleic acid sequence that contains a sufficient number of identical or equivalent (e.g. , with a similar side chain, e.g., conserved amino acid substitutions) amino acid residues or nucleotides to a second amino acid or nucleic acid sequence such that the first and second amino acid or nucleic acid sequences have (or encode proteins having) similar activities, e.g. , a binding activity, a binding preference, or a biological activity.
  • the second antibody has the same specificity and has at least 50%, at least 25%, or at least 10% of the affinity relative to the same antigen.
  • Sequences similar or homologous e.g. , at least about 85% sequence identity
  • sequences disclosed herein are also part of this application.
  • sequence identity can be about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher.
  • a plasma kallikrein binding antibody can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to an antibody described herein.
  • a plasma kallikrein binding antibody can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity in the HC and/or LC framework regions (e.g., HC and/or LC FR 1, 2, 3, and/or 4) to an antibody described herein (e.g. , DX-2930).
  • a plasma kallikrein binding antibody can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity in the HC and/or LC CDRs (e.g.
  • a plasma kallikrein binding antibody can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity in the constant region (e.g., CHI, CH2, CH3, and/or CL1) to an antibody described herein (e.g., DX-2930).
  • nucleic acid segments hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the strand.
  • the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
  • Exemplary statistical tests include: the Students T-test, Mann Whitney U non- parametric test, and Wilcoxon non-parametric statistical test. Some statistically significant relationships have a P value of less than 0.05 or 0.02. Particular binding proteins may show a difference, e.g., in specificity or binding that are statistically significant (e.g. , P value ⁇ 0.05 or 0.02).
  • the terms “induce”, “inhibit”, “potentiate”, “elevate”, “increase”, “decrease” or the like, e.g., which denote distinguishable qualitative or quantitative differences between two states, may refer to a difference, e.g., a statistically significant difference, between the two states.
  • a "therapeutically effective dosage” preferably modulates a measurable parameter, e.g., plasma kallikrein activity, by a statistically significant degree or at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
  • a measurable parameter e.g., plasma kallikrein activity
  • the ability of a compound to modulate a measurable parameter e.g., a disease-associated parameter, can be evaluated in an animal model system predictive of efficacy in human disorders and conditions. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to modulate a parameter in vitro.
  • treating refers to the application or administration of a composition including one or more active agents to a subject, who has an allergic disease, a symptom of the allergic disease, or a predisposition toward the allergic disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms of the disease, or the predisposition toward the disease.
  • “Prophylactic treatment,” also known as “preventive treatment” refers to a treatment that aims at protecting a person from, or reducing the risk for a disease to which he or she has been, or may be, exposed.
  • preventing refers to subjecting the subject to a pharmaceutical treatment, e.g., the administration of a drug, such that at least one symptom of the disease is prevented, that is, administered prior to clinical
  • the unwanted condition e.g., disease or other unwanted state of the host animal
  • Preventing a disease may also be referred to as “prophylaxis” or “prophylactic treatment.”
  • prophylactic ally effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, because a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • Plasma kallikrein binding antibodies for use in the methods described herein can be full-length (e.g. , an IgG (e.g., an IgGl, IgG2, IgG3, IgG4), IgM, IgA (e.g. , IgAl, IgA2), IgD, and IgE) or can include only an antigen-binding fragment (e.g. , a Fab, F(ab')2 or scFv fragment.
  • the binding antibody can include two heavy chain immunoglobulins and two light chain immunoglobulins, or can be a single chain antibody.
  • Plasma kallikrein binding antibodies can be recombinant proteins such as humanized, CDR grafted, chimeric, deimmunized, or in vitro generated antibodies, and may optionally include constant regions derived from human germline immunoglobulin sequences.
  • the plasma kallikrein binding antibody is a monoclonal antibody
  • the disclosure features an antibody (e.g., an isolated antibody) that binds to plasma kallikrein (e.g. , human plasma kallikrein and/or murine kallikrein) and includes at least one immunoglobulin variable region.
  • the antibody includes a heavy chain (HC) immunoglobulin variable domain sequence and/or a light chain (LC) immunoglobulin variable domain sequence.
  • the antibody binds to and inhibits plasma kallikrein, e.g., human plasma kallikrein and/or murine kallikrein.
  • the antibody can include one or more of the following characteristics: (a) a human CDR or human framework region; (b) the HC immunoglobulin variable domain sequence comprises one or more (e.g. , 1, 2, or 3) CDRs that are at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a CDR of a HC variable domain described herein; (c) the LC immunoglobulin variable domain sequence comprises one or more (e.g.
  • the LC immunoglobulin variable domain sequence is at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a LC variable domain described herein (e.g.
  • the HC immunoglobulin variable domain sequence is at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a HC variable domain described herein (e.g., overall or in framework regions or CDRs);
  • the antibody binds an epitope bound by an antibody described herein, or competes for binding with an antibody described herein;
  • the HC immunoglobulin variable domain sequence comprises a CDR1 that differs by at least one amino acid but by no more than 2 or 3 amino acids from the CDR1 of a HC variable domain described herein;
  • the HC immunoglobulin variable domain sequence comprises a CDR2 that differs by at least one amino acid but by no more than 2, 3, 4, 5, 6, 7, or 8 amino acids from the CDR2 of a HC variable domain described herein; j)
  • the HC immunoglobulin variable domain sequence differs by at least one amino acid but by no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids from a HC variable domain described herein (e.g. , overall or in framework regions or CDRs).
  • the plasma kallikrein binding protein may be an isolated antibody (e.g. , at least 70, 80, 90, 95, or 99% free of other proteins).
  • the plasma kallikrein binding antibody, or composition thereof is isolated from antibody cleavage fragments (e.g. , DX-2930) that are inactive or partially active (e.g. , bind plasma kallikrein with a Ki, app of 5000 nM or greater) compared to the plasma kallikrein binding antibody.
  • the plasma kallikrein binding antibody is at least 70% free of such antibody cleavage fragments; in other embodiments the binding antibody is at least 80%, at least 90%, at least 95%, at least 99% or even 100% free from antibody cleavage fragments that are inactive or partially active.
  • the plasma kallikrein binding antibody may additionally inhibit plasma kallikrein, e.g., human plasma kallikrein.
  • the plasma kallikrein binding antibody does not bind prekallikrein (e.g., human prekallikrein and/or murine prekallikrein), but binds to the active form of plasma kallikrein (e.g., human plasma kallikrein and/or murine kallikrein).
  • the antibody binds at or near the active site of the catalytic domain of plasma kallikrein, or a fragment thereof, or binds an epitope that overlaps with the active site of plasma kallikrein.
  • the antibody binds the same epitope or competes for binding with an antibody described herein.
  • the antibody can bind to plasma kallikrein, e.g. , human plasma kallikrein, with a binding affinity of at least 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 and 10 11 M "1 .
  • the antibody binds to human plasma kallikrein with a K 0 ff slower than 1 x 10 ⁇ 3 , 5 X 10 "4 s "1 , or 1 x 10 "4 s "1 .
  • the antibody binds to human plasma kallikrein with a K on faster than 1 x 10 2 , 1 x 10 3 , or 5 x 10 3 ⁇ " ⁇
  • the antibody binds to plasma kallikrein, but does not bind to tissue kallikrein and/or plasma prekallikrein (e.g. , the antibody binds to tissue kallikrein and/or plasma prekallikrein less effectively (e.g., 5-, 10-, 50-, 100-, or 1000-fold less or not at all, e.g. , as compared to a negative control) than it binds to plasma kallikrein.
  • the antibody inhibits human plasma kallikrein activity, e.g. , with a Ki of less than 10 "5 , 10 "6 , 10 “7 , 10 ⁇ 8 , 10 “9 , and 10 "10 M.
  • the antibody can have, for example, an IC 50 of less than 100 nM, 10 nM, 1, 0.5, or 0.2 nM.
  • the antibody may modulate plasma kallikrein activity, as well as the production of Factor Xlla (e.g. , from Factor XII) and/or bradykinin (e.g., from high- molecular-weight kininogen (HMWK)).
  • Factor Xlla e.g. , from Factor XII
  • HMWK high- molecular-weight kininogen
  • the antibody may inhibit plasma kallikrein activity, and/or the production of Factor Xlla (e.g. , from Factor XII) and/or bradykinin (e.g., from high-molecular-weight kininogen (HMWK)).
  • the affinity of the antibody for human plasma kallikrein can be characterized by a K D of less than 100 nm, less than 10 nM, less than 5 nM, less than 1 nM, less than 0.5 nM.
  • the antibody inhibits plasma kallikrein, but does not inhibit tissue kallikrein (e.g., the antibody inhibits tissue kallikrein less effectively (e.g., 5-, 10-, 50- , 100-, or 1000-fold less or not at all, e.g. , as compared to a negative control) than it inhibits plasma kallikrein.
  • tissue kallikrein e.g., the antibody inhibits tissue kallikrein less effectively (e.g., 5-, 10-, 50- , 100-, or 1000-fold less or not at all, e.g. , as compared to a negative control) than it inhibits plasma kallikrein.
  • the antibody has an apparent inhibition constant (Ki app) of less than 1000, 500, 100, 5, 1, 0.5 or 0.2 nM.
  • Plasma kallikrein binding antibodies may have their HC and LC variable domain sequences included in a single polypeptide (e.g. , scFv), or on different polypeptides (e.g., IgG or Fab).
  • the HC and LC variable domain sequences are
  • the HC and LC variable domain sequences are components of different polypeptide chains.
  • the antibody is an IgG, e.g., IgGl, IgG2, IgG3, or IgG4.
  • the antibody can be a soluble Fab.
  • the antibody includes a Fab2', scFv, minibody, scFv::Fc fusion, Fab::HSA fusion, HSA::Fab fusion, Fab::HSA::Fab fusion, or other molecule that comprises the antigen combining site of one of the binding proteins herein.
  • VH and VL regions of these Fabs can be provided as IgG, Fab, Fab2, Fab2', scFv, PEGylated Fab, PEGylated scFv, PEGylated Fab2, VH::CH1 ::HSA+LC, HSA::VH::CH1+LC, LC::HSA + VH::CH1, HSA::LC + VH::CH1, or other appropriate construction.
  • the antibody is a human or humanized antibody or is non- immunogenic in a human.
  • the antibody includes one or more human antibody framework regions, e.g., all human framework regions, or framework regions at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to human framework regions.
  • the antibody includes a human Fc domain, or an Fc domain that is at least 95, 96, 97, 98, or 99% identical to a human Fc domain.
  • the antibody is a primate or primatized antibody or is non- immunogenic in a human.
  • the antibody includes one or more primate antibody framework regions, e.g., all primate framework regions, or framework regions at least 85, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to primate framework regions.
  • the antibody includes a primate Fc domain, or an Fc domain that is at least 95, 96, 97, 98, or 99% identical to a primate Fc domain.
  • “Primate” includes humans (Homo sapiens), chimpanzees (Pan troglodytes and Pan paniscus (bonobos)), gorillas (Gorilla gorilla), gibons, monkeys, lemurs, aye-ayes (Daubentonia madagascariensis), and tarsiers.
  • the affinity of the primate antibody for human plasma kallikrein is characterized by a KD of less than 1000, 500, 100, 10, 5, 1, 0.5 nM, e.g., less than 10 nM, less than 1 nM, or less than 0.5 nM.
  • the antibody includes no sequences from mice or rabbits (e.g., is not a murine or rabbit antibody).
