WO2016145102A1 - Compositions and methods for activating "stimulator of interferon gene" -dependent signalling - Google Patents
Compositions and methods for activating "stimulator of interferon gene" -dependent signalling Download PDFInfo
- Publication number
- WO2016145102A1 WO2016145102A1 PCT/US2016/021597 US2016021597W WO2016145102A1 WO 2016145102 A1 WO2016145102 A1 WO 2016145102A1 US 2016021597 W US2016021597 W US 2016021597W WO 2016145102 A1 WO2016145102 A1 WO 2016145102A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- pharmaceutically acceptable
- cancer
- mono
- cdn
- Prior art date
Links
- 0 CC1OC(C*OC(C)=O)C[C@@]1OC Chemical compound CC1OC(C*OC(C)=O)C[C@@]1OC 0.000 description 10
- DQEJMLBPUZMJGY-UHFFFAOYSA-N CCCC1NCN=C2NC=NC12 Chemical compound CCCC1NCN=C2NC=NC12 DQEJMLBPUZMJGY-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7084—Compounds having two nucleosides or nucleotides, e.g. nicotinamide-adenine dinucleotide, flavine-adenine dinucleotide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H19/00—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof
- C07H19/02—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof sharing nitrogen
- C07H19/04—Heterocyclic radicals containing only nitrogen atoms as ring hetero atom
- C07H19/16—Purine radicals
- C07H19/20—Purine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids
- C07H19/213—Purine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids containing cyclic phosphate
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/02—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- STING is an adaptor protein in the cytoplasm of host mammalian cells which activates the TANK binding kinase (TBK1)—IRF3 and the NF- ⁇ B signaling axis, resulting in the induction of IFN- ⁇ and other gene products that strongly activate innate immunity. It is now recognized that STING is a component of the host cytosolic surveillance pathway (Vance et al., 2009), that senses infection with intracellular pathogens and in response induces the production of IFN- ⁇ , leading to the development of an adaptive protective pathogen-specific immune response consisting of both antigen-specific CD4 and CD8 T cells as well as pathogen-specific antibodies.
- TTK1 TANK binding kinase
- cGAS cyclic GMP-AMP Synthase
- mammalian CDNs contained one 2’,5’ linkage and one 3’,5’ linkage, or a so- called“mixed linkage (ML) or non-canonical CDNs.
- 2’,5’-3’,5’ molecules bind STING with nM affinity, some 300-fold better than bacterial c-di-GMP.
- Human STING also has known polymorphisms, including alleles encoding histidine at position 232, which are refractory to bis-3’,5’ (canonical) CDNs, but not 2’,5’-3’,5’ (non-canonical, mixed linkage) CDNs (Diner et al., Cell Reports 3, 1355–61, 2013; Jin et al., Genes and Immunity, 12: 263-9, 2011).
- compositions and methods which modulate immune responses to diseases. It is a further object of the invention to provide compositions and methods which provide cyclic purine dinucleotide analogs that exhibit improved characteristics when employed for activation of mammalian, and preferably human, STING. It is yet a further object of the invention to provide compositions and methods for the treatment of cancer. [0009]
- the present invention provides compositions comprising: one or more mono- or di-fluoro substituted bis-3’,5’ cyclic purine dinucleotides (“mono- or di-F-CDN compounds”), or prodrugs, pharmaceutically acceptable salts,
- this is measured using the hSTING(REF) allele described in Ishikawa, H., and Barber, G.N. (2008). Nature 455, 674–678, the protein sequence of which is NCBI Reference Sequence NP_938023 (SEQ ID NO: 1; Fig.6).
- a mammalian cell line e.g., HEK293T cells
- HEK293T cells which does not express a functional STING endogenously, but has been modified to stably express the hSTING(REF) allele as described hereinafter (e.g. see Example 12).
- compositions comprising: one or more mono- or di-F-CDN compounds that bind at least one human STING allelic protein product with an affinity at least 10-fold higher than one or more of bis-3’,5’ c-di- GMP (i.e.3’3’-(G)(G)), bis-3’,5’ c-di-AMP (i.e.3’3’-(A)(A) or CDA), or bis-3’,5’ c- GMP-AMP (i.e. 3’3’-(G)(A) or cGAMP when measured using at least one human STING protein.
- this is measured using isolated the protein encoded by the hSTING(REF) allele described (Ishikawa, H., and Barber, G.N. (2008). Nature 455, 674–678), the protein sequence of which is NCBI Reference Sequence NP_938023 using a method such as differential scanning fluorometry as described hereinafter (e.g. see Example 11).
- substitution of one or both of the free 2’-hydroxyls with fluoro on the bis-3’,5’ cyclic purine dinucleotides of the present invention substantially improve their binding to human STING.
- a number of 2’-fluoro substituted CDNs find use in the present invention.
- Preferred 2’-fluoro substituted CDNs include, but are not limited to, those derived by substitution of one or both 2’-hydroxyls on c-di-AMP, c-di-GMP, c- di-IMP, c-AMP-GMP, c-AMP-IMP, c-GMP-IMP, and analogs, or prodrugs or pharmaceutically acceptable salts thereof. This list is not meant to be limiting. Additional aspects and embodiments of mono- or di-F-CDN compounds are described hereinafter.
- the present invention provides a mono- or di-fluoro substituted 3’,5’-3’,5’ cyclic purine dinucleotide (mono- or di-F-CDN) compound of Formula I:
- each R5 and R6 is SH.
- the compositions comprise one or more substantially pure Sp,Sp, Rp,Rp, Sp,Rp, or Rp,Sp stereoisomers. In some embodiments the compositions comprise one or more substantially pure Rp,Rp stereoisomers.
- each R7 or R11 is independently -CR- or -N-;
- R8 is -C(R) 2 -, -O-, or–NR-;
- each R9, R10, R12, R13, or R14 is independently selected from the group consisting of hydrogen, halogen, -CN, -OR, -SR, -N(R)2, -C(O)R, -CO2R, -S(O)R, -S(O)2R,
- each R is independently an optionally substituted substituent selected from the group consisting of C 1-12 aliphatic, phenyl, a 3-7 membered saturated or partially unsaturated monocyclic carbocyclic ring, a 7-10 membered saturated or partially unsaturated bicyclic carbocyclic ring, a 3-7 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 7-10 membered saturated or partially unsaturated bicyclic heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and a 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, or sulfur, wherein each R is independently an optionally substituted substituent selected from the group consisting of C 1-12 aliphatic, phenyl, a 3-7 membered saturated or partially unsaturated monocyclic carbocyclic ring, a 7-10 membered saturated or partially unsaturated bicyclic carbocyclic
- each of R1 and R2 are independently selected from the group consisting of adenine, guanine, isoguanine, hypoxanthine, and xanthine or analogs thereof. In some embodiments, each of R1 and R2 are independently adenine or guanine.
- one of R1 or R2 is adenine, and the other of R1 or R2 is guanine; each of R1 and R2 are adenine; or each of R1 and R2 are Guanine, or in each case or analogs thereof.
- R1 and R2 are independently adenine or guanine, provided that R1 and R2 are not both guanine, or analogs thereof.
- each R5 and R6 is SH and R1 and R2 are independently:
- R15 and R16 are independently H or -C(O)R’, wherein R’ is C1-6 alkyl or phenyl.
- R15 is H or -C(O)-isopropyl and R16 is H or -C(O)-phenyl.
- the compound of Formula I is selected from the group consisting of:
- each of R3 and R4 is F. This is referred to herein as 2’,2’’-diF or di-2’F.
- the one or more compounds are 2’,2’’-diF-Rp,Rp cyclic purine dinucleotides (thus in which each R5 and R6 is SH), including, but not limited to, 2’,2’’-diF-Rp,Rp-c-di-AMP (also referred to herein as 2’,2’’-diF-R,R-CDA or 3’3’- RR-(2’F-A)(2’F-A)), 2’,2’’-diF-Rp,Rp-c-di-GMP (also referred to herein as
- 2’,2’’-diF-Rp,Rp-c-AMP-IMP also referred to herein as 2’,2’’-diF-R,R-cIAMP or 3’3’- RR-(2’F-I)(2’F-A)
- 2’,2’’-diF-Rp,Rp-c-GMP-IMP also referred to herein as
- the compound is not one of the following:
- the present invention provides a mono- or di-F-CDN compound of Formula II:
- R17 and R18 are independently a guanine or adenine bound to the structure via the N9 position, wherein the 6 position amine of adenine is optionally substituted with a benzoyl group and wherein the 2 position amine of guanine is optionally substituted with an isobutyryl group;
- the compound of Formula II is a compound of Formula IIa, a compound of Formula IIb or a compound of Formula IIc:
- R17 and R18 are independently adenine or guanine.
- R17 and R18 are independently adenine or guanine, provided that R17 and R18 are not both guanine.
- R17 and R18 are both adenine.
- R17 and R18 are both guanine.
- one of R17 and R18 is adenine and the other of R17 and R18 is guanine.
- one of R19 and R20 is F and the other of R19 and R20 is OH. In some embodiments, R19 and R20 are both F. In some embodiments, R19 and R20 are both F and the compound is a compound of Formula IIa. [0025] In some embodiments of the third aspect, the mono- or di-F-CDN compound is selected from the group consisting of:
- the mono- or di-F-CDN compound is selected from the group consisting of:
- the present invention provides a di-F-CDN compound of Formula III:
- the compound of Formula III is a compound of Formula IIIa or a compound of Formula IIIb:
- R21 and R22 are independently a guanine or adenine, provided that R21 and R22 are not both guanine. In some embodiments, R21 and R22 are both adenine. In some embodiments, R21 is adenine and R22 is guanine.
- the compound is a compound of Formula IIIa.
- the di-F-CDN compound is selected from the group consisting of:
- the di-F-CDN compound is selected from the group consisting of:
- the di-F-CDN compound is selected from the group consisting of:
- the di-F-CDN compound is selected from the group consisting of:
- the present invention provides a mono-F-CDN compound of Formula IV:
- R23 and R24 are independently a guanine or adenine bound to the structure via the N9 position;
- the compound of Formula IV is a compound of Formula IVa, a compound of Formula IVb or a compound of Formula IVc:
- R23 and R24 are independently adenine or guanine provided that R23 and R24 are not both guanine. In some embodiments, R23 and R24 are both adenine. In some embodiments, one of R23 and R24 is adenine and the other of R23 and R24 is guanine.
- the compound is a compound of Formula IVa.
- the mono-F-CDN compound is selected from the group consisting of:
- the present invention provides a mono- or di-F cyclic di- adenine compound of Formula V:
- R27 and R28 are independently OH or F, provided that at least one of R27 and R28 is F;
- R29 and R30 are independently H or benzoyl.
- the compound of Formula V is a compound of Formula Va or a compound of Formula Vb:
- R29 and R30 are both H.
- R29 and R30 are both benzoyl.
- one of R29 and R30 is benzoyl and the other of R29 and R30 is H.
- R27 and R28 are both F.
- one of R27 and R28 is F and the other of R27 and R28 is OH.
- R27 and R28 are both F, and R29 and R30 are both H.
- the compound is a compound of Formula Va, R27 and R28 are both F, and R29 and R30 are both H.
- the mono- or di-F cyclic di-adenine compound is selected from the group consisting of:
- the mono- or di-F cyclic di-adenine compound is selected from the group consisting of:
- the present invention provides a mono- or di-F cyclic di- uanine com ound of Formula VI:
- R31 and R32 are independently OH or F, provided that at least one of R31 and R32 is F; R33 and R34 are independently H or butyryl.
- the compound of Formula VI is a compound of Formula VIa or a compound of Formula VIb: or a prodrug, pharmaceutically acceptable salt, pharmaceutically acceptable solvate or pharmaceutically acceptable hydrate thereof, wherein R31, R32, R33 and R34 are as defined for Formula VI.
- R33 and R34 are both H.
- R33 and R34 are both butyryl.
- one of R33 and R34 is butyryl and the other of R33 and R34 is H.
- R31 and R32 are both F. In some embodiments, one of R31 and R32 is F and the other of R31 and R32 is OH. [0051] In some embodiments of the sixth aspect, R31 and R32 are both F, and R33 and R34 are both H. In some embodiments, the compound is a compound of Formula VIa, R31 and R32 are both F, and R33 and R34 are both H. [0052] In some embodiments of the seventh aspect, the mono- or di-F cyclic di-guanine compound is selected from the group consisting of:
- the present invention provides a mono- or di-F cyclic guanine and adenine dinucleotide compound of Formula VII:
- R35 and R36 are independently OH or F, provided that at least one of R35 and R36 is F; R37 is H or benzoyl; and
- R38 is H or butyryl.
- the compound of Formula VII is a compound of Formula VIIa, a compound of Formula VIIb or a compound of Formula VIIc:
- R37 and R38 are both H.
- R37 is benzoyl and R38 is butyryl.
- R37 is H and R38 is butyryl.
- R37 is benzoyl and R38 is H.
- R35 and R36 are both F.
- one of R35 and R36 is F and the other of R35 and R36 is OH.
- R35 and R36 are both F and the compound is a compound of Formual VIIa.
- R35 and R36 are both F and R37 and R38 are both H.
- R35 and R36 are both F
- R37 is H and R38 is butyryl.
- R35 and R36 are both F
- R37 is benzoyl and R38 is H.
- R35 and R36 are both F
- R37 is benzoyl and R38 is butyryl.
- R35 and R36 are both F, R37 and R38 are both H, and the compound is a compound of Formula VIIa.
- R35 is F, R36 is OH and R37 and R38 are both H.
- R35 is F, R36 is OH, R37 is H and R38 is butyryl.
- R35 is F, R36 is OH, R37 is benzoyl and R38 is H.
- R35 is F, R36 is OH, R37 is benzoyl and R38 is butyryl.
- R35 is F, R36 is OH, R37 and R38 are both H, and the compound is a compound of Formula VIIa.
- R35 is OH, R36 is F and R37 and R38 are both H.
- R35 is OH, R36 is F, R37 is H and R38 is butyryl.
- R35 is OH, R36 is F, R37 is benzoyl and R38 is H.
- R35 is OH, R36 is F, R37 is benzoyl and R38 is butyryl.
- R35 is OH, R36 is F, R37 and R38 are both H, and the compound is a compound of Formula VIIa.
- the mono- or di-F cyclic guanine and adenine dinucleotide compound is selected from the group consisting of:
- the mono- or di-F cyclic guanine and adenine dinucleotide compound is selected from the group consisting of:
- a compound 3’3’-RR-(2’F-A)(2’F-A) having the structure:
- a compound 3’3’-RS-(2’F-A)(2’F-A) having the structure:
- a compound 3’3’-RR-(2’F-G)(2’F-A) having the structure:
- a compound 3’3’-RS-(2’F-G)(2’F-A) having the structure:
- a compound 3’3’-RR-(2’F-G)(2’F-G) having the structure:
- a compound 3’3’-RS-(2’F-G)(2’F-G) having the structure:
- a compound 3’3’-RR-(2’F-iBuG)(2’F-BzA) having the structure:
- a compound 3’3’-RS-(2’F-iBuG)(2’F-BzA) having the structure:
- a compound 3’3’-RR-(2’F-BzA)(2’F-BzA) having the structure:
- a compound 3’3’-RR-(2’F-iBuG)(2’F-A) having the structure:
- a compound 3’3’-RR-(A)(2’F-A) having the structure:
- a compound 3’3’-RS-(A)(2’F-A) having the structure:
- a compound 3’3’-RR-(2’F-G)(A) having the structure:
- a compound 3’3’-SR-(2’F-G)(A) having the structure:
- a compound 3’3’-RR-(G)(2’F-A) having the structure:
- a compound 3’3’-RS-(G)(2’F-A) having the structure:
- a compound 3’3’-(2’F-G)(2’F-A) having the structure:
- a compound 3’3’-RR-(2’ ⁇ F-A)(2’ ⁇ F-A) having the structure:
- a compound 3’3’-RS-(2’ ⁇ F-A)(2’ ⁇ F-A) having the structure:
- the structure is preferably a thiophosphate at each of the phosphate linkers (e.g. R5 and R6 or Formula I are both SH), more preferably wherein the stereochemistry at each phosphorus is R, and the compound is substantially pure.
- the mono- or di-F-CDN compounds include prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates or pharmaceutically acceptable hydrates thereof, including pharmaceutically acceptable salts, pharmaceutically acceptable solvates or pharmaceutically acceptable hydrates of any prodrugs thereof, and including any pharmaceutically acceptable solvates or pharmaceutically acceptable hydrates of any pharmaceutically acceptable salts thereof.
- the mono- or di-F-CDN compounds include pharmaceutically acceptable solvates, pharmaceutically acceptable hydrates or pharmaceutically acceptable salts thereof.
- the mono- or di-F-CDN compound is a pharmaceutically acceptable salt, or a pharmaceutically acceptable solvate or pharmaceutically acceptable hydrate thereof.
- the mono- or di-F-CDN compound is a pharmaceutically acceptable salt thereof.
- the mono- or di-F-CDN compounds include pharmaceutically acceptable salts thereof.
- the pharmaceutically acceptable salt is selected from the group consisting of the sodium, potassium, calcium, magnesium, zinc, aluminum, ammonium, diethylamine, isopropylamine, olamine, benzathine, benethamine, tromethamine (2- amino-2-(hydroxymethyl)propane-1,3-diol), morpholine, epolamine, piperidine, piperazine, picoline, dicyclohexylamine, N,N’-dibenzylethylenediamine, 2- hydroxyethylamine, tri-(2-hydroxyethyl)amine, chloroprocaine, choline, deanol, imidazole, diethanolamine, ethylenediamine, meglumine (N-methyl
- the mono- or di-F-CDN compounds are provided as the disodium salt thereof. In some embodiments, the mono- or di-F-CDN compounds are provided as the disodium salt thereof, or a pharmaceutically acceptable solvate or pharmaceutically acceptable hydrate thereof. [0085] In some embodiments of any of the above aspects and embodiments thereof, the mono- or di-F-CDN compound is more active in a cellular assay that measures the induction of human STING dependent IFN- ⁇ production as compared to one or more reference compounds. In some embodiments, the one or more reference compounds are selected from the group consisting of 3’3’-(G)(G) (i.e.
- the mono- or di-F-CDN compound is a mono- or di-F-RR-CDN compound and the one or more reference compounds are selected from the group consisting of 3’3’-RR-(A)(A), 3’3’-RR-(G)(G) and
- the reference compound is the di-OH reference compound.
- the cellular assay is an hPBMC assay, for example the assay as described in Example 13.
- the cellular assay is a THP1 assay, for example the assay as described in Example 14.
- the cellular assay is performed without the addition of an agent that enhances uptake of the mono- or di-F-CDN compound or reference compound by the assay cells or an agent that enhances the permeability of the mono- or di-F-CDN compound or reference compound to the assay cells.
- the cellular assay is a THP1 cellular assay performed without the addition of an agent that enhances uptake of the mono- or di-F- CDN compound or reference compound by the assay cells or an agent that enhances the permeability of the mono- or di-F-CDN compound or reference compound to the assay cells, in which the mono- or di-F-CDN compound has an EC50 of less than 40 ⁇ M, less than 30 ⁇ M, less than 20 ⁇ M, less than 15 ⁇ M, or less than 10 ⁇ M. In some
- the mono- or di-F-CDN compound has an EC50 of less than 40 ⁇ M, less than 30 ⁇ M, less than 20 ⁇ M, less than 15 ⁇ M, or less than 10 ⁇ M in a cellular assay that measures induction of human STING dependent IFN- ⁇ production, wherein the cellular assay is performed without the addition of an agent that enhances uptake of the mono- or di-F-CDN compound by the assay cells or an agent that enhances the permeability of the mono- or di-F-CDN compound to the assay cells.
- the cellular assay is a THP1 cellular assay as described in Example 14, wherein the assay is performed without addition of digitonin.
- the mono- or di-F-CDN compound has an EC50 that is less than the EC50 of one or more reference compounds selected from the group consisting of 3’3’-(G)(G) (i.e. cyclic-[G(3’,5’)p-G(3’,5’)p]), 3’3’-(A)(A) (i.e. cyclic-[A(3’,5’)p-A(3’,5’)p]), 3’3’-(G)(A) (i.e. cyclic-[G(3’,5’)p-A(3’,5’)p]), 3’3’- RR-(A)(A) (i.e. dithio-(Rp,Rp)-cyclic-[A(3’,5’)p-A(3’,5’)p]), 3’3’-RR-(G)(G) (i.e.
- the mono- or di-F-CDN compound has an EC50 that is less than the EC50 of a di-OH reference compound in a THP1 cellular assay as described in Example 14, preferably wherein the assay is performed without addition of digitonin.
- the mono- or di-F-CDN compound has an EC50 that is at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, or at least 8-fold lower than the EC50 of the di-OH reference compound in the THP1 cellular assay as described in Example 14, wherein the assay is performed without addition of digitonin.
- a cyclic purine dinucleotide composition according to the present invention wherein one or more mono- or di-F-CDN compounds present in the composition can induce STING-dependent type I interferon production at least 2-fold, and more preferably 5-fold or 10-fold, or more, at concentrations at least 10-fold, 50-fold, or 100-fold lower than one or more of bis-3’,5’ c-di-GMP (i.e.3’3’-(G)(G)), bis-3’,5’ c- di-AMP (i.e.3’3’-(A)(A) or CDA), or bis-3’,5’ c-GMP-AMP (i.e.3’3’-(G)(A) or cGAMP) (meaning lacking the 2’-F substitution(s)).
- the STING is human STING.
- a composition comprising a mono- or di-F-CDN compound according to the present invention activates human STING but the corresponding bis-3’,5’ cyclic purine dinucleotide (having the same purines and lacking the 2’-F substitution(s)) does not.
- composition comprising a mono- or di-F- CDN compound according to the present invention, wherein one or more mono- or di-F- CDN compounds present in the composition bind STING with an affinity at least 10-fold, 50-fold, or 100-fold higher one or more of bis-3’,5’ c-di-GMP (i.e.3’3’-(G)(G)), bis-3’,5’ c-di-AMP (i.e. 3’3’-(A)(A) or CDA), or bis-3’,5’ c-GMP-AMP (i.e.3’3’-(G)(A) or cGAMP) (meaning lacking the 2’-F substitution(s)).
- bis-3’,5’ c-di-GMP i.e.3’3’-(G)(G)
- bis-3’,5’ c-GMP-AMP i.e.3’3’-(G)(A) or cGAMP
- a cyclic purine dinucleotide composition according to the present invention binds STING with an affinity at least 10- fold, 50-fold, or 100-fold higher than the corresponding bis-(3’,5’) cyclic purine dinucleotide (having the same purines and lacking the 2’-F substitution(s)).
- the mono- or di-F-CDN compound binds at least one human STING allelic protein product (including any one of WT, REF, HAQ, AQ and Q alleles) with a greater affinity than one or more reference compounds selected from the group consisting of 3’3’-(G)(G) (i.e. cyclic-[G(3’,5’)p-G(3’,5’)p]), 3’3’-(A)(A) (i.e. cyclic-[A(3’,5’)p-A(3’,5’)p]), 3’3’- (G)(A) (i.e.
- the mono- or di-F-CDN compound binds at least one human STING allelic protein product with an affinity greater than a di-OH reference compound.
- this is measured using the isolated protein encoded by the hSTING (WT), hSTING (HAQ) or hSTING (REF) allele (Ishikawa, H., and Barber, G.N. (2008).
- the present invention provides pharmaceutical compositions comprising one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts,
- the delivery vehicle comprises one or more agents selected from the group consisting of adjuvants, lipids, liposomes, interbilayer crosslinked multilamellar vesicles, biodegradeable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers.
- agents selected from the group consisting of adjuvants, lipids, liposomes, interbilayer crosslinked multilamellar vesicles, biodegradeable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers.
- the present invention provides pharmaceutical compositions comprising one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts,
- the pharmaceutical composition does not include an agent that enhances cellular permeability of the one or more mono- or di-F-CDN compounds.
- the pharmaceutical composition does not include an agent that enhances cellular uptake of the one or more mono- or di-F-CDN compounds.
- the pharmaceutical composition further comprises a delivery vehicle which enhances cellular uptake and/or stability of the compound.
- the delivery vehicle comprises one or more agents selected from the group consisting of adjuvants, lipids, liposomes, interbilayer crosslinked multilamellar vesicles, biodegradeable poly(D,L-lactic-co- glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers.
- the pharmaceutical composition further comprises one or more additional pharmaceutically active components selected from the group consisting of an immune checkpoint inhibitor (e.g.
- CpG or monophosphoryl lipid A an inactivated or attenuated bacteria which induce innate immunity (e.g., inactivated or attenuated Listeria monocytogenes); a composition that mediates innate immune activation via Toll-like Receptors (TLRs), via (NOD)-like receptors (NLRs), via Retinoic acid inducible gene-based (RIG)-I-like receptors (RLRs), via C-type lectin receptors (CLRs), or via pathogen-associated molecular patterns (PAMPs); and a chemotherapeutic agent.
- TLRs Toll-like Receptors
- NLRs nuclear-like receptors
- RLRs Retinoic acid inducible gene-based
- RLRs C-type lectin receptors
- PAMPs pathogen-associated molecular patterns
- the immune checkpoint inhibitor is selected from the group consisting of a CTLA-4 pathway antagonist, a PD-1 pathway antagonist, a Tim-3 pathway antagonist, a Vista pathway antagonist, a BTLA pathway antagonist, a LAG-3 pathway antagonist, and a TIGIT pathway antagonist.
- the immune checkpoint inhibitor is an anti- PD-1 antibody, an anti-PD-L1 antibody, an anti-CTLA-4 antibody, an anti-TIM-3 antibody, an anti-BTLA antibody or an anti-LAG-3 antibody.
- the immune checkpoint inhibitor is selected from the group consisting of nivolumab, pembrolizumab, pidilizumab, AMP-224, ipilimumab, BMS-936559, MPDL3280A, MEDI4736, and avelumab.
- the TLR agonist is CpG or monophosphoryl lipid A.
- the pharmaceutical composition further comprises an inactivated tumor cell which expresses and secretes one or more cytokines which stimulate dendritic cell induction, recruitment and/or maturation, or which expresses and secretes one or more heat shock proteins, including gp96-Ig fusion proteins.
- the one or more cytokines is selected from the group consisting of GM-CSF, CCL20, CCL3, IL-12p70 and FLT-3 ligand.
- the tumor cell is inactivated by treatment with radiation.
- the one or more cytokines is selected from the group consisting of GM-CSF, CCL20, CCL3, IL-12p70 and FLT-3 ligand, and the tumor cell is inactivated by treatment with radiation.
- the inactivated tumor cell expresses and secretes a gp96-Ig fusion protein.
- the pharmaceutical composition further comprises one or more antigens selected for the purposes of inducing an immune response against said one or more antigen(s) when the composition is administered to an individual.
- the antigen is a recombinant protein antigen.
- the antigen is a recombinant protein antigen related to an infectious disease, a
- the one or more antigens is one or more antigens in Table 1.
- the pharmaceutical compositions are formulated as aqueous or oil-in-water emulsions.
- the invention provides a method for treating an individual suffering from a cancer, wherein the method comprises administering to the individual in need thereof an effective amount of one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates, or pharmaceutically acceptable hydrates thereof, or compositions thereof as described in the twent-eighth and twenty-ninth aspects and any embodiments thereof as described herein above.
- the one or more mono- or di-F-CDN compounds or composition thereof is administered non-parenterally or parenterally.
- the administration is subcutaneous, intramuscular, intradermal, mucosal, vaginal, cervical, peri-tumoral, intra-tumoral, or directly into the tumor-draining lymph node(s). In some embodiments, the administration is mucosal, preferably oral.
- the individual receiving such treatment may be suffering from a cancer selected from the group consisting of a colorectal cancer, an aero-digestive squamous cancer, a lung cancer, a brain cancer, a liver cancer, a stomach cancer, a bladder cancer, a thyroid cancer, an adrenal cancer, a gastrointestinal cancer, an oropharyngeal cancer, an esophageal cancer, a head and neck cancer, an ovarian cancer, a uterine cancer, a cervical cancer, an endometrial cancer, a breast cancer, a melanoma, a prostate cancer, a pancreatic carcinoma, a renal carcinoma, a sarcoma, a leukemia, a lymphoma and a multiple myeloma.
- a cancer selected from the group consisting of a colorectal cancer, an aero-digestive squamous cancer, a lung cancer, a brain cancer, a liver cancer, a stomach cancer, a bladder cancer, a thyroid cancer,
- the method for treating an individual suffering from a cancer further comprises administering one or more additional cancer therapies.
- the one or more additional cancer therapies comprises radiation therapy, surgery, a chemotherapy, or an immunotherapy (for example, without limitation, an immunomodulator, an immune checkpoint inhibitor, a cellular immunotherapy, or a cancer vaccine).
- an immunotherapy for example, without limitation, an immunomodulator, an immune checkpoint inhibitor, a cellular immunotherapy, or a cancer vaccine.
- the one or more additional cancer therapies comprises an inactivated tumor cell that expresses and secretes one or more cytokines or one or more heat shock proteins.
- the cytokine is selected from the group consisting of GM-CSF, CCL20, CCL3, IL-12p70, and FLT-3 ligand.
- the heat shock protein is a gp96-Ig protein.
- the method comprises administering one or more additional cancer therapies selected from the group consisting of a chemotherapeutic agent; an immune checkpoint inhibitor; a TLR agonist; a vaccine selected to stimulate an immune response to one or more cancer antigens, a therapeutic antibody that induces antibody-dependent cellular cytotoxicity; an immunomodulatory cell line; an inactivated or attenuated bacteria that induces innate immunity; an antigen selected for the purpose of inducing an immune response, and a composition that mediates innate immune activation via Toll-like Receptors (TLRs), (NOD)-like receptors (NLRs), Retinoic acid inducible gene-based (RIG)-I-like receptors (RLRs), C-type lectin receptors (CLRs) or pathogen-associated molecular patterns (“PAMPs”).