  • the antibody used in the methods described herein may be DX-2930 as described herein or a functional variant thereof, or an antibody that binds the same epitope as DX-2930 or competes against DX-2930 for binding to active plasma kallikrein.
  • a functional variant of DX-2930 comprises the same complementary determining regions (CDRs) as DX-2930, as determined by the same method.
  • the functional variants of DX-2930 may contain one or more mutations (e.g., conservative substitutions) in the FRs of either the V H or the V L as compared to those in the V H and V L of DX-2930. Preferably, such mutations do not occur at residues which are predicted to interact with one or more of the CDRs, which can be determined by routine technology.
  • the functional variants described herein contain one or more mutations (e.g., 1, 2, or 3) within one or more of the CDR regions of DX-2930.
  • a functional variant of DX-2930 may comprise a V H chain that comprises an amino acid sequence at least 85% (e.g., 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to that of the V H of DX-2930 and/or a V L chain that has an amino acid sequence at least 85% (e.g., 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to that of the V L of DX-2930.
  • These variants are capable of binding to the active form of plasma kallikrein and preferably do not bind to prekallikrein.
  • Gapped BLAST can be utilized as described in Altschul et al, Nucleic Acids Res. 25(17):3389-3402, 1997.
  • the default parameters of the respective programs e.g., XBLAST and NBLAST.
  • the antibody used in the methods and compositions described herein may be the DX-2930 antibody.
  • the heavy and light chain full and variable sequences for DX-2930 are provided below, with signal sequences in italics.
  • the CDRs are boldfaced and underlined (based on the Kabat numbering scheme).
  • DX-2930 Heavy Chain Amino Acid Sequence (451 amino acids, 49439.02 Da) GW5C/L L ArArGAHSEVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMM WVRQAPGKGLEWVSGIYSSGGITVYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSK STS GGT AALGCLVKD YFPEPVTVS WNS GALTS GVHTFPA VLQS S GLYSLS S VV TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
  • DX-2930 Light Chain Amino Acid Sequence (213 amino acids, 23419.08 Da) GWSC/L LyArArGAHSDIQMTQSPSTLSASVGDRVTITCRASOSISSWLAWY QQKPGKAPKLLIYKASTLESGVPSRFS GS GS GTEFTLTIS S LQPDDFAT YYCOO YNTYWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDN ALQS GNS QES VTEQDS KDS T YS LS S TLTLS KAD YEKHKV Y ACE VTHQGLS S P VTKS FNRGEC (SEQ ID NO: 2)
  • An antibody as described herein can be made by any method known in the art. See, for example, Harlow and Lane, (1988) Antibodies: A
  • the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
  • the polynucleotide sequence may be used for genetic manipulation to "humanize” the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody.
  • the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to the target antigen and greater efficacy in inhibiting the activity of PKal. It will be apparent to one of skill in the art that one or more polynucleotide changes can be made to the antibody and still maintain its binding specificity to the target antigen.
  • Fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
  • Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are Xenomouse R TM from Amgen, Inc. (Fremont, Calif.) and HuMAb-Mouse R TM and TC MouseTM from Medarex, Inc. (Princeton, N.J.).
  • antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos.
  • Antigen-binding fragments of an intact antibody can be prepared via routine methods.
  • F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments.
  • DNA encoding a monoclonal antibodies specific to a target antigen can be readily isolated or synthesized.
  • the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. See, e.g., PCT Publication No. WO 87/04462.
  • the DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., (1984) Proc. Nat. Acad. Sci. 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non- immunoglobulin polypeptide.
  • genetically engineered antibodies such as "chimeric” or "hybrid” antibodies; can be prepared that have the binding specificity of a target antigen.
  • variable regions of VH and VL of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art.
  • framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis.
  • human VH and VL chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent VH and VL sequences as search queries. Human VH and VL acceptor genes are then selected.
  • the CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
  • residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions can be used to substitute for the corresponding residues in the human acceptor genes.
  • a single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region.
  • a flexible linker is incorporated between the two variable regions.
  • techniques described for the production of single chain antibodies can be adapted to produce a phage or yeast scFv library and scFv clones specific to a PKal can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that inhibits PKal activity.
  • Some antibodies can be produced in bacterial cells, e.g., E. coli cells (see e.g., Nadkarni, A. et al., 2007 Protein Expr Purif 52(l):219-29).
  • E. coli cells see e.g., Nadkarni, A. et al., 2007 Protein Expr Purif 52(l):219-29.
  • the Fab is encoded by sequences in a phage display vector that includes a suppressible stop codon between the display entity and a bacteriophage protein (or fragment thereof)
  • the vector nucleic acid can be transferred into a bacterial cell that cannot suppress a stop codon.
  • the Fab is not fused to the gene III protein and is secreted into the periplasm and/or media.
  • Antibodies can also be produced in eukaryotic cells.
  • the antibodies e.g., scFv's
  • a yeast cell such as Pichia
  • the antibodies are expressed in a yeast cell such as Pichia
  • Pichia see, e.g., Powers et al., 2001, J. Immunol. Methods. 251: 123-35; Schoonooghe S. et al., 2009 BMC Biotechnol. 9:70; Abdel-Salam, HA. et al., 2001 Appl Microbiol Biotechnol 56(1- 2): 157-64; Takahashi K. et al., 2000 Biosci Biotechnol Biochem 64(10):2138-44; Edqvist, J.
  • osmolarity see e.g., Dragosits, M. et al., 2010 BMC Genomics 11:207
  • temperature see e.g., Dragosits, M. et al., 2009 J Proteome Res. 8(3): 1380-92
  • fermentation conditions see e.g., Ning, D. et al. 2005 J. Biochem. and Mol. Biol. 38(3): 294-299
  • strain of yeast see e.g., Kozyr, AV et al. 2004 Mol Biol (Mosk) 38(6): 1067-75; Horwitz, AH.
  • antibodies are produced in mammalian cells.
  • Preferred mammalian host cells for expressing the clone antibodies or antigen-binding fragments thereof include Chinese Hamster Ovary (CHO cells) (including dhfr- CHO cells, described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216- 4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol. 159:601 621), lymphocytic cell lines, e.g., NS0 myeloma cells and SP2 cells, COS cells, HEK293T cells (J. Immunol. Methods (2004) 289(l-2):65-80), and a cell from a transgenic animal, e.g., a transgenic mammal.
  • the cell is a mammary epithelial cell.
  • plasma kallikrein binding antibodies are produced in a plant or cell-free based system (see e.g., Galeffi, P., et al., 2006 J Transl Med 4:39).
  • the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Patent Nos. 4,399,216, 4,634,665 and 5,179,017).
  • the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • Preferred selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhff host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhff CHO cells by calcium phosphate-mediated transfection.
  • the antibody heavy and light chain genes are each operatively linked to
  • enhancer/promoter regulatory elements e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/ AdMLP promoter regulatory element or an SV40 enhancer/ AdMLP promoter regulatory element
  • the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
  • the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and intact antibody is recovered from the culture medium. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium. For example, some antibodies can be isolated by affinity
  • the antibody production system may produce antibodies in which the Fc region is glycosylated.
  • the Fc domain of IgG molecules is glycosylated at asparagine 297 in the CH2 domain.
  • This asparagine is the site for modification with biantennary-type oligosaccharides. It has been demonstrated that this glycosylation is required for effector functions mediated by Fcg receptors and complement Clq (Burton and Woof, 1992, Adv. Immunol. 51: 1- 84; Jefferis et al., 1998, Immunol. Rev. 163:59-76).
  • the Fc domain is produced in a mammalian expression system that appropriately
  • the Fc domain can also include other eukaryotic post-translational modifications.
  • Antibodies can also be produced by a transgenic animal.
  • U.S. Pat. No. 5,849,992 describes a method of expressing an antibody in the mammary gland of a transgenic mammal.
  • a transgene is constructed that includes a milk- specific promoter and nucleic acids encoding the antibody of interest and a signal sequence for secretion.
  • the milk produced by females of such transgenic mammals includes, secreted-therein, the antibody of interest.
  • the antibody can be purified from the milk, or for some applications, used directly.
  • An antibody as described herein can be present in a composition, e.g. , a pharmaceutically acceptable composition or pharmaceutical composition.
  • the antibody as described herein e.g., DX-2930
  • 30 mg- 400 mg of DX-2930 antibody are present in a composition, optionally with a pharmaceutically acceptable carrier, e.g. , a pharmaceutically acceptable composition or pharmaceutical composition.
  • 30 mg, 100 mg, 150 mg, 300 mg, or 400 mg of DX-2930 antibody are present in a composition optionally with a pharmaceutically acceptable carrier, e.g. , a pharmaceutically acceptable composition or pharmaceutical composition.
  • a pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for subcutaneous, intravenous, intramuscular, parenteral, spinal, or epidermal administration (e.g., by injection or infusion), although carriers suitable for inhalation and intranasal administration are also contemplated.
  • the pharmaceutically acceptable carrier is one or more of sodium phosphate, citric acid, histidine, sodium chloride, and Tween 80.
  • the carrier is suitable for subcutaneous, intravenous, intramuscular, parenteral, spinal, or epidermal administration (e.g., by injection or infusion), although carriers suitable for inhalation and intranasal administration are also contemplated.
  • the pharmaceutically acceptable carrier is one or more of sodium phosphate, citric acid, histidine, sodium chloride, and Tween 80.
  • the pharmaceutically acceptable carrier is one or more of sodium
  • the pharmaceutically acceptable carrier is sodium phosphate, citric acid, histidine, sodium chloride, and Tween 80.
  • the antibody such as DX-2930, is formulated in 30 mM sodium phosphate, 8.6 mM citric acid, 50 mM histidine, 90 mM sodium chloride, 0.01% Tween 80, pH 6.0.
  • the composition comprises or consists of 100 mg DX-2930 per 1 mL solution of 30 mM sodium phosphate, 8.6 mM citric acid, 50 mM histidine, 90 mM sodium chloride, 0.01% Tween 80.
  • a pharmaceutically acceptable salt is a salt that retains the desired biological activity of the compound and does not impart any undesired toxicological effects (see e.g. , Berge, S.M., et al., 1977, J. Pharm. Sci. 66: 1-19).
  • Examples of such salts include acid addition salts and base addition salts.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous, and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids, and the like.
  • nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous, and the like
  • nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids, and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium, and the like, as well as from nontoxic organic amines, such as ⁇ , ⁇ '-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine, and the like.
  • compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
  • the form can depend on the intended mode of administration and therapeutic application.
  • Many compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for administration of humans with antibodies.
  • An exemplary mode of administration is parenteral (e.g.,
  • the plasma kallikrein binding protein is administered by intravenous infusion or injection. In another preferred embodiment, the plasma kallikrein binding protein is
  • the plasma kallikrein binding protein is administered by intraperitoneal injection.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical
  • administration usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the binding protein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • an antibody as described herein can be administered by a variety of methods, including intravenous injection or infusion.
  • the antibody can be administered by intravenous infusion at a rate of less than 30, 20, 10, 5, or 1 mg/min to reach a dose of about 1 to
  • the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
  • a controlled release formulation including implants, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are available. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., 1978, Marcel Dekker, Inc., New York.
  • compositions can be administered with medical devices.
  • a pharmaceutical composition disclosed herein can be administered with a device, e.g., a needleless hypodermic injection device, a pump, or implant.
  • an antibody as described herein can be formulated to ensure proper distribution in vivo.
  • the blood-brain barrier excludes many highly hydrophilic compounds.
  • the therapeutic compounds disclosed herein cross the BBB (if desired) they can be formulated, for example, in liposomes.
  • liposomes For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331.
  • the liposomes may comprise one or more moieties that are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g. , V.V. Ranade, 1989, J. Clin. Pharmacol. 29:685).
  • Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms can be dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody as described herein is 30 mg to 400 mg, or any integer in between, for example, 100-400 mg, 100-300 mg, or 300-400 mg.
  • the therapeutically or prophylactically effective amount is 30 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg.
  • the therapeutically or prophylactically effective amount of an antibody described herein is 30 mg, 100 mg, 150 mg, 300 mg, or 400 mg. In some embodiments, the therapeutically or prophylactically effective amount is 150 mg. In some embodiments, the therapeutically or prophylactically effective amount is 300 mg. In some embodiments, the therapeutically or prophylactically effective amount of an antibody described herein (e.g., DX-2930) is 30 mg, 100 mg, 150 mg, 300 mg, or 400 mg. In some embodiments, the therapeutically or prophylactically effective amount is 150 mg. In some embodiments, the therapeutically or prophylactically effective amount is 300 mg. In some embodiments, the therapeutically or
  • prophylactically effective amount is 400 mg.
  • the therapeutically or prophylactically effective amount is administered at least two times, at least three times, at least four times, at least five times, at least six times, at least seven times, at least eight times, at least nine times, at least ten times, or more. In some embodiments, the therapeutically or
  • prophylactically effective amount is administered every other week (i.e., every two weeks). In some embodiments, the therapeutically or prophylactically effective amount is 300 mg or 400 mg and the amount is administered every two weeks. In some embodiments, the therapeutically or prophylactically effective amount is 300 mg and this amount of the antibody is administered every two weeks. In some embodiments, the therapeutically or prophylactically effective amount is 400 mg and this amount of the antibody is administered every two weeks.
  • treatment of any of the anti-pKal antibody such as DX- 2930 involves a treatment regimen comprising at least a loading period and a maintenance period.
  • the therapeutically or prophylactically effective amount of the antibody for the loading period is 100 to 300 mg (e.g., 150 mg or 300 mg) per each administration.
  • the antibody may be administered every week (e.g. , every week for one, two or three weeks).
  • the loading period is 2 weeks and the antibody is administered at day 0, day 7, and day 14.
  • the therapeutically or prophylactically effective amount for the maintenance period is about 100 to 300 mg (e.g. , 150 mg or 300 mg) per each administration.
  • the antibody can be administered every other week (i.e., every two weeks), every three weeks, or every four weeks (e.g. , every two weeks for ten weeks, resulting in delivery of 5 doses total).
  • the maintenance period may last for 10 weeks and the antibody is administered at day 28, day 42, day 56, day 70, and day 84.
  • the amount is first administered every week for a suitable period (e.g. , every week for one, two or three weeks) and subsequently administered every two to four weeks (e.g., every two, three or four weeks) for a suitable period.
  • a suitable period e.g. , every week for one, two or three weeks
  • two to four weeks e.g., every two, three or four weeks
  • the treatment regimen may further comprise a follow-up period after the maintenance period.
  • the antibody such as DX-2930 may be administered every 2-4 weeks at 100-300 mg, for example 300 mg.
  • the dosage may increase to 400 mg in one or more of the loading period, the maintenance period, and the follow-up period.
  • compositions disclosed herein may include a
  • kits can be provided in a kit, e.g., as a component of a kit.
  • the kit includes (a) a DX-2930 antibody, e.g., a composition (e.g. , a pharmaceutical composition) that includes the antibody, and, optionally (b) informational material.
  • the informational material can be descriptive, instructional, marketing or other material that relates to a method described herein and/or the use of an antibody as described herein (e.g. , DX-2930), e.g. , for a method described herein.
  • the kit comprises one or more doses of DX- 2930.
  • the one or more doses are 30 mg, 100 mg, 150 mg, 300 mg or 400 mg.
  • the informational material of the kit is not limited in its form.
  • the informational material can include information about production of the compound, molecular weight of the compound, concentration, date of expiration, batch or production site information, and so forth.
  • the informational material relates to using the antibody to treat, prevent, or diagnosis of disorders and conditions, e.g., a plasma kallikrein associated disease or condition.
  • the informational material can include instructions to administer n antibody as described herein (e.g. , DX-2930) in a suitable manner to perform the methods described herein, e.g. , in a suitable dose, dosage form, mode of administration or dosing schedule (e.g. , a dose, dosage form, dosing schedule or mode of administration described herein).
  • the informational material can include instructions to administer an antibody as described herein (e.g. , DX-2930) to a suitable subject, e.g. , a human, e.g. , a human having, or at risk for, a plasma kallikrein associated disease or condition.
  • the material can include instructions to administer an antibody as described herein (e.g. , DX-2930) to a patient with a disorder or condition described herein, e.g., a plasma kallikrein associated disease, e.g., according to a dosing schedule described herein.
  • a disorder or condition described herein e.g., a plasma kallikrein associated disease, e.g., according to a dosing schedule described herein.
  • the informational material of the kits is not limited in its form. In many cases, the informational material, e.g., instructions, is provided in print but may also be in other formats, such as computer readable material.
  • An antibody as described herein can be provided in any form, e.g., liquid, dried or lyophilized form. It is preferred that an antibody be substantially pure and/or sterile.
  • the liquid solution preferably is an aqueous solution, with a sterile aqueous solution being preferred.
  • reconstitution generally is by the addition of a suitable solvent.
  • the solvent e.g., sterile water or buffer, can optionally be provided in the kit.
  • the kit can include one or more containers for the composition containing an antibody as described herein (e.g., DX-2930).
  • the kit contains separate containers, dividers or compartments for the composition and informational material.
  • the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in association with the container.
  • the separate elements of the kit are contained within a single, undivided container.
  • the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
  • the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of an antibody as described herein (e.g., DX-2930).
  • the kit includes a plurality of syringes, ampules, foil packets, or blister packs, each containing a single unit dose of an antibody as described herein (e.g., DX-2930).
  • the containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
  • the kit optionally includes a device suitable for administration of the composition, e.g., a syringe, or any such delivery device.
  • the device is an implantable device that dispenses metered doses of the antibody.
  • the disclosure also features a method of providing a kit, e.g., by combining components described herein.
  • the disclosure provides the use of an antibody as described herein (e.g., DX-2930) in treating HAE.
  • an antibody as described herein e.g., DX-2930
  • Hereditary angioedema is also known as "Quincke edema,” CI esterase inhibitor deficiency, CI inhibitor deficiency, and hereditary angioneurotic edema (HANE). HAE is characterized by recurrent episodes of severe swelling (angioedema), which can affect, e.g., the limbs, face, genitals, gastrointestinal tract, and airway.
  • Symptoms of HAE include, e.g., swelling in the arms, legs, lips, eyes, tongue, and/or throat; airway blockage that can involve throat swelling and sudden hoarseness; repeat episodes of abdominal cramping without obvious cause; and/or swelling of the intestines, which can be severe and can lead to abdominal cramping, vomiting, dehydration, diarrhea, pain, and/or shock. About one-third of individuals with this HAE develop a non-itchy rash called erythema marginatum during an attack.
  • Trauma or stress e.g., dental procedures, sickness (e.g., viral illnesses such as colds and the flu), menstruation, and surgery can trigger an attack of angioedema.
  • sickness e.g., viral illnesses such as colds and the flu
  • menstruation e.g., a system for preventing HAE.
  • HAE hypertension
  • patients can attempt to avoid specific stimuli that have previously caused attacks.
  • an attack occurs without a known trigger.
  • HAE symptoms first appear in childhood and worsen during puberty.
  • untreated individuals have an attack every 1 to 2 weeks, and most episodes last for about 3 to 4 days (ghr.nlm.nih.gov/condition/hereditary- angioedema).
  • the frequency and duration of attacks vary greatly among people with hereditary angioedema, even among people in the same family.
  • HAE HAE
  • types I, II, and III HAE
  • HAE HAE affects 1 in 50,000 people
  • type I accounts for about 85 percent of cases
  • type II accounts for about 15 percent of cases
  • type III is very rare.
  • Patients having type I or type II HAE are typically deficient in Cl-INH. Such patients either have a defective Cl-INH gene and thus do not produce Cl-INH, or produce atypical Cl-INH proteins.
  • Type III is the most newly described form and was originally thought to occur only in women, but families with affected males have been identified.
  • Type III HAE is believed to be unassociated with Cl-INH. Patients having type III HAE may have normal Cl-INH proteins.
  • HAE is inherited in an autosomal dominant pattern, such that an affected person can inherit the mutation from one affected parent. New mutations in the gene can also occur, and thus HAE can also occur in people with no history of the disorder in their family. It is estimated that 20-25% of cases result from a new spontaneous mutation. Mutations in the SERPING1 gene cause hereditary angioedema type I and type II.
  • the SERPING1 gene provides instructions for making the CI inhibitor protein, which is important for controlling inflammation. CI inhibitor blocks the activity of certain proteins that promote inflammation. Mutations that cause hereditary angioedema type I lead to reduced levels of CI inhibitor in the blood. In contrast, mutations that cause type II result in the production of a CI inhibitor that functions abnormally.
  • bradykinin Without the proper levels of functional CI inhibitor, excessive amounts of bradykinin are generated. Bradykinin promotes inflammation by increasing the leakage of fluid through the walls of blood vessels into body tissues. Excessive accumulation of fluids in body tissues causes the episodes of swelling seen in individuals with hereditary angioedema type I and type II.
  • Mutations in the F12 gene are associated with some cases of hereditary angioedema type III.