- TLRs Toll-like Receptors
- NLRs Retinoic acid inducible gene-based
- RLRs Retinoic acid inducible gene-based
- the immune checkpoint inhibitor is an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti- CTLA-4 antibody, an anti-TIM-3 antibody, an anti-BTLA antibody or an anti-LAG-3 antibody.
- the TLR agonist is CpG or monophosphoryl lipid A.
- the therapeutic antibody that induces antibody-dependent cellular cytotoxicity is rituximab, ibritumomab, tositumomab, cetuximab, trastuzumab, brentuximab vedotin, alemtuzumab, oncolym, ibilimumab, vitaxin, or bevacizumab.
- the individual suffers from a cancer expressing a cancer antigen
- the method for treating said individual further comprises administering to the individual a primary therapy to remove or kill cancer cells expressing the cancer antigen, wherein the administration of the primary therapy is simultaneously with, prior to or following administration of the mono- or di-F-CDN compound or composition thereof.
- the mono- or di-F-CDN compound or composition thereof is administered as a neoadjuvant therapy to the primary therapy.
- the mono- or di-F-CDN compound or composition thereof is administered following the primary therapy.
- the primary therapy comprises surgery to remove the cancer cells from the mammal, radiation therapy to kill the cancer cells in the mammal, or both surgery and radiation therapy.
- the invention provides a method of treating a disease in an individual, comprising administering to the individual in need thereof i) an effective amount of one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates, or pharmaceutically acceptable hydrates thereof, or compositions thereof as described in the twenty-eighthand twenty-ninth aspects and any embodiments thereof as described herein above; and ii) an effective amount of one or more therapeutic antibodies that induce antibody-dependent cellular cytotoxicity, wherein the disease is selected from the group consisting of a cancer, acute rejection of an organ transplant, Type I diabetes mellitus, rheumatoid arthritis, psoriasis, Cr
- the cancer is selected from the group consisting of lymphoma (e.g. B-cell lymphoma), breasts cancer, chronic lymphocytic leukemia, colorectal cancer, melanoma, non-small cell lung carcinoma, small cell lung cancer, bladder cancer, prostate cancer and other solid tumors.
- lymphoma e.g. B-cell lymphoma
- breasts cancer chronic lymphocytic leukemia
- colorectal cancer melanoma
- non-small cell lung carcinoma small cell lung cancer
- bladder cancer prostate cancer and other solid tumors.
- the therapeutic antibody is selected from the group consisting of muromonab-CD3, infliximab, daclizumab, omalizumab, abciximab, rituximab, ibritumomab, tositumomab, cetuximab, trastuzumab, brentuximab vedotin, alemtuzumab, oncolym, ibilimumab, vitaxin, and bevacizumab.
- the invention provides a method for the treatment of disorders in which shifting of Th1 to Th2 immunity confers clinical benefit, wherein the method comprises administering to the individual in need thereof one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs,
- CLI Cell-mediated immunity
- IFN interferon
- TNF tumor necrosis factor
- humoral immunity is associated with TH2 CD4+ T lymphocytes producing IL-4, IL-6 and IL-10.
- Immune deviation towards TH1 responses typically produces activation of cytotoxic T-cell lymphocytes (CTL), natural killer (NK) cells, macrophages and monocytes.
- CTL cytotoxic T-cell lymphocytes
- NK natural killer
- Th1 responses are more effective against intracellular pathogens (viruses and bacteria that are inside host cells) and tumors
- Th2 responses are more effective against extracellular bacteria, parasites including helminths and toxins.
- the activation of innate immunity is expected to normalize the T-helper type 1 and 2 (Th1/Th2) immune system balance and to suppress the excessive reaction of Th2 type responses that cause immunoglobulin (Ig) E-dependent allergies and allergic asthma.
- the mono- or di-F-CDN compounds as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates, or pharmaceutically acceptable hydrates thereof, or compositions thereof as described in the twenty-eighth and twenty-ninth aspects and any embodiments thereof as described herein above, may be administered to individuals in need thereof, as described in the methods of the thirtieth through thirty-second aspects and any embodiments thereof as described herein above, by a variety of parenteral and non-parenteral routes in formulations containing pharmaceutically acceptable excipients (e.g. carriers, adjuvants, vehicles and the like).
- pharmaceutically acceptable excipients e.g. carriers, adjuvants, vehicles and the like.
- Preferred non-parenteral routes include mucosal (e.g., oral, vaginal, nasal, cervical, etc.) routes.
- Preferred parenteral routes include but, are not limited to, one or more of subcutaneous, intravenous, intramuscular, intraarterial, intradermal, intrathecal and epidural administrations.
- Preferably administration is by subcutaneous, intra-tumoral or peri-tumoral routes, more preferably subcutaneous administration.
- the mono- or di-F-CDN compounds as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates, or pharmaceutically acceptable hydrates thereof, or compositions thereof as described in the twenty-eighth and twenty-ninth aspects and any embodiments thereof as described herein may be co-administered to individuals in need thereof, as described in the methods of the thirtieth through thirty-second aspects and any embodiments thereof as described herein above, with one or more additional pharmaceutically active components such as adjuvants, lipids, interbilayer crosslinked multilamellar vesicles, biodegradeable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers, immune checkpoint inhibitors (e.g.
- compositions which mediate innate immune activation via Toll-like Receptors (TLRs), (NOD)-like receptors (NLRs), Retinoic acid inducible gene-based (RIG)-I-like receptors (RLRs), C-type lectin receptors (CLRs), or pathogen-associated molecular patterns
- the invention provides one or more mono- or di-F- CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs,
- the vaccine is selected to stimulate an immune response to one or more predetermined antigens.
- the vaccine comprises one or more antigens, including a recombinant protein antigen related to an infectious disease, a malignancy, or an allergan.
- the one or more mono- or di-F-CDN compound or composition thereof is used simultaneously with, prior to or following the vaccine.
- the one or more mono- or di-F-CDN compound or composition thereof is formulated in the same composition as the vaccine.
- the vaccine comprises an inactivated or attenuated bacteria or virus comprising the one or more antigens of interest, one or more purified antigens, live viral or bacterial delivery vectors recombinantly engineered to express and/or secrete the one or more antigens, antigen presenting cell (APC) vectors comprising cells that are loaded with the one or more antigens or transfected with a composition comprising a nucleic acid encoding the one or more antigens, liposomal antigen delivery vehicles, or naked nucleic acid vectors encoding the one or more antigens.
- APC antigen presenting cell
- the vaccine is an anti-bacterial, anti-viral, or anti-cancer therapeutic or prophylactic vaccine.
- the one or more antigens is one or more antigens selected from the group consisting of a viral antigen, a bacterial antigen and a cancer antigen.
- the vaccine comprises an inactivated tumor cell that expresses and secretes one or more cytokines.
- the cytokine is selected from the group consisting of GM- CSF, CCL20, CCL3, IL-12p70, and FLT-3 ligand.
- the vaccine comprises an inactivated tumor cell that expresses and secretes one or more heat shock proteins.
- the heat shock protein is gp96-Ig fusion protein.
- the invention provides a method for treating an individual suffering from a chronic infectious disease, wherein the method comprises administering to the individual in need thereof an effective amount of one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs,
- the one or more mono- or di-F-CDN compounds or composition thereof is administered in combination with another agent for use in treating the chronic infectious disease.
- the chronic infectious disease is selected from the group consisting of HBV infection, HCV infection, HPV infection, HSV infection and hepatocellular cancer.
- the invention provides one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs,
- the one or more mono- or di-F-CDN compounds are for use in treating a cancer.
- the cancer is selected from the group consisting of a colorectal cancer, an aero-digestive squamous cancer, a lung cancer, a brain cancer, a liver cancer, a stomach cancer, a bladder cancer, a thyroid cancer, an adrenal cancer, a gastrointestinal cancer, an oropharyngeal cancer, an esophageal cancer, a head and neck cancer, an ovarian cancer, a uterine cancer, a cervical cancer, an endometrial cancer, a breast cancer, a melanoma, a prostate cancer, a pancreatic carcinoma, a renal carcinoma, a sarcoma, a leukemia, a lymphoma and a multiple myeloma.
- the invention provides one or more mono- or di-F- CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs,
- the one or more mono- or di-F-CDN compounds are for use in preparation of a medicament for the treatment of a cancer.
- the cancer is selected from the group consisting of a colorectal cancer, an aero-digestive squamous cancer, a lung cancer, a brain cancer, a liver cancer, a stomach cancer, a bladder cancer, a thyroid cancer, an adrenal cancer, a gastrointestinal cancer, an oropharyngeal cancer, an esophageal cancer, a head and neck cancer, an ovarian cancer, a uterine cancer, a cervical cancer, an endometrial cancer, a breast cancer, a melanoma, a prostate cancer, a pancreatic carcinoma, a renal carcinoma, a sarcoma, a leukemia, a lymphoma and a multiple myeloma.
- a colorectal cancer an aero-digestive squamous cancer
- a lung cancer a brain cancer, a liver cancer, a stomach cancer, a bladder cancer, a thyroid cancer, an adrenal cancer, a gastrointestinal cancer, an oropharyngeal cancer, an
- the invention provides a kit that includes one or more mono- or di-F-CDN compounds, as described in the second through twenty-seventh aspects and any embodiments thereof as described herein above, including any prodrugs, pharmaceutically acceptable salts, pharmaceutically acceptable solvates, or
- one or more mono- or di-F-CDN compounds or compositions thereof is packaged, e.g., in a vial, bottle or similar container, which may be further packaged, e.g., within a box, envelope, or similar container.
- one or more mono- or di-F-CDN compounds or compositions thereof is approved by the U.S. Food and Drug Administration or similar regulatory agency for administration to a mammal, e.g., a human.
- a kit includes written instructions for use and/or other indication that the one or more mono- or di-F- CDN compounds or compositions thereof is suitable or approved for administration to a mammal, e.g., a human, for a suitable disease or condition.
- the compound or composition is packaged in unit dose or single dose form, e.g., single dose pills, capsules, or the like.
- the compound is a compound selected from the group consisting of:
- FIG.1A-B depicts analytical data NMR (1A) and LC (1B) for 3’3’-RR-(2’F- G)(2’F-A) (dithio-(Rp,Rp)-cyclic-[2’F-G(3’,5’)p-2’F-A(3’,5’)p]).
- Fig. 2 depicts binding of mono- or di-F CDNs to human STING REF protein.
- Fig.3 depicts binding of mono- or di-F CDNs to human STING WT protein.
- Fig. 4 depicts the protein sequence of hSTING(REF).
- Fig.5A-B depicts the fold IFN ⁇ luciferase reporter induction by hSTING(WT) in HEK293T cells over a dose range (5A) and at 6.25 ⁇ M CDN (5B).
- Fig.6A-B depicts the fold IFN ⁇ luciferase reporter induction by hSTING(REF) in HEK293T cells over a dose range (6A) and at 6.25 ⁇ M CDN (6B).
- Fig. 4 depicts the protein sequence of hSTING(REF).
- Fig.5A-B depicts the fold IFN ⁇ luciferase reporter induction by hSTING(WT) in HEK293T cells over a dose range (5A) and at 6.25 ⁇ M CDN (5B).
- Fig.6A-B depicts the fold IFN ⁇ luciferase reporter induction by hSTING
- FIG. 7A-B depicts relative IFN ⁇ expression by STING WT/WT hPBMCs over at dose range (7A) and at 6.25 ⁇ M CDN (7B).
- Fig.8A-B depicts relative IFN ⁇ expression by STING REF/REF hPBMCs over at dose range (8A) and at 6.25 ⁇ M CDN (8B).
- Fig. 9A-B depicts the normalized IFN ⁇ expression in hPBMCs with hSTING(WT) (9A) or REF hSTING(REF) (9B) treated with CDNs.
- FIG. 10A-B depicts the normalized TNF ⁇ expression in hPBMCs with hSTING(WT) (10A) or REF hSTING(REF) (10B) treated with CDNs.
- Fig. 11A-B depicts the normalized IL-6 expression in hPBMCs with hSTING(WT) (11A) or REF hSTING(REF) (11B) treated with CDNs.
- Fig. 12A-B depicts the normalized IFN ⁇ expression in hPBMCs with hSTING(WT) (12A) or REF hSTING(REF) (12B) treated with CDNs.
- Fig. 11A-B depicts the normalized IL-6 expression in hPBMCs with hSTING(WT) (11A) or REF hSTING(REF) (12B) treated with CDNs.
- Fig. 12A-B depicts the normalized IFN ⁇ expression in hPBMCs with hSTING(
- FIG. 13A-B depicts the normalized IL-12p40 expression in hPBMCs with hSTING(WT) (13A) or REF hSTING(REF) (13B) treated with CDNs.
- Fig. 14A-B depicts the tumor volume (14A) and percent of SIY + CD8 + T-cells (14B) in a B16-SIY melanoma mouse model, following intra-tumoral injection of CDNs.
- Fig. 15A-B depicts the tumor volume in a B16 melanoma (15A) or MC38 colon carcinoma (15B) mouse model, following intra-tumoral injection of CDNs.
- Fig. 14A-B depicts the tumor volume (14A) and percent of SIY + CD8 + T-cells (14B) in a B16-SIY melanoma mouse model, following intra-tumoral injection of CDNs.
- Fig. 15A-B depicts the tumor volume in a B
- 16A-B depicts the HIVgag p55 antigen specific CD4 + T-cell response (15A) or CD8 + T cell response (15B) in mice injected with CDN and HIVgag p55 protein.
- the present invention relates to the production and use of mono- or di-fluoro substituted bis-3’,5’ cyclic-di-nucleotide (mono- or di-F-CDN) immune stimulators that activate DCs via a cytoplasmic receptor known as STING (Stimulator of Interferon Genes).
- the CDNs of the present invention are provided in the form of a composition comprising one or more mono- or di-F-CDN, and most preferably one or more dithio Rp,Rp di-F-CDNs.
- PAMPs Pathogen-Associated Molecular Patterns
- PRRs with germ-line encoded specificity host cell Pattern Recognition Receptors
- triggering a downstream signaling cascade resulting in the induction of cytokines and chemokines
- initiation of a specific adaptive immune response Iwasaki and Medzhitov, Science 327, 291-5, 2010.
- innate immune system is engaged by PAMPs presented from an infectious agent shapes the development of an adaptive response appropriate to combat the invading pathogen from causing disease.
- One objective in the design of immune modulators and adjuvants is to select defined PAMPs or synthetic molecules which activate designated PRRs and initiate a desired response.
- Adjuvants such as monophosphoryl lipid A (MPL) and CpG are microbial-derived PAMPs recognized by Toll-like receptors (TLRs), a class of PRRs that signal through MyD88 and TRIF adaptor molecules and mediate induction of NF-kB dependent proinflammatory cytokines (Pandey et. al., Cold Spring Harb Perspect Biol 2015;7: a016246).
- TLR-4 agonist and CpG are the most clinically advanced adjuvants, and are components of vaccines that are approved or pending approval by the FDA (Einstein et al., Human Vaccines, 5: 705-19, 2009; Ahmed et al., Nature Immunol.12: 509-17, 2011).