  • the F12 gene provides instructions for making coagulation factor XII.
  • factor XII is also an important stimulator of inflammation and is involved in the production of bradykinin.
  • Certain mutations in the F12 gene result in the production of factor XII with increased activity. As a result, more bradykinin is generated and blood vessel walls become more leaky, which leads to episodes of swelling.
  • the cause of other cases of hereditary angioedema type III remains unknown. Mutations in one or more as-yet unidentified genes may be responsible for the disorder in these cases.
  • HAE can present similarly to other forms of angioedema resulting from allergies or other medical conditions, but it differs significantly in cause and treatment.
  • hereditary angioedema is misdiagnosed as an allergy, it is most commonly treated with antihistamines, steroids, and/or epinephrine, which are typically ineffective in HAE, although epinephrine can be used for life-threatening reactions.
  • Misdiagnoses have also resulted in unnecessary exploratory surgery for patients with abdominal swelling, and in some HAE patients abdominal pain has been incorrectly diagnosed as psychosomatic.
  • CI inhibitor therapies as well as other therapies for HAE, are described in Kaplan, A.P., J Allergy Clin Immunol, 2010, 126(5):918-925.
  • Acute treatment of HAE attacks is provided to halt progression of the edema as quickly as possible.
  • CI inhibitor concentrate from donor blood which is administered intravenously, is one acute treatment; however, this treatment is not available in many countries.
  • fresh frozen plasma FFP can be used as an alternative, as it also contains CI inhibitor.
  • C I inhibitor Purified C I inhibitor, derived from human blood, has been used in Europe since 1979. Several C I inhibitor treatments are now available in the U.S. and two C I inhibitor products are now available in Canada. Berinert P (CSL Behring), which is pasteurized, was approved by the F.D.A. in 2009 for acute attacks. Cinryze
  • Rhucin is a recombinant CI inhibitor under development that does not carry the risk of infectious disease transmission due to human blood-borne pathogens.
  • Treatment of an acute HAE attack also can include medications for pain relief and/or IV fluids.
  • Treatment modalities can stimulate the synthesis of CI inhibitor, or reduce CI inhibitor consumption.
  • Androgen medications such as danazol, can reduce the frequency and severity of attacks by stimulating production of CI inhibitor.
  • Helicobacter pylori can trigger abdominal attacks. Antibiotics to treat h. pylori will decrease abdominal attacks.
  • Ecallantide KALBITOR ® , DX- 88, Dyax
  • Icatibant FIRAZYR ® , Shire
  • Diagnosis of HAE can rely on, e.g., family history and/or blood tests.
  • HAE types I, II, and III Laboratory findings associated with HAE types I, II, and III are described, e.g., in Kaplan, A.P., J Allergy Clin Immunol, 2010, 126(5):918-925.
  • type I HAE the level of C I inhibitor is decreased, as is the level of C4, whereas C lq level is normal.
  • type II HAE the level of C I inhibitor is normal or increased; however, C I inhibitor function is abnormal.
  • C4 level is decreased and C lq level is normal.
  • type III the levels of CI inhibitor, C4, and Clq can all be normal.
  • Symptoms of HAE can be assessed, for example, using questionnaires, e.g., questionnaires that are completed by patients, clinicians, or family members. Such questionnaires are known in the art and include, for example, visual analog scales. See, e.g. , McMillan, C.V. et al. Patient. 2012;5(2): 113-26. Treating HAE with anti-PKal antibodies
  • an antibody described herein e.g., a therapeutically effective amount of an antibody described herein
  • a subject having or suspected of having HAE e.g., according to a dosing schedule described herein.
  • methods of treating HAE by administering an antibody described herein (e.g., a therapeutically effective amount of an antibody described herein), e.g. , according to a dosing schedule described herein, or in combination with a second therapy, e.g., with one other agent, e.g., described herein.
  • the disclosure also provides methods of preventing HAE or a symptom thereof by administering an antibody described herein (e.g., a prophylactically effective amount of an antibody described herein) to a subject at risk of developing HAE (e.g., a subject having a family member with HAE or a genetic predisposition thereto), e.g. , according to a dosing schedule described herein.
  • an antibody described herein e.g., a prophylactically effective amount of an antibody described herein
  • a subject at risk of developing HAE e.g., a subject having a family member with HAE or a genetic predisposition thereto
  • the subject may be a human patient who has no HAE symptoms at the time of the treatment.
  • Treating includes administering an amount effective to alleviate, relieve, alter, remedy, ameliorate, improve or affect the disorder, the symptoms of the disorder or the predisposition toward the disorder.
  • the treatment may also delay onset, e.g., prevent onset, or prevent deterioration of a disease or condition.
  • Suitable dosages of the antibody used can depend on the age and weight of the subject and the particular drug used.
  • the antibody can be used as competitive agents to inhibit, reduce an undesirable interaction, e.g., between plasma kallikrein and its substrate (e.g., Factor XII or HMWK).
  • the dose of the antibody can be the amount sufficient to block 90%, 95%, 99%, or 99.9% of the activity of plasma kallikrein in the patient, especially at the site of disease. This may require 30 mg, 100 mg, 300 mg, or 400 mg, e.g., administered every two weeks.
  • the antibodies are used to inhibit an activity (e.g., inhibit at least one activity of plasma kallikrein, e.g., reduce Factor Xlla and/or bradykinin production) of plasma kallikrein, e.g., in vivo.
  • the binding proteins can be used by themselves or conjugated to an agent, e.g., a cytotoxic drug, cytotoxin enzyme, or radioisotope.
  • the antibodies can be used directly in vivo to eliminate antigen-expressing cells via natural complement-dependent cytotoxicity (CDC) or antibody dependent cellular cytotoxicity (ADCC).
  • the antibodies described herein can include complement binding effector domain, such as the Fc portions from IgGl, -2, or -3 or corresponding portions of IgM which bind complement.
  • a population of target cells is ex vivo treated with an antibody described herein and appropriate effector cells. The treatment can be supplemented by the addition of complement or serum containing complement.
  • phagocytosis of target cells coated with an antibody described herein can be improved by binding of complement proteins.
  • cells coated with the antibody which includes a complement binding effector domain are lysed by complement.
  • the antibodies can be used as competitive agents to inhibit or reduce an undesirable interaction, e.g., between a natural or pathological agent and the plasma kallikrein.
  • a therapeutically effective amount of an antibody as described herein can be administered to a subject having, suspected of having, or at risk for HAE, thereby treating (e.g., ameliorating or improving a symptom or feature of a disorder, slowing, stabilizing and/or halting disease progression) the disorder.
  • the antibody described herein can be administered in a therapeutically effective amount.
  • a therapeutically effective amount of an antibody is the amount which is effective, upon single or multiple dose administration to a subject, in treating a subject, e.g., curing, alleviating, relieving or improving at least one symptom of a disorder in a subject to a degree beyond that expected in the absence of such treatment.
  • Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the DX-2930 antibody is administered by multiple doses such as once every 2 weeks, once every 3 weeks, once every four weeks, once every 6 weeks, once every 8 weeks or less frequent.
  • Each of the multiple doses can be 30 mg, 100 mg, 150 mg, 300 mg, 350 mg. or 400 mg.
  • a patient may be given multiple doses once every 2 weeks, for a suitable period of time.
  • DX-2930 can be administered at 300 mg or 400 mg every two weeks.
  • DX-2930 can be administered at 300 mg or 400 mg every four weeks.
  • DX-2930 can be administered at 150 mg every four weeks.
  • a subject treated by DX-2930 for multiple doses as described herein may be followed up with a maintenance treatment.
  • a subject may be treated by DX-2930 for multiple doses in a loading period and then followed up with a maintenance period.
  • the subject may be treated with DX-2930 at about 100 mg to about 400 mg (e.g. , 100-300 mg or 150-300 mg, for example, 100 mg, 150 mg, 200 mg, 300 mg, or 400 mg) once every 2-4 weeks (for example, every 2 weeks, every 3 weeks, or every 4 weeks) for a suitable period.
  • the subject may be treated with DX-2930 at about 100 mg to about 300 mg (e.g., 100-300 mg or 150-300 mg, for example, 100 mg, 150 mg, 200 mg, or 300 mg) once every 2-4 weeks (for example, every 2 weeks, every 3 weeks, or every 4 weeks) for a suitable period.
  • 100 mg to about 300 mg e.g., 100-300 mg or 150-300 mg, for example, 100 mg, 150 mg, 200 mg, or 300 mg
  • 2-4 weeks for example, every 2 weeks, every 3 weeks, or every 4 weeks
  • the patient can be monitored for side effects (e.g., elevation of creatine phosphatase levels) and/or inhibition levels of pKal by the antibody (e.g. , serum or plasma concentration of the antibody or the pKal activity level) before and after the treatment or during the course of treatment. If adverse effect is observed, the dose of the antibody might be reduced or the treatment might be terminated. If the inhibition level is below a minimum therapeutic level, further doses of the antibody might be administered to the patient.
  • the plasma or serum concentration of the antibody e.g., DX-2930
  • the plasma or serum concentration of the antibody may be measured by determining the protein level of the antibody in a plasma or serum sample obtained from the subject, e.g., by an immune assay or MS assay.
  • the plasma or serum concentration of the antibody may also be measured by determining the inhibitory level of pKal in a plasma or serum sample obtained from a subject treated with the antibody.
  • assays may include the synthetic substrate assay or the Western blot assay for measuring cleaved kininogen as described herein.
  • the plasma or serum level of creatine kinase can be monitored during the course of the treatment. If the plasma or serum level of creatine kinase is found to elevate during the treatment, the dosage of the antibody may be reduced or the treatment may be terminated.
  • an optimal dosage e.g., optimal prophylactic dosage or optimal therapeutic dosage
  • the antibody e.g., DX-2930
  • the antibody is given to a subject in need of the treatment at an initial dose.
  • the plasma concentration of the antibody in the subject is measured. If the plasma concentration is lower than 80 nM, the dose of the antibody is increased in a subsequent administration.
  • a dosage of the antibody that maintains the antibody plasma concentration above about 80 nM can be chosen as the optimal dosage for the subject.
  • the creatine phosphokinase level of the subject can be monitored during the course of treatment and the optimal dosage for that subject can be further adjusted based on the creatine phosphokinase level, e.g., the dosage of the antibody might be reduced is elevation of creatine phosphokinase is observed during treatment.
  • the antibody such as DX-2930 is administered to reduce the level of cleaved kininogen to levels comparable to healthy subjects.
  • any of the antibodies disclosed herein, such as DX- 2930 and its functional variants may be used to prevent HAE attack or reduce the rate of HAE attack in human patients having history of HAE attack.
  • the human patients experienced at least two HAE attacks per year and optionally at least one within the 6 months prior to the treatment.
  • the human patients experienced at least two HAE attacks within 3 months prior to the treatment.
  • the human patients had at least 9 HAE attacks within 3 months prior to the treatment and optionally at least 25 attacks (e.g., 36 attacks) within 12 months prior to the treatment.
  • an antibody as described herein can be administered in combination with one or more of the other therapies for treating a disease or condition associated with plasma kallikrein activity, e.g. , a disease or condition described herein.
  • an antibody as described herein e.g. , DX-2930