- TLRs present on the cell surface e.g., TLR-4
- endosomes e.g., TLR-9
- the productive growth cycle of multiple pathogens including viruses and intracellular bacteria occurs in the cytosol.
- Type I interferons are the signature cytokines induced by two distinct TLR-independent cytosolic signaling pathways.
- RNA helicases including retinoic acid-inducible gene I (RIG-I) and melanoma differentiation-associated gene 5 (MDA-5), and through the IFN- ⁇ promoter stimulator 1 (IPS-1) adaptor protein mediate phosphorylation of the IRF-3 transcription factor, leading to induction of IFN- ⁇ (Ireton and Gale, Viruses 3: 906-19, 2011).
- IPS-1 -/- deficient mice have increased susceptibility to infection with RNA viruses.
- Synthetic dsRNA such as polyinosinic:polycytidylic acid (poly (I:C) and poly ICLC, an analog that is formulated with poly L lysine to resist RNase digestion, is an agonist for both TLR3 and MDA5 pathways, is a powerful inducer of IFN- ⁇ , and is currently being evaluated in several diverse clinical settings (Caskey et al., J. Exp. Med. 208: 2357-77, 2011).
- STING Stimulator of Interferon Genes
- Ds double- stranded DNA from infectious pathogens or aberrant host cells
- TMEM173, MITA, ERIS, and MPYS STING was discovered using cDNA expression cloning methods as a MyD88-independent host cell defense factor expressed in macrophages, dendritic cells (DCs) and fibroblasts was found to induce expression of IFN- ⁇ and NF- ⁇ B dependent pro-inflammatory cytokines in response to sensing cytoplasmic DNA, in response to infection with herpes simplex virus (Ishikawa and Barber, Nature 455: 674-79, 2008).
- DCs dendritic cells
- fibroblasts was found to induce expression of IFN- ⁇ and NF- ⁇ B dependent pro-inflammatory cytokines in response to sensing cytoplasmic DNA, in response to infection with herpes simplex virus (Ishikawa and Barber, Nature 455: 674-79, 2008).
- Cyclic dinucleotides have been studied as ubiquitous small molecule second messengers synthesized by bacteria which regulate diverse processes including motility and formation of biofilms (Romling et al., Micrb. Mol. Biol. Rev., 77: 1-52, 2013). CDNs are also a ligand for STING (Burdette et al., Nature 478: 515–18, 2011).
- STING activates signaling through the TBK-1/IRF-3 axis and NF- ⁇ B axis and induces the expression of IFN- ⁇ and other co-regulated genes (Burdette and Vance, Nat Immunol.14: 19-26, 2013; McWhirter et al., J. Exp. Med. 206: 1899- 1911, 2009).
- Cyclic (c)-di-AMP is secreted by multidrug resistance efflux pumps from the intracellular bacterium Listeria monocytogenes into the cytosol of infected host antigen presenting cells, and is correlated with CD4 + and CD8 + T cell-mediated protection in the mouse listeriosis model (Woodward et al., Science 328, 1703-05, 2010; Crimmins et al., Proc. Natl. Acad. Sci. USA 105: 10191-10196, 2008).
- IFN- ⁇ is dependent upon activation of the STING signaling pathway, and the level of type I IFN induced by c-di-AMP in macrophages from MyD88- /- Trif -/- or C57BL/6 parental mice is indistinguishable (Leber et al., PLoS Pathog 4(1): e6. doi:10.1371, 2008; Witte et al., mBio 4: e00282-13, 2012).
- IFN- ⁇ is not induced by CDNs in macrophages derived from goldenticket (gt) mice encoding a nonfunctional mutant STING protein (Sauer et al., Infect.
- cGAS cyclic GMP-AMP synthase
- cGAMP cyclic GMP-AMP synthase
- cGAS produces a non-canonical CDN (c-GMP-AMP; cGAMP) that activates STING alleles that are non-responsive to canonical CDNs
- cGAMP non-canonical CDN
- cGAMP thus functions as a second messenger that binds to and activates STING.
- the internucleotide phosphate bridge in the cyclic-GMP-AMP synthesized by cGAS is joined by non-canonical 2’, 5’ and 3’,5’ linkages (alternatively termed“mixed” linkages or ML), represented as c[G(2’,5’)pA(3’,5’)p].
- 2’,5’-3’,5’ molecules bind STING with nM affinity, some 300-fold better than bacterial c-di-GMP.
- Human STING has known polymorphisms, including alleles encoding histidine at position 232, which are refractory to canonical CDNs, but not non-canonical CDNs (Diner et al., 2013, Jin et al., 2011). Single nucleotide polymorphisms in the hSTING gene have been shown to affect the responsiveness to bacterial-derived canonical CDNs (Diner et al., 2013; Gao et al., 2013; Conlon et. al., 2013).
- hSTING Five haplotypes of hSTING have been identified (WT, REF, HAQ, AQ and Q alleles), which vary at amino acid positions 71, 230, 232 and 293 (Jin et al., 2011; Yi et al., 2013).
- Cells expressing hSTING respond poorly to stimulation with bacterial CDNs cGAMP, c-di- AMP and c-di-GMP having bis-(3’, 5’) linkages, but are responsive to the endogenously produced cGAS product, ML cGAMP (Diner et al., 2013).
- the mono- or di- fluoro substituted bis-3’,5’ linked CDNs of the present invention stimulate the hSTING REF allele comparably to the endogenously produced ML cGAMP.
- Examples of cyclic purine dinucleotides are described in some detail in, e.g., U.S. Patent Nos.7,709458 and 7,592,326; WO2007/054279, WO2014/093936 and WO2014/189805; and Yan et al., Bioorg. Med. Chem Lett.18: 5631 (2008).
- Native CDN molecules are sensitive to degradation by phosphodiesterases that are present in host cells, for example in antigen presenting cells, which take up vaccine formulations that contain said native CDN molecules.
- the potency of a defined adjuvant may be diminished by such degradation, as the adjuvant would be unable to bind and activate its defined PRR target.
- Lower adjuvant potency could be measured, for example by a lower amount of induced expression of a signature molecule of innate immunity (e.g., IFN- ⁇ ), correlated with weaker vaccine potency, as defined by the magnitude of a measured antigen-specific immune response.
- substantially pure mono- or di-fluoro CDNs and particularly dithio-diphosphate derivatives of mono- or di-fluoro CDNs are provided.
- the synthesis process for said dithio-diphosphate derivatives of c-di-AMP, c-GAMP and c-di- GMP molecules results in a mixture of diastereomers, including Rp,Rp, Sp,Sp, SpRp, and Rp,Sp dithio-diphosphate molecules. These individual species may be separated, and exhibit substantial differences in their pharmaceutical characteristics, wherein the Rp,Rp diastereomer is preferred.
- administering refers without limitation to contact of an exogenous ligand, reagent, placebo, small molecule, pharmaceutical agent, therapeutic agent, diagnostic agent, or composition to the subject, cell, tissue, organ, or biological fluid, and the like.“Administration” can refer, e.g., to therapeutic,
- Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
- Administration also encompasses in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell.
- administered together or“co-administered” it is not meant to be implied that two or more agents be administered as a single composition.
- An“agonist,” as it relates to a ligand and receptor, comprises a molecule, combination of molecules, a complex, or a combination of reagents, that stimulates the receptor.
- an agonist of granulocyte-macrophage colony stimulating factor (GM-CSF) receptor can encompass GM-CSF, a mutein or derivative of GM-CSF, a peptide mimetic of GM-CSF, a small molecule that mimics the biological function of GM-CSF, or an antibody that stimulates GM-CSF receptor.
- An“antagonist,” as it relates to a ligand and receptor comprises a molecule, combination of molecules, or a complex, that inhibits, counteracts, downregulates, and/or desensitizes the receptor.“Antagonist” encompasses any reagent that inhibits a constitutive activity of the receptor.
- a constitutive activity is one that is manifest in the absence of a ligand/receptor interaction.
- “Antagonist” also encompasses any reagent that inhibits or prevents a stimulated (or regulated) activity of a receptor.
- an antagonist of GM-CSF receptor includes, without implying any limitation, an antibody that binds to the ligand (GM-CSF) and prevents it from binding to the receptor, or an antibody that binds to the receptor and prevents the ligand from binding to the receptor, or where the antibody locks the receptor in an inactive conformation.
- the term“antibody” as used herein refers to a peptide or polypeptide derived from, modeled after or substantially encoded by an immunoglobulin gene or
- immunoglobulin genes capable of specifically binding an antigen or epitope. See, e.g. Fundamental Immunology, 3rd Edition, W.E. Paul, ed., Raven Press, N.Y. (1993); Wilson (1994; J. Immunol. Methods 175:267-273; Yarmush (1992) J.
- antibody includes antigen-binding portions, i.e., "antigen binding sites,” (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHl domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHl domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
- antigen binding sites e.g., fragments, subs
- di-OH reference compound refers to a known CDN compound lacking any 2’ and/or 2’’ fluoro substituent of the mono-or di-F-CDN compounds as described herein, instead having an -OH substituent at these positions.
- known di-OH reference compound for the mono- or di-F-CDN is a known CDN compound lacking any 2’ and/or 2’’ fluoro substituent of the mono-or di-F-CDN compounds as described herein, instead having an -OH substituent at these positions.
- the known di-OH reference compound for the mono- or di-F-CDN is known CDN compound lacking any 2’ and/or 2’’ fluoro substituent of the mono-or di-F-CDN compounds as described herein, instead having an -OH substituent at these positions.
- the known di-OH reference compound for the mono- or di-F-CDN is a known CDN compound lacking any 2’ and/or 2’’ fluoro substituent of the mono-or di-F-CDN compounds as described here
- the di-OH reference compound for 3’3’-RR-(2’F-A)(2’F-A), 3’3’- RR-(2’F-A)(A), 3’3’-RR-(A)(2’F-A), and 3’3’-RR-(2’ ⁇ F-A)(2’ ⁇ F-A) is 3’3’-RR-(A)(A);
- the di-OH reference compound for 3’3’-RR-(G)(2’F-A), 3’3’-RR-(2’F-G)(2’F-A), and 3’3’-RR-(2’F-G)(A) is 3’3’-RR-(G)(A); and the di-OH reference compound for 3’3’- RR-(2’F-G)(
- di-OH reference compounds 3’3’-RR- (A)(A), 3’3’-RR-(G)(A) and 3’3’-RR-(G)(G) are described, for example, in PCT publication WO 2014/093936.
- an agent that enhances permeability or“an agent that enhances uptake” as used herein as it relates to cell permeability or uptake of compound by cells, is an agent that enhances the permeability of a cell to a compound or enhances the uptake of a compound by the cell, either in vitro, or in vivo.
- the mono- or di-F-CDN compounds as described herein, or di-OH reference compound can be compared in an in vitro cell based assay, wherein the assay may be performed with or without an agent, such as digitonin, that allows for the compound to be taken up by the cell.
- the mono- or di-F-CDN compounds as described herein are surprisingly active in such cell based assays without the need for such an agent that enhances permeability of the cell or enhances uptake of the compound by the cell, for example in the THP-1 cell assay as described herein.
- compositions comprising the mono- or di-F-CDN compounds as described herein can be formulated without an agent that enhances permeability of the cell or enhances uptake of the compound by the cell, for example without a delivery vehicle that enhances permeability of the cell or enhances cellular uptake.
- Such additives or delivery vehicles include, without limitation, lipid or lipid-like adjuvants, liposomes, interbilayer crosslinked multilamellar vesicles, nanocarriers, nanoparticles and the like, such as nanoparticles comprising Poly(lactic acid) (PLA), Poly(glycolic acid) (PGA), and/or their copolymers such as biodegradeable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles.
- PLA Poly(lactic acid)
- PGA Poly(glycolic acid)
- PLGA biodegradeable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles.
- substantially purified with regard to CDNs of the invention is meant that a specified species accounts for at least 50%, more often accounts for at least 60%, typically accounts for at least 70%, more typically accounts for at least 75%, most typically accounts for at least 80%, usually accounts for at least 85%, more usually accounts for at least 90%, most usually accounts for at least 95%, and conventionally accounts for at least 98% by weight, or greater, of the CDN activity present in a composition.
- the weights of water, buffers, salts, detergents, reductants, protease inhibitors, stabilizers (including an added protein such as albumin), and excipients are generally not used in the determination of purity.
- nucleic acid/complementary nucleic acid e.g., a cytokine to a cytokine receptor
- a“target” binding pair e.g., a cytokine to a cytokine receptor
- biomolecule indicates a binding reaction which is related to the presence of the target in a heterogeneous population of proteins and other biologics.
- Specific binding can mean, e.g., that the binding compound, nucleic acid ligand, antibody, or binding composition derived from the antigen-binding site of an antibody, of the contemplated method binds to its target with an affinity that is often at least 25% greater, more often at least 50% greater, most often at least 100% (2-fold) greater, normally at least ten times greater, more normally at least 20-times greater, and most normally at least 100-times greater than the affinity with a non-target molecule.
- Ligand refers to a small molecule, nucleic acid, peptide, polypeptide, saccharide, polysaccharide, glycan, glycoprotein, glycolipid, or combinations thereof that binds to a target biomolecule. While such ligands may be agonists or antagonists of a receptor, a ligand also encompasses a binding agent that is not an agonist or antagonist, and has no agonist or antagonist properties. Specific binding of a ligand for its cognate target is often expressed in terms of an“Affinity.” In preferred embodiments, the ligands of the present invention bind with affinities of between about 10 4 M -1 and about 10 8 M -1 .
- affinity can be measured by isothermal titration calorimetry (ITC).
- ITC isothermal titration calorimetry
- prodrug refers to a modification of contemplated compounds, wherein the modified compound exhibits less pharmacological activity (as compared to the modified compound) and wherein the modified compound is converted within the body (e.g., in a target cell or target organ) back into the unmodified form through enzymatic or non-enzymatic reactions.
- the hydroxyl on one ribose comprises a prodrug leaving group.
- Prodrugs can modify the physicochemical, biopharmaceutic, and pharmacokinetic properties of drugs.
- Traditional prodrugs are classified as drugs that are activated by undergoing transformation in vivo to form the active drug.
- Reasons for prodrug development are typically poor aqueous solubility, chemical instability, low oral bioavailability, lack of blood brain barrier penetration, and high first pass metabolism associated with the parent drug. Suitable prodrug moieties are described in, for example,“Prodrugs and Targeted Delivery,” J. Rautico, Ed., John Wiley & Sons, 2011.
- Examples include, but are not limited to, leaving groups removed by cellular esterases, a C6 to C18 fatty acid ester, a myristoyl ester, a pentanoyl ester, a hexanoyl ester, and a heptanoyl ester.
- the mono-2’F-CDN compounds as described herein can include substitution at the remaining 2’ hydroxyl, to form such esters.
- the term“subject” or“individual” as used herein refers to a human or non- human organism.
- subjects are“patients,” i.e., living humans that are receiving medical care for a disease or condition. This includes persons with no defined illness who are being investigated for signs of pathology.
- Preferred cancers for treatment with the compositions described herein include, but are not limited to prostate cancer, renal carcinoma, melanoma, pancreatic cancer, cervical cancer, ovarian cancer, colon cancer, head & neck cancer, lung cancer and breast cancer.