  • plasma kallikrein inhibitors that can be used in combination therapy with a plasma kallikrein binding antibodies described herein include plasma kallikrein inhibitors described in, e.g. , WO 95/21601 or WO 2003/103475.
  • One or more plasma kallikrein inhibitors can be used in combination with an antibody as described herein (e.g. , DX-2930).
  • an antibody as described herein e.g. , DX-2930.
  • the combination can result in a lower dose of the inhibitor being needed, such that side effects are reduced.
  • An antibody as described herein can be administered in combination with one or more current therapies for treating HAE.
  • DX- 2930 antibody can be co-used with a second anti-HAE therapeutic agent such as ecallantide, a C I esterase inhibitor (e.g. , CINRYZETM), aprotinin (TRASYLOL®), and/or a bradykinin B2 receptor inhibitor (e.g. , icatibant (FIRAZYR ® )).
  • a second anti-HAE therapeutic agent such as ecallantide, a C I esterase inhibitor (e.g. , CINRYZETM), aprotinin (TRASYLOL®), and/or a bradykinin B2 receptor inhibitor (e.g. , icatibant (FIRAZYR ® )).
  • the term “combination” refers to the use of the two or more agents or therapies to treat the same patient, wherein the use or action of the agents or therapies overlaps in time.
  • the agents or therapies can be administered at the same time (e.g. , as a single formulation that is administered to a patient or as two separate
  • a combination can include administering a second agent at a dosage at least 10, 20, 30, or 50% lower than would be used in the absence of the plasma kallikrein binding antibody.
  • a combination therapy can include administering an agent that reduces the side effects of other therapies.
  • the agent can be an agent that reduces the side effects of a plasma kallikrein associated disease treatment.
  • Example 1 A Phase lb, Double-Blind, Multiple Ascending Dose Study to Assess
  • One patient in the 400 mg group received only one dose and then was unavailable for the second dose and was replaced. The replacement patient was also unable to complete the study for reasons not related to the study, resulting a total of 10 patients completing the 400 mg dose and being included in the assessment.
  • Plasma was collected at time points following administration out to day 120 (15 weeks), except in the group that received the 400 mg dose, where data was available up to day 50. Analyses included safety, pharmacokinetics, pharmacodynamics (biomarkers), and efficacy.
  • the drug group and the placebo group were baled in terms of age, race, ethnicity, and BMI, although there were slightly more females present in the DX-2930 (67%) vs placebo (54%) groups.
  • DX-2930 drug levels were measured in plasma by a validated immunoassay that used an anti-idiotypic antibody against DX-2930 (M293-D02). From the plot of mean plasma drug levels for each dose group versus days following DX-2930 administration, it was evident that drug levels were dose dependent and exhibited a prolonged half-life, typical of a human monoclonal antibody. Key pharmacokinetic observations are summarized in Table 2 and Figure 1. First, C max drug levels increased with increasing dose, as expected. In addition, the T max following the second dose was about 20 days and the half-life was approximately 14 days. These parameters were consistent with values obtained in a phase la study in healthy volunteers and supported either once or twice a month dosing.
  • the first PD assay provides a measure of the bioactivity of DX-2930 in citrated plasma obtained from treated patients at the same time points following dosing as used to determine the pharmacokinetic properties of DX-2930.
  • This assay measured the amount of active plasma kallikrein that is generated in diluted plasma after activation of the contact pathway.
  • dilute plasma was spiked with active Factor Xlla (FXIIa) which propagates the enzymatic cascade of the contact pathway, after 2 minutes the FXIIa inhibitor Corn Trypsin Inhibitor was added to stop the reaction, and the amount of active plasma kallikrein present in the sample was measured by its ability to hydrolyze a pro- fluorescent synthetic peptide substrate.
  • FXIIa active Factor Xlla
  • Corn Trypsin Inhibitor was added to stop the reaction
  • the amount of active plasma kallikrein present in the sample was measured by its ability to hydrolyze a pro- fluorescent synthetic peptide substrate.
  • the presence of increasing levels of DX-2930 in the plasma of treated healthy volunteers (phase la study) or HAE patients (phase lb study) was associated with a dose dependent reduction in the observed plasma kallikrein enzymatic rate ( Figure 2).
  • the percent inhibition observed at each time point was calculated relative to the amount of plasma kallikrein activity in the pre-
  • HAE patients are deficient in CI -Inhibitor, the endogenous inhibitor of plasma kallikrein. As a result, these patients have elevated active plasma kallikrein, which converts its 1 -chain high molecular weight kininogen substrate to 2-chain and bradykinin, the key mediator of pain and edema in HAE.
  • DX-2930 is a highly potent inhibitor of active plasma kallikrein that blocks 2-chain and bradykinin generation.
  • FIG. 3 shows the %2-chain that was observed in HAE patient plasma collected in the presence of protease inhibitors (SCAT 169 plasma).
  • SCAT 169 plasma protease inhibitors
  • this level of 2-chain was expected to closely match that of endogenous levels in HAE patients in in the phase lb trial (27%) and in healthy volunteers (12%).
  • DX-2930 treated HAE patients exhibited lower 2-chain levels as measured in samples collected either 8 or 22 days after dosing.
  • FIG. 5 shows that citrated plasma from DX-2930 dosed HAE patients exhibited less 2-chain following ex vivo activation with coagulation factor Xlla (FXIIa).
  • the 300 and 400 mg dose groups reduced the amount of 2-chain to a level below that observed in healthy volunteers. This ex vivo activation may be considered an in vitro model of a severe HAE attack.
  • TEAE Treatment Emergent Adverse Events. An AE is treatment emergent if the onset time is after administration of study drug through the Day 120 post dose final follow-up visit, or in the event that onset time precedes study drug administration, the AE increases in severity during the 120 day post dose follow-up period. **
  • Treatment-related AEs Relatedness of AEs to study drug was assessed by a blinded investigator.
  • a prospective primary efficacy analysis was performed, which focused on the 300 and 400 mg doses of DX-2930, individually and combined, compared to placebo.
  • a six week primary assessment period (Day 8 to Day 50) was used ( Figure 6A and 6B), as PK modeling from phase la suggested notable drug exposure during this time interval.
  • the primary analysis focused upon subjects with a minimum baseline history of at least 2 attacks in the past 3 months. Most of the subjects fulfilled the minimum required baseline history of at least 2 attacks in the past 3 months. Of the 13 placebo subjects, 11 met this requirement. Of the 16 subjects treated with 300 or 400 mg DX-2930, 15 met this requirement.
  • the baseline HAE attack rates in the placebo, 300 mg, and 400 mg groups were 0.39, 0.33, and 0.55 attacks per week, respectively.
  • the baseline rate in the combined 300 and 400 mg group was 0.49 attacks per week.
  • the primary approach was an intent-to-treat (ITT) analysis.
  • ITT intent-to-treat
  • ANOVA analysis of variance
  • the read-out was expressed as a percent reduction in HAE attacks by DX-2930 in comparison to the placebo attack rates, and p values were calculated.
  • Results of the efficacy assessment are shown in Table 4 and 5 and in Figure 7, which both show a reduction in HAE attack rate with the 300 and 400 mg doses of DX-2930, individually and combined, compared to the placebo.
  • 13 of the 15 DX-2930 subjects treated with 300 or 400 mg were attack-free for the duration of the study, whereas for the placebo group, only 3 of the 11 subjects were attack-free.
  • mITT modified intent-to-treat
  • the ITT population was used except 2 subjects were excluded (one subject that did not receive 2 administrations and 1 subject that did not have HAE type 1 or type 2).
  • Results of the modified analysis are shown in Table 7.
  • the 300 mg DX-2930 group had a 100% reduction in attacks with a p value of less than 0.0001.
  • the 400 mg DX- 2930 group had a 95% reduction in attacks with a p value of 0.0022.
  • the combined 300 and 400 mg DX-2930 group had a 97% reduction in HAE attacks, with a p value of 0.0007.
  • MITT population excludes 2 subjects, one subject without type I or II HAE and one subject who received only 1 administration of DX-2930.
  • DX-2930 the therapeutic effects of DX-2930 were also observed in HAE patients with high baseline attack rates were explored. Subjects with at least 9 attacks in the past 3 months prior to dosing were identified and evaluated. There were 6 such subjects- 1 treated with placebo, 1 treated with 300 mg DX-2930, and 4 treated with 400 mg DX-2930.
  • this study shows (a) that there were no apparent safety signals for DX-2930, (b) that the PK profile was consistent overall with a monoclonal antibody and supported a regimen of dosing once every 2 weeks or even less frequently, (c) that pharmacodynamic data demonstrated that DX-2930 normalizes the aberrant instability of HAE plasma, at least in the context of the kininogen biomarker assays, and (d) that a highly statistically significant finding of HAE attack prevention by DX- 2930 was observed. Specifically, in comparison to placebo, there were 100% and 88% reduction in attacks by the 300 and 400 mg DX-2930 treatment groups respectively. This clinical effect was logically associated with drug exposure over time and was also observed in the subset of patients with high baseline attack rates.
  • HAE hereditary angioedema
  • pKal plasma kallikrein
  • HMWK high-molecular-weight kininogen
  • Hereditary Angioedema DX-2930 is a human monoclonal antibody inhibitor of plasma kallikrein in development for the prevention of hereditary angioedema (HAE) attacks.
  • HAE hereditary angioedema
  • Placebo-treated subjects reported HAE attacks throughout the study (9 subjects, 65 HAE attacks).
  • HAE attacks were reported prior to or just after initial dosing.
  • drug levels were high (Day 8 to 50), all but 1 subject was attack-free.
  • drug levels waned, attacks re-emerged.
  • DX-2930 is a human monoclonal antibody inhibitor of plasma kallikrein in development for the prevention of hereditary angioedema (HAE) attacks.
  • HAE hereditary angioedema
  • KKS plasma kallikrein kinin system
  • HAE hereditary angioedema
  • KKS-associated diseases including neuropathic pain, systemic lupus erythrmatosus, and systemic mastocytosis.
  • treatment with a pKal inhibitor, such as DX-2930 may reduce the risk for the development of such a KKS-associated disease.
  • Example 6 A Double-Blind Study including a Load Period and a Maintenance
  • a randomized, double-blind, placebo-controlled, parallel arm study is carried out. Patients are selected for having HAE type I or II patients with at least 1 attack per 4 weeks. A run-in period is used to evaluate baseline HAE attack rate. The patients are subjected to a 1: 1: 1 randomization into 3 different treatment arms (300 mg DX-2930, 150 mg DX-2930, or placebo) which are administered by subcutaneous injection. The study is designed with a load period and a maintenance period ( Figure 14). Subjects are treated on Days 0, 7, and 14 during the loading period, followed by dosing every 2 weeks during the maintenance period (Days 28, 42, 56, 70, and 84).
  • inventive embodiments may be practiced otherwise than as specifically described and claimed.
  • Inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein.
  • any combination of two or more such features, systems, articles, materials, kits, and/or methods, if such features, systems, articles, materials, kits, and/or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure.
  • a reference to "A and/or B", when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
  • the phrase "at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
  • This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase "at least one" refers, whether related or unrelated to those elements specifically identified.
  • At least one of A and B can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Dermatology (AREA)
  • Inorganic Chemistry (AREA)
  • Endocrinology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2016/024921 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack Ceased WO2016160926A1 (en)

Priority Applications (23)

Application Number Priority Date Filing Date Title
HK18110329.1A HK1250995A1 (zh) 2015-03-30 2016-03-30 血浆激肽释放酶抑制剂及预防遗传性血管神经性水肿发作的用途
EA201792161A EA201792161A1 (ru) 2015-03-30 2016-03-30 Ингибиторы калликреинов плазмы и их применение для профилактики приступа наследственного ангионевротического отека
EP16774069.5A EP3286226A4 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
JP2017549388A JP7008920B2 (ja) 2015-03-30 2016-03-30 血漿カリクレイン阻害剤および遺伝性血管浮腫発作を予防するためのその使用
KR1020177031279A KR102607829B1 (ko) 2015-03-30 2016-03-30 혈장 칼리크레인 저해제 및 유전성 혈관부종 발작을 예방하기 위한 이의 용도
NZ735659A NZ735659B2 (en) 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
IL254292A IL254292B1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and their uses for preventing the onset of hereditary angioedema
IL305207A IL305207A (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and their uses to prevent the outbreak of hereditary angioedema
KR1020257012913A KR20250057946A (ko) 2015-03-30 2016-03-30 혈장 칼리크레인 저해제 및 유전성 혈관부종 발작을 예방하기 위한 이의 용도
CA2979713A CA2979713A1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
KR1020237040648A KR102799778B1 (ko) 2015-03-30 2016-03-30 혈장 칼리크레인 저해제 및 유전성 혈관부종 발작을 예방하기 위한 이의 용도
CN201680018200.7A CN107614532A (zh) 2015-03-30 2016-03-30 血浆激肽释放酶抑制剂及其预防遗传性血管性水肿发作的用途
AU2016243160A AU2016243160B2 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
MX2017012423A MX2017012423A (es) 2015-03-30 2016-03-30 Inhibidores de calicreina plasmatica y uso de los mismos para prevenir el ataque del angioedema hereditario.
US15/562,671 US20180298110A1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
EP21167802.4A EP3916020A1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
BR112017020864-4A BR112017020864A2 (en) 2015-03-30 2016-03-30 plasma kallikrein inhibitors and their uses for the prevention of hereditary angioedema attack
CONC2017/0009404A CO2017009404A2 (es) 2015-03-30 2017-09-15 Inhibidores de calicreina plasmática y uso de los mismos para prevenir el ataque del angioedema hereditario
US17/500,214 US20220169749A1 (en) 2015-03-30 2021-10-13 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
JP2021204200A JP7309836B2 (ja) 2015-03-30 2021-12-16 血漿カリクレイン阻害剤および遺伝性血管浮腫発作を予防するためのその使用
AU2022203180A AU2022203180B2 (en) 2015-03-30 2022-05-12 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
JP2023110592A JP2023130442A (ja) 2015-03-30 2023-07-05 血漿カリクレイン阻害剤および遺伝性血管浮腫発作を予防するためのその使用
AU2025271115A AU2025271115A1 (en) 2015-03-30 2025-11-21 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201562140289P 2015-03-30 2015-03-30
US201562140277P 2015-03-30 2015-03-30
US62/140,289 2015-03-30
US62/140,277 2015-03-30
US201562214293P 2015-09-04 2015-09-04
US62/214,293 2015-09-04