- “Therapeutically effective amount” is defined as an amount of a reagent or pharmaceutical composition that is sufficient to show a patient benefit, i.e., to cause a decrease, prevention, or amelioration of the symptoms of the condition being treated.
- a “diagnostically effective amount” is defined as an amount that is sufficient to produce a signal, image, or other diagnostic parameter. Effective amounts of the pharmaceutical formulation will vary according to factors such as the degree of susceptibility of the individual, the age, gender, and weight of the individual, and idiosyncratic responses of the individual.“Effective amount” encompasses, without limitation, an amount that can ameliorate, reverse, mitigate, prevent, or diagnose a symptom or sign of a medical condition or disorder or a causative process thereof. Unless dictated otherwise, explicitly or by context, an“effective amount” is not limited to a minimal amount sufficient to ameliorate a condition.
- Treatment or“treating” (with respect to a condition or a disease) is an approach for obtaining beneficial or desired results including and preferably clinical results.
- beneficial or desired results with respect to a disease include, but are not limited to, one or more of the following: preventing a disease, improving a condition associated with a disease, curing a disease, lessening severity of a disease, delaying progression of a disease, alleviating one or more symptoms associated with a disease, increasing the quality of life of one suffering from a disease, and/or prolonging survival.
- beneficial or desired results with respect to a condition include, but are not limited to, one or more of the following: preventing a condition, improving a condition, curing a condition, lessening severity of a condition, delaying progression of a condition, alleviating one or more symptoms associated with a condition, increasing the quality of life of one suffering from a condition, and/or prolonging survival.
- the beneficial or desired results include, but are not limited to, one or more of the following: reducing the proliferation of (or destroying) neoplastic or cancerous cells, reducing metastasis of neoplastic cells found in cancers, shrinking the size of a tumor, decreasing symptoms resulting from the cancer, increasing the quality of life of those suffering from the cancer, decreasing the dose of other medications required to treat the disease, delaying the progression of the cancer, and/or prolonging survival of patients having cancer.
- “treatment” of a subject can imply that the subject is in need of treatment, e.g., in the situation where the subject comprises a disorder expected to be ameliorated by administration of a reagent.
- “Vaccine” encompasses preventative vaccines. Vaccine also encompasses therapeutic vaccines, e.g., a vaccine administered to a mammal that comprises a condition or disorder associated with the antigen or epitope provided by the vaccine.
- Cyclic Purine Dinucleotides [00157] Prokaryotic as well as eukaryotic cells use various small molecules for cell signaling and intra- and intercellular communication. Cyclic nucleotides like cGMP, cAMP, etc.
- prokaryotic cells are known to have regulatory and initiating activity in pro- and eukaryotic cells. Unlike eukaryotic cells, prokaryotic cells also use cyclic purine dinucleotides as regulatory molecules. In prokaryotes, the condensation of two GTP molecules is catalyzed by the enzyme diguanylate cyclase (DGC) to give c-diGMP, which represents an important regulator in bacteria.
- DGC diguanylate cyclase
- cyclic diGMP or analogs thereof can also stimulate or enhance immune or inflammatory response in a patient or can enhance the immune response to a vaccine by serving as an adjuvant in mammals.
- Cytosolic detection of pathogen-derived DNA requires signaling through TANK binding kinase 1 (TBK1) and its downstream transcription factor, IFN-regulatory factor 3 (IRF3).
- IRF3 IFN-regulatory factor 3
- a transmembrane protein called STING (stimulator of IFN genes; also known as MITA, ERIS, MPYS and TMEM173) functions as the signaling receptor for these cyclic purine dinucleotides, causing stimulation of the TBK1-IRF3 signalling axis and a STING-dependent type I interferon response. See, e.g., Fig. 1.
- CDNs may be modified using standard organic chemistry techniques in order to produce the CDNs of the present invention.
- the mono- or di-F-CDN compounds of the present invention as described herein are potent STING agonists, and demonstrate unexpected improvement over known non-fluoro substituted CDN compounds, such as RR-(A)(A), or the endogenously produced cGAS product, ML cGAMP.
- the mono- or di-F-CDN compounds of the present invention are compared to known compounds that differ in the substitution of the 2’ and 2’’ position, for example a di-OH reference compound such as 3’3’-(A)(A), 3’3’-(G)(A), 3’3’-RR-(A)(A) or 3’3’-RR-(G)(A).
- a di-OH reference compound such as 3’3’-(A)(A), 3’3’-(G)(A), 3’3’-RR-(A)(A) or 3’3’-RR-(G)(A).
- Examples 11-17 The properties of the mono- or di-F- CDN compounds are demonstrated in Examples 11-17 below, where the compounds demonstrate an improvement over the di-OH reference compound as having one or more of i) a higher Tm shift in a DSF assay as described in Example 11 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); ii) a higher relative expression of IFN- ⁇ transcript in an hPBMC assay as described in Example 13 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); or iii) a lower EC50 in a THP1 cell assay as described in Example 14, where preferably the THP1 assay is performed in the absence of digitonin.
- the mono- or di-F-CDN demonstrates an improvement over the di-OH reference compound as having two or more of i) a higher T m shift in a DSF assay as described in Example 14 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); ii) a higher relative expression of IFN- ⁇ transcript in an hPBMC assay as described in Example 13 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); or iii) a lower EC50 in a THP1 cell assay as described in Example 14, where preferably the THP1 assay is performed in the absence of digitonin.
- the mono- or di-F-CDN demonstrates an improvement over the di- OH reference compound as having each of i) a higher Tm shift in a DSF assay as described in Example 11 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); ii) a higher relative expression of IFN- ⁇ transcript in an hPBMC assay as described in Example 13 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF); or iii) a lower EC50 in a THP1 cell assay as described in Example 14, where preferably the THP1 assay is performed in the absence of digitonin.
- a higher Tm shift in a DSF assay as described in Example 11 for one or more of hSTING (WT), hSTING (HAQ) or hSTING (REF)
- the mono- or di-F-CDN compound has at least a 2-fold, at least a 5-fold, at least a 10-fold, at least a 50- fold, at least a 100-fold, at least a 500-fold, or at least a 1000-fold higher relative expression of IFN- ⁇ transcript in an hPBMC assay as described in Example 13 for hSTING REF allele as compared to 3’3’-RR-(A)(A).
- the mono- or di-F-CDN compound has an EC50 in the THP1 assay described in Example 14 without addition of digitonin that is at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, or at least 8-fold lower than the EC50 of a di-OH reference compound.
- the mono- or di-F-CDN compound has an EC50 in the THP1 cell assay without addition of an agent that enhances the permeability of the compound to the cell or an agent that enhances the uptake of the compound by the cell that is less than 40 ⁇ M, less than 30 ⁇ M, less than 20 ⁇ M, less than 15 ⁇ M, or less than 10 ⁇ M.
- the mono- or di-F-CDN compound has an EC50 in the THP1 assay described in Example 14 without addition of digitonin that is less than 40 ⁇ M, less than 30 ⁇ M, less than 20 ⁇ M, less than 15 ⁇ M, or less than 10 ⁇ M.
- Preferred cyclic purine dinucleotides are phosphorothioate analogues, referred to herein as“thiophosphates”.
- Phosphorothioates are a variant of normal nucleotides in which one of the nonbridging oxygens is replaced by a sulfur.
- the sulfurization of the internucleotide bond dramatically reduces the action of endo-and exonucleases, including 5' to 3' and 3' to 5' DNA POL 1 exonuclease, nucleases S1 and P1, RNases, serum nucleases and snake venom phosphodiesterase.
- the potential for crossing the lipid bilayer increases.
- cyclic purine dinucleotides of the present invention comprise 2’-F substituted forms of CDNs, and in particular CDN
- Rp,Rp, Sp,Sp, Sp,Rp, and Rp,Sp forms may likewise be obtained.
- Preferred purines include, but are not limited to, adenine, guanine, inosine, hypoxanthine, xanthine, isoguanine, etc.
- the mono- or di-F-CDNs of the present invention are preferably phosphorothioate analogues, including substantially pure Sp,Sp, Rp,Rp, SpRp, or Rp,Sp stereoisomers thereof, and most preferably substantially pure Rp,Rp stereoisomers thereof.
- alkyl refers to a saturated straight or branched hydrocarbon radical containing up to twenty four carbon atoms.
- alkyl groups include without limitation, methyl, ethyl, propyl, butyl, isopropyl, n-hexyl, octyl, decyl, dodecyl and the like.
- Alkyl groups typically include from 1 to about 24 carbon atoms, more typically from 1 to about 12 carbon atoms with from 1 to about 6 carbon atoms being more preferred.
- the term “lower alkyl” as used herein includes from 1 to about 6 carbon atoms.
- Alkyl groups as used herein may optionally include one or more further substituent groups.
- alkenyl refers to a straight or branched
- alkenyl groups include without limitation, ethenyl, propenyl, butenyl, l-methyl-2-buten-l-yl, dienes such as 1,3 -butadiene and the like.
- Alkenyl groups typically include from 2 to about 24 carbon atoms, more typically from 2 to about 12 carbon atoms with from 2 to about 6 carbon atoms being more preferred.
- Alkenyl groups as used herein may optionally include one or more further substituent groups.
- alkynyl refers to a straight or branched
- alkynyl groups include, without limitation, ethynyl, 1-propynyl, 1-butynyl, and the like.
- Alkynyl groups typically include from 2 to about 24 carbon atoms, more typically from 2 to about 12 carbon atoms with from 2 to about 6 carbon atoms being more preferred.
- Alkynyl groups as used herein may optionally include one or more further substituent groups.
- acyl refers to a radical formed by removal of a hydroxyl group from an organic acid and has the general Formula -C(O)-X where X is typically aliphatic, alicyclic or aromatic. Examples include aliphatic carbonyls, aromatic carbonyls, aliphatic sulfonyls, aromatic sulfinyls, aliphatic sulfinyls, aromatic phosphates, aliphatic phosphates and the like. Acyl groups as used herein may optionally include further substituent groups.
- alicyclic refers to a cyclic ring system wherein the ring is aliphatic.
- the ring system can comprise one or more rings wherein at least one ring is aliphatic.
- Preferred alicyclics include rings having from about 5 to about 9 carbon atoms in the ring.
- Alicyclic as used herein may optionally include further substituent groups.
- the term "aliphatic,” as used herein, refers to a straight or branched hydrocarbon radical containing up to twenty four carbon atoms wherein the saturation between any two carbon atoms is a single, double or triple bond.
- An aliphatic group preferably contains from 1 to about 24 carbon atoms, more typically from 1 to about 12 carbon atoms with from 1 to about 6 carbon atoms being more preferred.
- the straight or branched chain of an aliphatic group may be interrupted with one or more heteroatoms that include nitrogen, oxygen, sulfur and phosphorus.
- Such aliphatic groups interrupted by heteroatoms include without limitation, polyalkoxys, such as polyalkylene glycols, polyamines, and polyimines. Aliphatic groups as used herein may optionally include further substituent groups.
- alkoxy refers to a radical formed between an alkyl group and an oxygen atom wherein the oxygen atom is used to attach the alkoxy group to a parent molecule.
- alkoxy groups include without limitation, methoxy, ethoxy, propoxy, isopropoxy, n-butoxy, sec-butoxy, tert-butoxy, n-pentoxy, neopentoxy, n-hexoxy and the like.
- Alkoxy groups as used herein may optionally include further substituent groups.
- aminoalkyl refers to an amino substituted C ⁇ -Cn alkyl radical. The alkyl portion of the radical forms a covalent bond with a parent molecule. The amino group can be located at any position and the aminoalkyl group can be substituted with a further substituent group at the alkyl and/or amino portions.
- aralkyl and arylalkyl refer to an aromatic group that is covalently linked to a C ⁇ -Cn alkyl radical.
- the alkyl radical portion of the resulting aralkyl (or arylalkyl) group forms a covalent bond with a parent molecule. Examples include without limitation, benzyl, phenethyl and the like.
- Aralkyl groups as used herein may optionally include further substituent groups attached to the alkyl, the aryl or both groups that form the radical group.
- aryl and “aromatic,” as used herein, refer to a mono- or polycyclic carbocyclic ring system radicals having one or more aromatic rings.
- aryl groups include without limitation, phenyl, naphthyl, tetrahydronaphthyl, indanyl, idenyl and the like. Preferred aryl ring systems have from about 5 to about 20 carbon atoms in one or more rings. Aryl groups as used herein may optionally include further substituent groups. [00173]
- halo and “halogen,” as used herein, refer to an atom selected from fluorine, chlorine, bromine and iodine.
- heteroaryl and “heteroaromatic,” as used herein, refer to a radical comprising a mono- or poly-cyclic aromatic ring, ring system or fused ring system wherein at least one of the rings is aromatic and includes one or more heteroatoms.
- Heteroaryl is also meant to include fused ring systems including systems where one or more of the fused rings contain no heteroatoms.
- Heteroaryl groups typically include one ring atom selected from sulfur, nitrogen or oxygen. Examples of heteroaryl groups include without limitation, pyridinyl, pyrazinyl, pyrimidinyl, pyrrolyl, pyrazolyl, imidazolyl, thiazolyl, oxazolyl, isooxazolyl, thiadiazolyl, oxadiazolyl, thiophenyl, furanyl, quinolinyl, isoquinolinyl, benzimidazolyl, benzooxazolyl, quinoxalinyl and the like.
- Heteroaryl radicals can be attached to a parent molecule directly or through a linking moiety such as an aliphatic group or hetero atom. Heteroaryl groups as used herein may optionally include further substituent groups.
- heteroarylalkyl refers to a heteroaryl group as previously defined that further includes a covalently attached C1-C12 alkyl radical. The alkyl radical portion of the resulting heteroarylalkyl group is capable of forming a covalent bond with a parent molecule. Examples include without limitation,
- the mono- or di-F CDN compounds aslo include prodrug forms of the CDNs, and in particular CDN thiophosphates.
- Produrgs can modify the physicochemical, biopharmaceutic, and pharmacokinetic properties of drugs.
- Traditional prodrugs are classified as drugs that are activated by undergoing transformation in vivo to form the active drug.
- prodrug development is typically poor aqueous solubility, chemical instability, low oral bioavailability, lack of blood brain barrier penetration, and high first pass metabolism associated with the parent drug.
- Suitable prodrug moieties are described in, for example,“Prodrugs and Targeted Delivery,” J. Rautico, Ed., John Wiley & Sons, 2011.
- substantially pure as used herein with regard to dithio-diphosphate cyclic purine dinucleotides refers to an Rp,Rp or Rp,Sp form which is at least 75% pure relative to other possible stereochemistries at the chiral phosphorus centers indicated in the mono- or di-F-RR-CDN compounds as described herein, such as compounds of Formula II.
- a“substantially pure 3’3’-RR-(2’F-A)(2’F-A)” would be at least 75% pure with regard to the Rp,Sp and Sp,Sp forms, i.e.
- a substantially pure cyclic purine dinucleotide is at least 85% pure, at least 90% pure, at least 95% pure, at least 97% pure, and at least 99% pure. While a substantially pure cyclic purine dinucleotide preparation of the invention is“stereochemically pure,” this is not meant to indicate that all CDNs within the preparation having a particular stereochemistry at these chiral centers are otherwise identical.
- a substantially pure cyclic purine dinucleotide preparation may contain a combination of 3’3’-RR-(2’F-A)(2’F-A) and 3’3’- RR-(2’F-G)(2’F-A)and still be a substantially pure cyclic purine dinucleotide preparation.
- Such a preparation may also include other components as described hereinafter that are advantageous for patient treatment, provided that all CDNs within the preparation having a particular stereochemistry at these chiral centers.
- the mono- or di-F-CDN compounds and compositions thereof described herein can be administered to a host, either alone or in combination with a
- the immune response can comprise, without limitation, specific immune response, non-specific immune response, both specific and non-specific response, innate response, primary immune response, adaptive immunity, secondary immune response, memory immune response, immune cell activation, immune cell proliferation, immune cell differentiation, and cytokine expression.
- the mono- or di-F-CDN compounds and compositions thereof described herein are administered in conjunction with one or more additional compositions including vaccines intended to stimulate an immune response to one or more
- the mono- or di-F-CDN compounds and compositions thereof described herein may be administered before, after, and/or simultaneously with an additional therapeutic or prophylactic composition or modality.
- B7 costimulatory molecule interleukin-2, interferon- ⁇ , GM-CSF, CTLA-4 antagonists, OX-40/OX-40 ligand, CD40/CD40 ligand, sargramostim, levamisol, vaccinia virus, Bacille Calmette-Guerin (BCG), liposomes, alum, Freund's complete or incomplete adjuvant, detoxified endotoxins, mineral oils, surface active substances such as lipolecithin, pluronic polyols, polyanions, peptides, and oil or hydrocarbon emulsions.
- BCG Bacille Calmette-Guerin
- Carriers for inducing a T cell immune response which preferentially stimulate a cytolytic T cell response versus an antibody response are preferred, although those that stimulate both types of response can be used as well.
- the agent is a polypeptide
- the polypeptide itself or a polynucleotide encoding the polypeptide can be administered.
- the carrier can be a cell, such as an antigen presenting cell (APC) or a dendritic cell.
- APC antigen presenting cell
- Antigen presenting cells include such cell types as macrophages, dendritic cells and B cells.
- Other professional antigen-presenting cells include monocytes, marginal zone Kupffer cells, microglia, Langerhans' cells, interdigitating dendritic cells, follicular dendritic cells, and T cells.
- Facultative antigen-presenting cells can also be used.
- facultative antigen-presenting cells include astrocytes, follicular cells, endothelium and fibroblasts.
- the carrier can be a bacterial cell that is transformed to express the polypeptide or to deliver a polynucleoteide which is subsequently expressed in cells of the vaccinated individual.
- Adjuvants such as aluminum hydroxide or aluminum phosphate, can be added to increase the ability of the vaccine to trigger, enhance, or prolong an immune response.
- TLR toll-like receptor
- retinoic acid-inducible gene I (RIG-I) agonists such as poly I:C, used separately or in combination with the described compositions are also potential adjuvants.
- Other representative examples of adjuvants include the synthetic adjuvant QS-21 comprising a homogeneous saponin purified from the bark of Quillaja saponaria and Corynebacterium parvum (McCune et al., Cancer, 1979; 43:1619). It will be understood that the adjuvant is subject to optimization. In other words, the skilled artisan can engage in routine experimentation to determine the best adjuvant to use. [00180] Methods for co-administration with an additional therapeutic agent are well known in the art (Hardman, et al. (eds.) (2001) Goodman and Gilman’s The
- co-administration or administration together indicates treating a subject with two or more agents, where the agents can be administered simultaneously or at different times.
- agents may be delivered to a single subject as separate administrations, which may be at essentially the same time or different times, and which may be by the same route or different routes of administration.
- Such agents may be delivered to a single subject in the same administration (e.g. same formulation) such that they are administered at the same time by the same route of administration.
- adjuvant properties of the compounds of the present invention their use may also combined with other therapeutic modalities including other vaccines, adjuvants, antigen, antibodies, and immune modulators. Examples are provided below.
- Adjuvants [00182]
- the compositions or methods of the present invention may further comprise one or more additional substances which, because of their nature, can act to stimulate or otherwise utilize the immune system to respond to the cancer antigens present on the targeted tumor cell(s).
- Such adjuvants include, but are not limited to, lipids, liposomes, inactivated bacteria which induce innate immunity (e.g., inactivated or attenuated Listeria monocytogenes), compositions which mediate innate immune activation via Toll-like Receptors (TLRs), (NOD)-like receptors (NLRs), Retinoic acid inducible gene-based (RIG)-I-like receptors (RLRs), C-type lectin receptors (CLRs) and/or pathogen-associated molecular patterns (”PAMPS”).
- TLRs Toll-like Receptors
- NLRs NOD-like receptors
- RLRs Retinoic acid inducible gene-based
- RLRs Retinoic acid inducible gene-based CLRs
- CLRs C-type lectin receptors
- PAMPS pathogen-associated molecular patterns
- PAMPs examples include lipoproteins, lipopolypeptides, peptidoglycans, zymosan, lipopolysaccharide, neisserial porins, flagellin, profillin, galactoceramide, muramyl dipeptide.
- Peptidoglycans, lipoproteins, and lipoteichoic acids are cell wall components of Gram-positive.
- Lipopolysaccharides are expressed by most bacteria, with MPL being one example.
- Flagellin refers to the structural component of bacterial flagella that is secreted by pathogenic and commensal bacterial.
- ⁇ -Galactosylceramide ( ⁇ -GalCer) is an activator of natural killer T (NKT) cells.
- Muramyl dipeptide is a bioactive peptidoglycan motif common to all bacteria. This list is not meant to be limiting.
- Preferred adjuvant compositions are described below.
- the mono- or di-F-CDN compounds as described herein can be used in combination with an immune checkpoint inhibitor, such as an immune checkpoint inhibitor selected from the group consisting of a CTLA-4 pathway antagonist, a PD-1 pathway antagonist, a Tim-3 pathway antagonist, a Vista pathway antagonist, a BTLA pathway antagonist, a LAG-3 pathway antagonist, or a TIGIT pathway antagonist.
- an immune checkpoint inhibitor such as an immune checkpoint inhibitor selected from the group consisting of a CTLA-4 pathway antagonist, a PD-1 pathway antagonist, a Tim-3 pathway antagonist, a Vista pathway antagonist, a BTLA pathway antagonist, a LAG-3 pathway antagonist, or a TIGIT pathway antagonist.
- the immune checkpoint inhibitor is selected from the group consisting of an anti-CTLA-4 antibody, an anti-PD-1 antibody, an anti-Tim-3 antibody, an anti-Vista antibody, an anti-BTLA antibody, an anti-LAG-3 antibody, or an anti-TIGIT antibody.
- the mono- or di-F-CDN compounds as described herein can be used in combination with CTLA-4 pathway antagonists.
- the combination is used to treat a solid tumor or a hematologic malignancy.
- CTLA-4 is thought to be an important negative regulator of the adaptive immune response.
- Activated T cells upregulate CTLA-4, which binds CD80 and CD86 on antigen-presenting cells with higher affinity than CD28, thus inhibiting T-cell stimulation, IL-2 gene expression and T-cell proliferation.
- Anti-tumor effects of CTLA4 blockade have been observed in murine models of colon carcinoma, metastatic prostate cancer, and metastatic melanoma.
- the CTLA-4 pathway antogonist is an anti-CTLA-4 antibody molecule selected from the group consisting of tremelimumab and ipilimumab.
- the anti-CTLA-4 antibody is an anti-CTLA-4 antibody as disclosed in e.g., U.S. Pat. No.5,811,097. [00185] Ipilimumab (Yervoy TM , a CTLA-4 antibody, also known as MDX-010, CAS No.
- tremelimumab IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206
- ipilimumab and tremelimumab Phase I and II studies using ipilimumab and tremelimumab have demonstrated clinical activity in cancer patients.
- Other negative immune regulators which may be targeted by a similar strategy include programmed cell death 1 (PD-1), B and T lymphocyte attenuator, transforming growth factor beta ⁇ , interleukin-10, and vascular endothelial growth factor.
- the mono- or di-F-CDN compounds as described herein can be used in combination with an anti-CTLA-4 antibody and an anti-PD-1 antibody.
- the combination includes an anti-PD-1 antibody molecule, e.g., as described herein, and an anti-CTLA-4 antibody, e.g., ipilimumab.
- exemplary doses that can be use include a dose of anti-PD-1 antibody molecule of about 1 to 10 mg/kg, e.g., 3 mg/kg, and a dose of an anti-CTLA-4 antibody, e.g., ipilimumab, of about 3 mg/kg.
- the mono- or di-F-CDN compounds as described herein can be used in combination with PD-1 pathway antagonists.
- the combination is used to treat a solid tumor or a hematologic malignancy.
- PD-1 is another negative regulator of adaptive immune response that is expressed on activated T-cells.
- PD-1 binds to B7-H1 and B7-DC, and the engagement of PD-1 suppresses T-cell activation.
- Anti- tumor effects have been demonstrated with PD-1 pathway blockade.
- Anti-PD-1 antibody molecules e.g.
- Nivolumab (Opdivo TM ), pembrolizumab (Keytruda TM ), and pidilizumab), and AMP-224 have been reported in the literature to be examples of PD-1 pathway blockers which may find use in the present invention.
- the PD-1 pathway antogonist is an anti-PD-1 antibody molecule selected from the group consisting of nivolumab, pembrolizumab or pidilizumab. [00188]
- the anti-PD-1 antibody is nivolumab.
- Alternative names for nivolumab include MDX- 1106, MDX-1106-04, ONO-4538, or BMS-936558.
- the anti-PD- 1 antibody is nivolumab (CAS Registry Number: 946414-94-4).
- Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PD1.
- Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD1 are disclosed in US 8,008,449 and WO2006/121168.
- the inhibitor of PD-1 is nivolumab, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy chain amino acid sequence of nivolumab is as follows: ⁇
- the anti-PD-1 antibody is pembrolizumab.
- Pembrolizumab (also referred to as lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA®; Merck) is a humanized IgG4 monoclonal antibody that binds to PD- 1.
- Pembrolizumab and other humanized anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134–44, US 8,354,509 and WO2009/114335.
- the inhibitor of PD-1 is pembrolizumab, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy chain amino acid sequences of pembrolizumab is as follows:
- the anti-PD-1 antibody is pidilizumab.
- Pidilizumab (CT-011; Cure Tech) is a humanized IgG1k monoclonal antibody that binds to PD-1. Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are disclosed in WO2009/101611. [00195] In some embodiments, the anti-PD-1 antibody is AMP 514 (Amplimmune), or an anti-PD-1 antibody as disclosed in US 8,609,089, US 2010028330, and/or US
- the PD-1 pathway antagonist is an anti-PD-1 antibody molecule disclosed in US 2015/0210769, published on July 30, 2015, entitled“Antibody Molecules to PD-1 and Uses Thereof”.
- the anti-PD-1 antibody molecule includes at least one or two heavy chain variable domain (optionally including a constant region), at least one or two light chain variable domain (optionally including a constant region), or both, comprising the amino acid sequence of BAP049-Clone-A, BAP049-Clone-B, BAP049- Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1 of US 2015/0210769, or encoded by the nucleotide sequence in Table 1 therein; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the
- the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as shown in Table 4 of US 2015/0210769; or a sequence substantially identical thereto.
- the disclosure of US 2015/0210769 is hereby incorporated by reference as it relates to the amino acid sequences and nucleotide sequences in Table 4 therein.
- the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described in US 2015/0210769, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-hum10, BAP049-hum11, BAP049-hum12, BAP049-hum13, BAP049-hum14, BAP049-hum15, BAP049-hum16, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-
- CDRs complementarity
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0210769, or encoded by a nucleotide sequence shown in Table 1 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0210769, or encoded by a nucleotide sequence shown in Table 1 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 therein, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
- Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74
- the anti-PD-1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1 of US
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 therein, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti-PD-1 antibody molecule includes: (a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a
- a VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32, each as disclosed in Table 1 of US 2015/0210769;
- a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3
- the anti-PD-1 antibody molecule comprises (i) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1, SEQ ID NO: 4, or SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 5; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and (ii) a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 32 or SEQ ID NO: 33, each as disclosed in Table 1 of US 2015/0210769.
- VH heavy chain variable region
- VL light chain variable region
- the PD-1 pathway antagonist is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-Ll or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
- the PD-1 inhibitor is AMP-224 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342) is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1.
- the PD-1 pathway antagonist is a PD-L1 or PD-L2 inhibitor.
- the PD-L1 or PD-L2 inhibitor is an anti-PD-L1 antibody or an anti-PD-L2 antibody.
- the anti-PD-Ll inhibitor is chosen from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, or MDX-1105.
- the PD-L1 inhibitor is an anti-PD-L1 antibody MSB0010718C.
- MSB0010718C also referred to as A09-246-2; Merck Serono
- A09-246-2 Merck Serono
- MSB0010718C and other humanized anti-PD-L1 antibodies are disclosed in WO2013/079174, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the heavy chain amino acid sequence (SEQ ID NO: 24 as disclosed in WO2013/079174) ⁇ of MSB0010718C includes at least the following:
- WO2013/079174 of MSB0010718C includes at least the following:
- the PD-L1 inhibitor is YW243.55.S70.
- YW243.55.S70 antibody is an anti-PD-Ll antibody as described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID Nos.20 and 21, respectively), and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the PD-L1 inhibitor is MDX-1105.
- MDX-1105 also known as BMS-936559
- BMS-936559 is an anti-PD-Ll antibody described in WO2007/005874, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
- the PD-L1 inhibitor is MDPL3280A (Genentech / Roche).
- MDPL3280A is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1.
- MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Patent No.: 7,943,743 and U.S Publication No.: 20120039906.
- the PD-L2 inhibitor is AMP-224.
- AMP-224 is a PD- L2 Fc fusion soluble receptor that blocks the interaction between PD1 and B7-H1 (B7- DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342
- the mono- or di-F-CDN compounds as described herein can be used in combination with TIM-3 pathway antagonists.
- the combination is used to treat a solid tumor or a hematologic malignancy.
- the TIM- 3 pathway antagonist is an anti-TIM-3 antibody.
- anti-TIM-3 antibody molecules are disclosed in US 2015/0218274, published on August 6, 2015, entitled“Antibody Molecules to TIM-3 and Uses Thereof”.
- the anti- TIM-3 antibody molecule includes at least one or two heavy chain variable domain (optionally including a constant region), at least one or two light chain variable domain (optionally including a constant region), or both, comprising the amino acid sequence of ABTIM3, ABTIM3-hum01, ABTIM3-hum02, ABTIM3-hum03, ABTIM3-hum04, ABTIM3-hum05, ABTIM3-hum06, ABTIM3- hum07, ABTIM3-hum08, ABTIM3-hum09, ABTIM3-hum10, ABTIM3-hum11,
- the anti-TIM-3 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as shown in US 2015/0218274; or a sequence substantially identical thereto.