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/562,671 A-371-Of-International US20180298110A1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
US17/500,214 Continuation US20220169749A1 (en) 2015-03-30 2021-10-13 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack

Publications (1)

Publication Number Publication Date
WO2016160926A1 true WO2016160926A1 (en) 2016-10-06

Family

ID=57005262

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/024921 Ceased WO2016160926A1 (en) 2015-03-30 2016-03-30 Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack

Country Status (14)

Country Link
US (2) US20180298110A1 (cg-RX-API-DMAC7.html)
EP (2) EP3286226A4 (cg-RX-API-DMAC7.html)
JP (3) JP7008920B2 (cg-RX-API-DMAC7.html)
KR (3) KR102607829B1 (cg-RX-API-DMAC7.html)
CN (1) CN107614532A (cg-RX-API-DMAC7.html)
AU (3) AU2016243160B2 (cg-RX-API-DMAC7.html)
BR (1) BR112017020864A2 (cg-RX-API-DMAC7.html)
CA (1) CA2979713A1 (cg-RX-API-DMAC7.html)
CO (1) CO2017009404A2 (cg-RX-API-DMAC7.html)
EA (1) EA201792161A1 (cg-RX-API-DMAC7.html)
HK (1) HK1250995A1 (cg-RX-API-DMAC7.html)
IL (2) IL305207A (cg-RX-API-DMAC7.html)
MX (2) MX2017012423A (cg-RX-API-DMAC7.html)
WO (1) WO2016160926A1 (cg-RX-API-DMAC7.html)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017100679A1 (en) * 2015-12-11 2017-06-15 Dyax Corp. Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
WO2019028362A1 (en) * 2017-08-04 2019-02-07 Dyax Corp. INHIBITORS OF PLASMATIC KALLIKREIN AND USES THEREOF
US10336832B2 (en) 2010-01-06 2019-07-02 Dyax Corp. Methods of inhibiting plasma kallikrein in edema patient
US10370453B2 (en) 2011-01-06 2019-08-06 Dyax Corp. Plasma kallikrein binding proteins
WO2019166572A1 (en) * 2018-02-28 2019-09-06 Pharming Intellectual Property B.V. Pharmaceutical system for transdermal administration of a c1 -esterase inhibitor
US10428158B2 (en) 2014-03-27 2019-10-01 Dyax Corp. Compositions and methods for treatment of diabetic macular edema
WO2020047352A1 (en) * 2018-08-30 2020-03-05 Dyax Corp. Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
US11084884B2 (en) 2014-01-21 2021-08-10 Takeda Pharmaceutical Company Limited Plasma kallikrein binding proteins and uses thereof in treating hereditary angioedema
US11299553B2 (en) 2013-03-15 2022-04-12 Takeda Pharmaceutical Company Limited Anti-plasma kallikrein antibodies

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112019005167A2 (pt) * 2016-09-16 2019-07-02 Dyax Corp. método e kit para analisar uma amostra
CA3092538A1 (en) * 2018-02-28 2019-09-06 Lifesci Pharmaceuticals, Inc. Treatment of hereditary angioedema
CN114166924B (zh) * 2021-12-03 2024-11-22 中国医学科学院北京协和医院 尿液蛋白标志物在诊断遗传性血管水肿中的用途

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014113712A1 (en) * 2013-01-20 2014-07-24 Dyax Corp. Evaluation and treatment of bradykinin-mediated disorders
WO2014152232A2 (en) * 2013-03-15 2014-09-25 Dyax Corp. Anti-plasma kallikrein antibodies