- the anti- TIM-3 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described in US 2015/0218274, e.g., an antibody chosen from any of ABTIM3, ABTIM3-hum01, ABTIM3-hum02, ABTIM3-hum03, ABTIM3-hum04, ABTIM3-hum05, ABTIM3- hum06, ABTIM3-hum07, ABTIM3-hum08, ABTIM3-hum09, ABTIM3-hum10, ABTIM3-hum11, ABTIM3-hum12, ABTIM3-hum13, ABTIM3-hum14, ABTIM3- hum15, ABTIM3-hum16,
- CDRs complementarity determining regions
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Tables 1-4 therein, or encoded by a nucleotide sequence shown in Table 1-4 therein.
- the anti- TIM-3 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Tables 1-4 of US 2015/0218274, or encoded by a nucleotide sequence shown in Tables 1-4 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Tables 1-4 therein, or encoded by a nucleotide sequence shown in Tables 1-4 therein.
- the anti-TIM-3 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti-TIM-3 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Tables 1-4 of US 2015/0218274, or encoded by a nucleotide sequence shown in Tables 1-4 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Tables 1-4 therein, or encoded by a nucleotide sequence shown in Tables 1-4 therein.
- the anti- TIM-3 antibody molecule includes: (a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 9; a VHCDR2 amino acid sequence of SEQ ID NO: 10; and a VHCDR3 amino acid sequence of SEQ ID NO: 5; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 12, a VLCDR2 amino acid sequence of SEQ ID NO: 13, and a VLCDR3 amino acid sequence of SEQ ID NO: 14, each as disclosed in Tables 1-4 of US 2015/0218274; (b) a VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 3; a VHCDR2 amino acid sequence of SEQ ID NO: 4; and a VHCDR3 amino acid sequence of SEQ ID NO: 5; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 6, a VH comprising a VHCDR
- the TIM-3 pathway antagonist is an anti-TIM-3 antibody as disclosed in U.S. Patent No.: 8,552,156, WO 2011/155607, EP 2581113 or U.S Publication No.: 2014/044728.
- the mono- or di-F-CDN compounds as described herein can be used in combination with LAG-3 pathway antagonists. In some embodiments, the combination is used to treat a solid tumor or a hematologic malignancy.
- the LAG-3 pathway antagonist is an anti-LAG-3 antibody.
- the anti- LAG-3 antibody molecules are disclosed in US 2015/0259420, filed March 13, 2015, entitled“Antibody Molecules to LAG-3 and Uses Thereof”.
- the anti- LAG-3antibody molecule includes at least one or two heavy chain variable domain (optionally including a constant region), at least one or two light chain variable domain (optionally including a constant region), or both, comprising the amino acid sequence of any of BAP050-hum01, BAP050-hum02, BAP050-hum03, BAP050-hum04, BAP050-hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050-hum09, BAP050-hum10, BAP050-hum11, BAP050-hum12, BAP050-hum13, BAP050-hum14, BAP050-hum15, BAP050-hum16, BAP050-hum17, BAP050-hum18, BAP050-hum19, BAP050-hum20, huBAP050(Ser) (e.g., BAP050- hum01-Ser, BAP050-hum02-Ser, BAP050-hum03-Ser
- the anti- LAG-3 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP050-hum01, BAP050-hum02, BAP050-hum03, BAP050-hum04, BAP050-hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050-hum09, BAP050-hum10, BAP050-hum11, BAP050-hum12, BAP050-hum13, BAP050-hum14, BAP050-hum15, BAP050-hum16, BAP050-hum17, BAP050-hum18, BAP050-hum19, BAP050-hum20, h
- CDRs complementarity determining regions
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 therein, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti-LAG-3 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0259420, or encoded by a nucleotide sequence shown in Table 1 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 therein, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti-PD-L1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
- the anti- LAG-3 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0259420, or encoded by a nucleotide sequence shown in Table 1 therein.
- one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 therein, or encoded by a nucleotide sequence shown in Table 1 therein.
- the anti- LAG-3 antibody molecule includes: (i) a heavy chain variable region (VH) including a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1, SEQ ID NO: 4 or SEQ ID NO: 286; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3, each as disclosed in Table 1 of US 2015/0259420; and (ii) a light chain variable region (VL) including a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12, each as disclosed in Table 1 of US 2015/0259420.
- VH heavy chain variable region
- VL light chain variable region
- the anti-LAG-3 antibody molecule includes: (i) a heavy chain variable region (VH) including a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1, SEQ ID NO: 4 or SEQ ID NO: 286; a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3, each as disclosed in Table 1 of US 2015/0259420; and (ii) a light chain variable region (VL) including a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15, each as disclosed in Table 1 of US 2015/0259420.
- the anti-LAG-3 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 1 as disclosed in Table 1 of US
- the anti-LAG-3 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 4 as disclosed in Table 1 of US
- the anti-LAG-3 antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 286, as disclosed in Table 1 of US 2015/0259420.
- the anti-LAG-3 antibody is BMS-986016.
- BMS- 986016 also referred to as BMS986016; Bristol-Myers Squibb
- BMS-986016 and other humanized anti-LAG-3 antibodies are disclosed in US 2011/0150892, WO2010/019570, and WO2014/008218.
- T-cell Receptor Agonists The mono- or di-F-CDN compounds as described herein can be used in combination with a T-cell receptor agonist, such as a CD28 agonist, an OX40 agonist, a GITR agonist, a CD137 agonist, a CD27 agonist or an HVEM agonist.
- a T-cell receptor agonist such as a CD28 agonist, an OX40 agonist, a GITR agonist, a CD137 agonist, a CD27 agonist or an HVEM agonist.
- exemplary CD27 agonists include an anti-CD27 agonistic antibody, e.g. as described in PCT Publication No. WO 2012/004367.
- the mono- or di-F-CDN compounds as described herein can be used in combination with a GITR agonist.
- the combination is used to treat a solid tumor or a hematologic malignancy.
- GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies), such as, a GITR fusion protein described in U.S. Patent No.: 6,111,090, European Patent No.: 0920505B1, U.S Patent No.: 8,586,023, PCT Publication Nos.: WO 2010/003118 and 2011/090754, or an anti-GITR antibody described, e.g., in U.S. Patent No.:
- the mono- or di-F-CDN compounds as described herein is used in combination with a GITR agonist used in combination with a PD-1 inhibitor, e.g., as described in WO2015/026684.
- the mono- or di-F-CDN compounds as described herein is used in combination with a GITR agonist used in combination with a TLR agonist, e.g., as described in WO2004060319, and International Publication No.:
- TLR Agonists The mono- or di-F-CDN compounds as described herein can be used in combination with a Toll like receptor agonist.
- the term“Toll like receptor” (or“TLR”) as used herein refers to a member of the Toll-like receptor family of proteins or a fragment thereof that senses a microbial product and/or initiates an adaptive immune response.
- a TLR activates a dendritic cell (DC).
- DC dendritic cell
- TLRs are a family of pattern recognition receptors that were initially identified as sensors of the innate immune system that recognize microbial pathogens.
- TLRs comprise a family of conserved membrane spanning molecules containing an ectodomain of leucine-rich repeats, a transmembrane domain and an intracellular TIR (Toll/IL-1R) domain. TLRs recognize distinct structures in microbes, often referred to as“PAMPs” (pathogen associated molecular patterns). Ligand binding to TLRs invokes a cascade of intra-cellular signaling pathways that induce the production of factors involved in inflammation and immunity. [00237] In humans, ten TLR have been identified. TLRs that are expressed on the surface of cells include TLR-1,-2,-4,-5, and -6, while TLR-3, -7/8, and -9 are expressed with the ER compartment.
- Human dendritic cell subsets can be identified on the basis of distinct TLR expression patterns.
- the myeloid or“conventional” subset of DC expresses TLRs 1–8 when stimulated, and a cascade of activation markers (e.g. CD80, CD86, MHC class I and II, CCR7), pro-inflammatory cytokines, and chemokines are produced.
- a cascade of activation markers e.g. CD80, CD86, MHC class I and II, CCR7
- pro-inflammatory cytokines e.g. CD80, CD86, MHC class I and II, CCR7
- chemokines e.g. CD80, CD86, MHC class I and II, CCR7
- a result of this stimulation and resulting expression is antigen- specific CD4+ and CD8+ T cell priming.
- These DCs acquire an enhanced capacity to take up antigens and present them in an appropriate form to T cells.
- the plasmacytoid subset of DC expresses only TLR7 and TLR9 upon activation, with a resulting activation of NK cells as well as T-cells.
- TLR7 and TLR9 the plasmacytoid subset of DC expresses only TLR7 and TLR9 upon activation, with a resulting activation of NK cells as well as T-cells.
- activating DC with TLR agonists may be beneficial for priming anti-tumor immunity in an immunotherapy approach to the treatment of cancer. It has also been suggested that successful treatment of breast cancer using radiation and chemotherapy requires TLR4 activation.
- TLR agonists known in the art and finding use in the present invention include, but are not limited to, the following: Pam3Cys, a TLR-1/2 agonist; CFA, a TLR-2 agonist; MALP2, a TLR-2 agonist; Pam2Cys, a TLR-2 agonist; FSL-1, a TLR-2 agonist; Hib-OMPC, a TLR-2 agonist; polyribosinic:polyribocytidic acid (Poly I:C), a TLR-3 agonist; polyadenosine-polyuridylic acid (poly AU), a TLR-3 agonist; Polyinosinic-Polycytidylic acid stabilized with poly-L-lysine and carboxymethylcellulose (Hiltonol®), a TLR-3 agonist; monophosphoryl lipid A (MPL), a TLR-4 agonist; LPS, a TLR-4 agonist; bacterial flagellin, a TLR-5
- TLR agonists are preferably used in combinations with other vaccines, adjuvants and/or immune modulators, and may be combined in various combinations.
- the mono- or di-F- CDN compounds that bind to STING and induce STING-dependent TBK1 activation and an inactivated tumor cell which expresses and secretes one or more cytokines which stimulate dendritic cell induction, recruitment and/or maturation, as described herein can be administered together with one or more TLR agonists for therapeutic purposes.
- Antibody Therapeutics [00241]
- the mono- or di-F-CDN compounds as described herein can be used in combination with therapeutic antibodies.
- the mechanism of action of the therapeutic antibody is Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC).
- ADCC is a mechanism of cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies. It is one of the mechanisms through which antibodies, as part of the humoral immune response, can act to limit and contain infection.
- Classical ADCC is mediated by natural killer (NK) cells; macrophages, neutrophils and eosinophils can also mediate ADCC.
- NK natural killer
- ADCC is an important mechanism of action of therapeutic monoclonal antibodies, including trastuzumab and rituximab, against tumors.
- Compounds of the present invention may act to potentiate ADCC.
- the following are an exemplary list of antibodies which may be used together with the mono- or di-F-CDN compounds of the present invention.
- Muromonab-CD3 Used to prevent acute rejection of organ, e.g., kidney, transplants. The humanized versions show promise in inhibiting the autoimmune destruction of beta cells in Type 1 diabetes mellitus.
- Omalizumab (Xolair®). Binds to IgE thus preventing IgE from binding to mast cells. Used against allergic asthma.
- Daclizumab (Zenapax®). Binds to part of the IL-2 receptor exposed at the surface of activated T cells. Used to prevent acute rejection of transplanted kidneys.
- Tositumomab (Bexxar®). This is a conjugate of a monoclonal antibody against CD20 and the radioactive isotope iodine-131 (131I).
- Cetuximab (Erbitux®). Blocks HER1, a receptor for epidermal growth factor (EGF) that is found on some tumor cells (some breast cancers, lymphomas).
- EGF epidermal growth factor
- Adcetris® A conjugate of a monoclonal antibody that binds CD30, a cell- surface molecule expressed by the cells of some lymphomas but not found on the normal stem cells needed to repopulate the bone marrow.
- Alemtuzumab Campath-1H®. Binds to CD52, a molecule found on lymphocytes and depletes both T cells and B cells. Has produced complete remission of chronic lymphocytic leukemia and shows promise in preventing rejection of kidney transplants.
- Lym-1 Oncolym®).
- Ipilimumab Yervoy®
- Vitaxin Binds to a vascular integrin (alpha-v/beta-3) found on the blood vessels of tumors but not on the blood vessels supplying normal tissues. In Phase II clinical trials, Vitaxin has shown some promise in shrinking solid tumors without harmful side effects.
- Bevacizumab (Avastin®). Binds to vascular endothelial growth factor (VEGF) preventing it from binding to its receptor.
- VEGF vascular endothelial growth factor
- Abciximab (ReoPro®). Inhibits the clumping of platelets by binding the receptors on their surface that normally are linked by fibrinogen. Helpful in preventing reclogging of the coronary arteries in patients who have undergone angioplasty.
- Additional therapeutic antibodies that may be used in combination with the mono- or di-F-CDN compounds as described herein include a prolactin receptor (PRLR) inhibitor, e.g. as disclosed in US Patent 7,867,493, a HER3 inhibitor, e.g. as disclosed in PCT Publication No. WO 2012/022814, an EGFR2 and/or EGFR4 inhibitor, e.g.
- PRLR prolactin receptor
- HER3 inhibitor e.g. as disclosed in PCT Publication No. WO 2012/022814
- an EGFR2 and/or EGFR4 inhibitor e.g.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a prolactin receptor (PRLR) inhibitor, a human monoclonal antibody molecule (Compound A26) as disclosed in US Patent 7,867,493), to treat a disorder, e.g., a disorder described herein.
- PRLR prolactin receptor
- Compound A26 human monoclonal antibody molecule
- the PRLR inhibitor is a human monoclonal antibody (Compound A26) disclosed in US 7,867,493.
- the mono- or di-F-CDN compound is used in combination with human monoclonal antibody molecule (Compound A26) described in US Patent 7,867,493 to treat a disorder such as, a cancer, a prostate cancer, or a breast cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a HER3 inhibitor, Compound A31, or a compound disclosed in PCT Publication No. WO
- the HER3 inhibitor is Compound A31 or a compound disclosed in PCT Publication WO 2012/022814.
- the mono- or di-F-CDN compound is used in combination with Compound A31, or a compound disclosed in PCT Publication WO 2012/022814, to treat a disorder such as a gastric cancer, an esophageal cancer, a head and neck cancer, a squamous cell carcinoma, a stomach cancer, a breast cancer (e.g., metastatic breast cancer), or a digestive/gastrointestinal cancer.
- Compound A31 is a human monoclonal antibody molecule.
- the HER3 inhibitor or Compound A31 is administered at a dose of about 3, 10, 20, or 40 mg/kg, e.g., once weekly (QW). In one embodiment, the compound is administered at a dose of about 3-10, 10-20, or 20-40 mg/kg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination an FGFR2 and/or FGFR4 inhibitor, Compound A32, or a compound disclosed in a publication PCT Publication No.
- WO 2014/160160 e.g., an antibody molecule drug conjugate against an FGFR2 and/or FGFR4, e.g., mAb 12425 as described therein
- a disorder e.g., a disorder described herein.
- the FGFR2 and/or FGFR4 inhibitor is Compound A32 or a compound disclosed in a publication PCT Publication No. WO 2014/160160.