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US5374548A (en) 1986-05-02 1994-12-20 Genentech, Inc. Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor
MX9203291A (es) 1985-06-26 1992-08-01 Liposome Co Inc Metodo para acoplamiento de liposomas.
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US4881175A (en) 1986-09-02 1989-11-14 Genex Corporation Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
CA2103059C (en) 1991-06-14 2005-03-22 Paul J. Carter Method for making humanized antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
ES2227545T3 (es) 1994-01-11 2005-04-01 Dyax Corporation Proteinas y sus analogos del "dominio de kunitz" inhibidores de calicreina.
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
DE60333758D1 (de) 2002-06-07 2010-09-23 Dyax Corp Prevention und Verringerung von Ischemia
US7132100B2 (en) * 2002-06-14 2006-11-07 Medimmune, Inc. Stabilized liquid anti-RSV antibody formulations
SI3459564T1 (sl) * 2010-01-06 2022-06-30 Takeda Pharmaceutical Company Limited Proteini, ki vežejo plazemski kalikrein
JP2014506257A (ja) * 2011-01-06 2014-03-13 ダイアックス コーポレーション 血漿カリクレイン結合タンパク質
WO2012151247A2 (en) * 2011-05-02 2012-11-08 Millennium Pharmaceuticals, Inc. FORMULATION FOR ANTI-α4β7 ANTIBODY
US9216219B2 (en) * 2012-06-12 2015-12-22 Novartis Ag Anti-BAFFR antibody formulation
KR20140119396A (ko) * 2013-03-29 2014-10-10 삼성전자주식회사 단백질 약물의 액상 제형
AU2014340450B2 (en) * 2013-10-21 2020-05-21 Takeda Pharmaceutical Company Limited Assays for determining plasma kallikrein system biomarkers
EA038532B1 (ru) * 2014-01-21 2021-09-10 Такеда Фармасьютикал Компани Лимитед Способ лечения наследственного ангионевротического отека (hae)

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014113712A1 (en) * 2013-01-20 2014-07-24 Dyax Corp. Evaluation and treatment of bradykinin-mediated disorders
WO2014152232A2 (en) * 2013-03-15 2014-09-25 Dyax Corp. Anti-plasma kallikrein antibodies

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CHYUNG ET AL.: "A phase 1 study investigating DX-2930 in healthy subjects''.", ANN ALLERGY ASTHMA IMMUNOL., vol. 113, no. 4., October 2014 (2014-10-01), pages 460 - 466, XP029068455 *
FAIR DISCLOSURE WIRE: "Dyax Corp. announces positive results from phase 1a clinical trial . of DX2930", 25 February 2014 (2014-02-25), XP055317760, Retrieved from the Internet <URL:http://dialog.proquest.com/professional/docview/1506520567?accountid=157282> [retrieved on 20160520] *

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12460016B2 (en) 2010-01-06 2025-11-04 Takeda Pharmaceutical Company Limited Plasma kallikrein binding proteins
US10336832B2 (en) 2010-01-06 2019-07-02 Dyax Corp. Methods of inhibiting plasma kallikrein in edema patient
US11505620B2 (en) 2010-01-06 2022-11-22 Takeda Pharmaceutical Company Limited Methods of detecting plasma kallikrein
US10370453B2 (en) 2011-01-06 2019-08-06 Dyax Corp. Plasma kallikrein binding proteins
US11401346B2 (en) 2011-01-06 2022-08-02 Takeda Pharmaceutical Company Limited Nucleic acids encoding plasma kallikrein binding proteins
US11299553B2 (en) 2013-03-15 2022-04-12 Takeda Pharmaceutical Company Limited Anti-plasma kallikrein antibodies
US12110343B2 (en) 2013-03-15 2024-10-08 Takeda Pharmaceutical Company Limited Anti-plasma kallikrein antibodies
US12384854B2 (en) 2014-01-21 2025-08-12 Takeda Pharmaceutical Company Limited Plasma kallikrein binding proteins and uses thereof in treating hereditary angioedema
US11084884B2 (en) 2014-01-21 2021-08-10 Takeda Pharmaceutical Company Limited Plasma kallikrein binding proteins and uses thereof in treating hereditary angioedema
US10428158B2 (en) 2014-03-27 2019-10-01 Dyax Corp. Compositions and methods for treatment of diabetic macular edema
US12084515B2 (en) 2014-03-27 2024-09-10 Takeda Pharmaceutical Company Limited Compositions and methods for treatment of diabetic macular edema
US11046785B2 (en) 2014-03-27 2021-06-29 Takeda Pharmaceutical Company Limited Compositions and methods for treatment of diabetic macular edema
IL259691B1 (en) * 2015-12-11 2024-04-01 Dyax Corp Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
WO2017100679A1 (en) * 2015-12-11 2017-06-15 Dyax Corp. Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
US11286307B2 (en) 2015-12-11 2022-03-29 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
JP2022033868A (ja) * 2015-12-11 2022-03-02 武田薬品工業株式会社 遺伝性血管性浮腫の発作を治療するための血漿カリクレイン阻害薬およびその用途
JP2019501886A (ja) * 2015-12-11 2019-01-24 ダイアックス コーポレーション 遺伝性血管性浮腫の発作を治療するための血漿カリクレイン阻害薬およびその用途
JP7003354B2 (ja) 2015-12-11 2022-03-04 武田薬品工業株式会社 遺伝性血管性浮腫の発作を治療するための血漿カリクレイン阻害薬およびその用途
AU2016366557B2 (en) * 2015-12-11 2024-01-25 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
JP7426369B2 (ja) 2015-12-11 2024-02-01 武田薬品工業株式会社 遺伝性血管性浮腫の発作を治療するための血漿カリクレイン阻害薬およびその用途
IL259691B2 (en) * 2015-12-11 2024-08-01 Dyax Corp Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
EP4494698A3 (en) * 2017-08-04 2025-04-23 Takeda Pharmaceutical Company Limited Inhibitors of plasma kallikrein and uses thereof
US11905285B2 (en) 2017-08-04 2024-02-20 Takeda Pharmaceutical Company Limited Inhibitors of plasma kallikrein and uses thereof
WO2019028362A1 (en) * 2017-08-04 2019-02-07 Dyax Corp. INHIBITORS OF PLASMATIC KALLIKREIN AND USES THEREOF
US11168083B2 (en) 2017-08-04 2021-11-09 Takeda Pharmaceutical Company Limited Inhibitors of Plasma Kallikrein and uses thereof
WO2019166572A1 (en) * 2018-02-28 2019-09-06 Pharming Intellectual Property B.V. Pharmaceutical system for transdermal administration of a c1 -esterase inhibitor
WO2020047352A1 (en) * 2018-08-30 2020-03-05 Dyax Corp. Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
US20200109214A1 (en) * 2018-08-30 2020-04-09 Dyax Corp. Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
AU2019328324B2 (en) * 2018-08-30 2025-06-19 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack

Also Published As

Publication number Publication date
JP2022037131A (ja) 2022-03-08
US20180298110A1 (en) 2018-10-18
KR102799778B1 (ko) 2025-04-28
HK1250995A1 (zh) 2019-01-18
JP7008920B2 (ja) 2022-01-25
MX2023010206A (es) 2023-09-11
AU2025271115A1 (en) 2025-12-18
BR112017020864A2 (en) 2018-07-10
IL254292B1 (en) 2025-09-01
NZ774543A (en) 2024-04-26
JP7309836B2 (ja) 2023-07-18
AU2022203180A1 (en) 2022-06-02
CN107614532A (zh) 2018-01-19
KR102607829B1 (ko) 2023-12-01
IL305207A (en) 2023-10-01
AU2016243160B2 (en) 2022-02-24
IL254292A0 (en) 2017-10-31
CA2979713A1 (en) 2016-10-06
US20220169749A1 (en) 2022-06-02
EP3916020A1 (en) 2021-12-01
KR20250057946A (ko) 2025-04-29
MX2017012423A (es) 2018-01-26
EP3286226A4 (en) 2018-12-05
EA201792161A1 (ru) 2018-04-30
KR20170135885A (ko) 2017-12-08
AU2022203180B2 (en) 2025-09-11
CO2017009404A2 (es) 2018-03-09
JP2023130442A (ja) 2023-09-20
NZ735659A (en) 2023-08-25
KR20230164767A (ko) 2023-12-04
JP2018514510A (ja) 2018-06-07
AU2016243160A1 (en) 2017-10-05
EP3286226A1 (en) 2018-02-28

Similar Documents

Publication Publication Date Title
US12384854B2 (en) Plasma kallikrein binding proteins and uses thereof in treating hereditary angioedema
US20220169749A1 (en) Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
US20230104754A1 (en) Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
EP4090427A1 (en) Plasma kallikrein inhibitors and uses thereof for treating pediatric hereditary angioedema attack
HK40064044A (en) Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
HK40057855A (en) Plasma kallikrein binding proteins and uses thereof in treating hereditary angioedema
NZ735659B2 (en) Plasma kallikrein inhibitors and uses thereof for preventing hereditary angioedema attack
EA046649B1 (ru) Ингибиторы калликреинов плазмы и их применение для профилактики приступа наследственного ангионевротического отека

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16774069

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 254292

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2979713

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: NC2017/0009404

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2017549388

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/012423

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016243160

Country of ref document: AU

Date of ref document: 20160330

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017020864

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20177031279

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201792161

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 112017020864

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170928

WWD Wipo information: divisional of initial pct application

Ref document number: 1020257012913

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 1020257012913

Country of ref document: KR