- the mono- or di-F-CDN compound is used in combination with Compound A32, or in further combination with a compound as described in Table 2, to treat a disorder such as a cancer, a gastric cancer, a breast cancer, a rhabdomyosarcoma, a liver cancer, an adrenal cancer, a lung cancer, an esophageal cancer, a colon cancer, or an endometrial cancer.
- Compound A32 is an antibody molecule drug conjugate against an FGFR2 and/or FGFR4, e.g., mAb 12425.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound described herein, is used in combination an M-CSF inhibitor, Compound A33, or a compound disclosed in PCT Publication No. WO
- M-CSF inhibitor e.g., an antibody molecule or Fab fragment against M-CSF
- the M-CSF inhibitor is Compound A33 or a compound disclosed in PCT Publication No. WO 2004/045532.
- the mono- or di-F-CDN compound is used in combination with
- Compound A33 or a compound as described in PCT Publication No. WO 2004/045532, to treat a disorder such as a cancer, a prostate cancer, a breast cancer, or pigmented villonodular synovitis (PVNS).
- Compound A33 is a monoclonal antibody molecule against M-CSF or a fragment (e.g., Fab fragment) thereof.
- the M-CSF inhibitor or Compound A33 is administered at an average dose of about 10mg/kg. Delivery Agents [00264] Liposomes are vesicles formed from one (“unilamellar”) or more
- liposomes (“multilamellar”) layers of phospholipid. Because of the amphipathic character of the phospholipid building blocks, liposomes typically comprise a hydrophilic layer presenting a hydrophilic external face and enclosing a hydrophilic core.
- hydrophilic/hydrophobic components their non-toxic nature, biodegradability, biocompatibility, adjuvanticity, induction of cellular immunity, property of sustained release and prompt uptake by macrophages, makes them attractive candidates for the delivery of antigens. [00265] WO2010/104833, describes suitable liposomal preparations.
- Such liposomal formulations referred to herein as VesiVax® (Molecular Express, Inc.), with our without the“immunogenic polypeptide(s) or carbohydrate(s)” referred to above, can contain one or more additional components such as peptidoglycan, lipopeptide, lipopolysaccharide, monophosphoryl lipid A, lipoteichoic acid, resiquimod, imiquimod, flagellin,
- these liposomal formulations can be used to deliver one or more mono- or di-F-CDN compounds and compositions thereof described herein in accordance with the present invention.
- liposomal formulations discussed above employ a” steroid derivative” as an anchor for attaching an immunogenic polypeptide or
- the steroid may simply be provided as an unconjugated steroid such as cholesterol.
- Suitable methods for preparing liposomes from lipid mixtures are well known in the art. See, e.g., Basu & Basu, Liposome Methods and Protocols (Methods in
- liposomes are provided within a particular average size range. Liposome size can be selected, for example, by extrusion of an aqueous vehicle comprising liposomes through membranes having a preselected pore size and collecting the material flowing through the membrane.
- the liposomes are selected to be substantially between 50 and 500 nm in diameter, more preferably substantially between 50 and 200 nm in diameter, and most preferably substantially between 50 and 150 nm in diameter.
- the term“substantially” as used herein in this context means that at least 75%, more preferably 80%, and most preferably at least 90% of the liposomes are within the designated range.
- Other lipid and lipid-like adjuvants which may find use in the present invention include oil-in-water (o/w) emulsions (see, e.g., Muderhwa et al., J. Pharmaceut.
- Nanoparticles also represent drug delivery systems suitable for most administration routes. Over the years, a variety of natural and synthetic polymers have been explored for the preparation of nanoparticles, of which Poly(lactic acid) (PLA), Poly(glycolic acid) (PGA), and their copolymers (PLGA) have been extensively investigated because of their biocompatibility and biodegradability.
- PLA Poly(lactic acid)
- PGA Poly(glycolic acid)
- PLGA copolymers
- Nanoparticles and other nanocarriers act as potential carries for several classes of drugs such as anticancer agents, antihypertensive agents, immunomodulators, and hormones; and macromolecules such as nucleic acids, proteins, peptides, and antibodies. See, e.g., Crit. Rev. Ther. Drug Carrier Syst. 21:387-422, 2004; Nanomedicine: Nanotechnology, Biology and Medicine 1:22-30, 2005.
- Chemotherapeutic Agents [00271]
- the mono- or di- F-CDN compounds as described herein are used in combination with chemotherapeutic agents (e.g. small molecule pharmaceutical compounds).
- the methods further involve administering to the subject an effective amount of one or more chemotherapeutic agents as an additional treatment or a combination treatment.
- the one or more chemotherapeutic agents is selected from the group consisting of abiraterone acetate, altretamine, anhydrovinblastine, auristatin, bexarotene, bicalutamide, BMS 184476, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl)benzene sulfonamide, bleomycin, N,N-dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-proly- 1-Lproline-t- butylamide, cachectin, cemadotin, chlorambucil, cyclophosphamide, 3',4'-didehydro-4'- deoxy-8'-norvin-caleukoblastine, docetaxol
- the mono- or di-F- CDN compounds as described herein are used in combination with chemotherapeutic agents and/or additional agents for treating the indications as described in the methods herein.
- the mono- or di-F-CDN compounds as described herein are used in combination with one or more agents selected from the group consisting of sotrastaurin, nilotinib, 5-(2,4-dihydroxy-5-isopropylphenyl)-N-ethyl-4-(4- (morpholinomethyl)phenyl)isoxazole-3-carboxamide, dactolisib, 8-(6-Methoxy-pyridin- 3-yl)-3-methyl-1-(4-piperazin-1-yl-3-trifluoromethyl-phenyl)-1,3-dihydro-imidazo[4,5- c]quinolin-2-one, 3-(2,6-dichloro-3,5-dimethoxy
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a PKC inhibitor, Sotrastaurin (Compound A1), or a compound disclosed in PCT Publication No. WO 2005/039549, to treat a disorder, e.g., a disorder described herein.
- the PKC inhibitor is Sotrastaurin (Compound A1) or a compound disclosed in PCT Publication No. WO 2005/039549.
- the mono- or di-F-CDN compound is used in combination with Sotrastaurin (Compound A1), or a compound as described in PCT Publication No.
- Sotrastaurin is administered at a dose of about 20 to 600 mg, e.g., about 200 to about 600 mg, about 50 mg to about 450 mg, about 100 mg to 400 mg, about 150 mg to 350 mg, or about 200 mg to 300 mg, e.g., about 50 mg, 100 mg, 150mg, 200 mg, 300 mg, 400 mg, 500 mg, or 600 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a BCR-ABL inhibitor, TASIGNA (Compound A2, nilotinib), or a compound disclosed in PCT Publication No. WO 2004/005281, to treat a disorder, e.g., a disorder described herein.
- the BCR-ABL inhibitor is TASIGNA, or a compound disclosed in PCT Publication No. WO 2004/005281.
- the mono- or di-F-CDN compound is used in combination with TASIGNA (Compound A2), or a compound as described in PCT Publication No. WO 2004/005281, to treat a disorder such as a lymphocytic leukemia, Parkinson’s Disease, a neurologic cancer, a melanoma, a digestive/gastrointestinal cancer, a colorectal cancer, a myeloid leukemia, a head and neck cancer, or pulmonary hypertension.
- TASIGNA Compound A2
- a compound as described in PCT Publication No. WO 2004/005281 to treat a disorder such as a lymphocytic leukemia, Parkinson’s Disease, a neurologic cancer, a melanoma, a digestive/gastrointestinal cancer, a colorectal cancer, a myeloid leukemia, a head and neck cancer, or pulmonary hypertension.
- the BCR-ABL inhibitor or TASIGNA is administered at a dose of about 300 mg (e.g., twice daily, e.g., for newly diagnosed Ph+ CML-CP), or about 400 mg, e.g., twice daily, e.g., for resistant or intolerant Ph+ CML-CP and CML-AP).
- BCR-ABL inhibitor or a Compound A2 is administered at a dose of about 300-400 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an HSP90 inhibitor, such as 5-(2,4-dihydroxy-5-isopropylphenyl)-N-ethyl-4-(4- (morpholinomethyl)phenyl)isoxazole-3-carboxamide (Compound A3), or a compound disclosed in PCT Publication No. WO 2010/060937 or WO 2004/072051, to treat a disorder, e.g., a disorder described herein.
- HSP90 inhibitor such as 5-(2,4-dihydroxy-5-isopropylphenyl)-N-ethyl-4-(4- (morpholinomethyl)phenyl)isoxazole-3-carboxamide (Compound A3), or a compound disclosed in PCT Publication No. WO 2010/060937 or WO 2004/072051, to treat a disorder, e.g., a disorder described
- the HSP90 inhibitor is 5- (2,4-dihydroxy-5-isopropylphenyl)-N-ethyl-4-(4-(morpholinomethyl)phenyl)isoxazole-3- carboxamide (Compound A3), or a compound disclosed in PCT Publication No. WO 2010/060937 or WO 2004/072051.
- the mono- or di-F-CDN compound is used in combination with 5-(2,4-dihydroxy-5-isopropylphenyl)-N-ethyl-4- (4-(morpholinomethyl)phenyl)isoxazole-3-carboxamide (Compound A3), or a compound as described in PCT Publication No.
- WO 2010/060937 or WO 2004/072051 to treat a disorder such as a cancer, a multiple myeloma, a non-small cell lung cancer, a lymphoma, a gastric cancer, a breast cancer, a digestive/gastrointestinal cancer, a pancreatic cancer, a colorectal cancer, a solid tumor, or a hematopoiesis disorder.
- a disorder such as a cancer, a multiple myeloma, a non-small cell lung cancer, a lymphoma, a gastric cancer, a breast cancer, a digestive/gastrointestinal cancer, a pancreatic cancer, a colorectal cancer, a solid tumor, or a hematopoiesis disorder.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an inhibitor of PI3K and/or mTOR, Dactolisib (Compound A4) or 8-(6-Methoxy-pyridin-3- yl)-3-methyl-1-(4-piperazin-1-yl-3-trifluoromethyl-phenyl)-1,3-dihydro-imidazo[4,5- c]quinolin-2-one (Compound A41), or a compound disclosed in PCT Publication No. WO 2006/122806, to treat a disorder, e.g., a disorder described herein.
- a disorder e.g., a disorder described herein.
- the PI3K and/or mTOR inhibitor is Dactolisib (Compound A4), 8-(6-Methoxy-pyridin-3- yl)-3-methyl-1-(4-piperazin-1-yl-3-trifluoromethyl-phenyl)-1,3-dihydro-imidazo[4,5- c]quinolin-2-one (Compound A41), or a compound disclosed in PCT Publication No. WO 2006/122806.
- the mono- or di-F-CDN compound is used in combination with Dactolisib (Compound A4), 8-(6-Methoxy-pyridin-3-yl)-3-methyl-1-(4- piperazin-1-yl-3-trifluoromethyl-phenyl)-1,3-dihydro-imidazo[4,5-c]quinolin-2-one (Compound A41), or a compound described in PCT Publication No.
- WO 2006/122806 to treat a disorder such as a cancer, a prostate cancer, a leukemia (e.g., lymphocytic leukemia), a breast cancer, a brain cancer, a bladder cancer, a pancreatic cancer, a renal cancer, a solid tumor, or a liver cancer.
- a leukemia e.g., lymphocytic leukemia
- a breast cancer e.g., a breast cancer
- a brain cancer e.g., a bladder cancer, a pancreatic cancer, a renal cancer, a solid tumor, or a liver cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an FGFR inhibitor, 3-(2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4-(4-ethylpiperazin-1- yl)phenyl)amino)pyrimidin-4-yl)-1-methylurea (Compound A5) or a compound disclosed in US Patent 8,552,002, to treat a disorder, e.g., a disorder described herein.
- an FGFR inhibitor 3-(2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4-(4-ethylpiperazin-1- yl)phenyl)amino)pyrimidin-4-yl)-1-methylurea
- Compound A5 3-(2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4
- the FGFR inhibitor is 3-(2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4-(4- ethylpiperazin-1-yl)phenyl)amino)pyrimidin-4-yl)-1-methylurea (Compound A5) or a compound disclosed in US Patent 8,552,002.
- the mono- or di-F- CDN compound is used in combination with Compound A5, or a compound as described in US 8,552,002, to treat a disorder such as a digestive/gastrointestinal cancer, a hematological cancer, or a solid tumor.
- the FGFR inhibitor or 3- (2,6-dichloro-3,5-dimethoxyphenyl)-1-(6-((4-(4-ethylpiperazin-1- yl)phenyl)amino)pyrimidin-4-yl)-1-methylurea is administered at a dose of about 100-125 mg (e.g., per day), e.g., about 100 mg or about 125 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a PI3K inhibitor, Buparlisib (Compound A6), or a compound disclosed in PCT Publication No. WO 2007/084786, to treat a disorder, e.g., a disorder described herein.
- a PI3K inhibitor e.g., Buparlisib (Compound A6)
- Buparlisib Compound A6
- a compound disclosed in PCT Publication No. WO 2007/084786 e.g., a disorder described herein.
- the PI3K inhibitor is Buparlisib (Compound A6) or a compound disclosed in PCT Publication No. WO 2007/084786.
- the mono- or di-F-CDN compound is used in combination with Buparlisib (Compound A6), or a compound disclosed in PCT Publication No.
- a disorder such as, a prostate cancer, a non-small cell lung cancer, an endocrine cancer, a leukemia, an ovarian cancer, a melanoma, a bladder cancer, a breast cancer, a female reproductive system cancer, a digestive/gastrointestinal cancer, a colorectal cancer, a glioblastoma multiforme, a solid tumor, a non-Hodgkin lymphoma, a hematopoiesis disorder, or a head and neck cancer.
- the PI3K inhibitor or Buparlisib is administered at a dose of about 100 mg (e.g., per day).
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- FGFR inhibitor 8-(2,6-difluoro-3,5-dimethoxyphenyl)-N-(4-((dimethylamino)methyl)-1H- imidazol-2-yl)quinoxaline-5-carboxamide
- Compound A7 8-(2,6-difluoro-3,5-dimethoxyphenyl)-N-(4-((dimethylamino)methyl)-1H- imidazol-2-yl)quinoxaline-5-carboxamide
- Compound A7 8-(2,6-difluoro-3,5-dimethoxyphenyl)-N-(4-((dimethylamino)methyl)-1H- imidazol-2-yl)quinoxaline-5-carboxamide
- Compound A7 8-(2,6-difluoro-3,5-dimeth
- the FGFR inhibitor is 8-(2,6-difluoro-3,5-dimethoxyphenyl)- N-(4-((dimethylamino)methyl)-1H-imidazol-2-yl)quinoxaline-5-carboxamide(Compound A7) or a compound disclosed in PCT Publication No. WO 2009/141386.
- the FGFR inhibitor is 8-(2,6-difluoro-3,5-dimethoxyphenyl)-N-(4- ((dimethylamino)methyl)-1H-imidazol-2-yl)quinoxaline-5-carboxamide(Compound A7).
- the mono- or di-F-CDN compound is used in combination with 8- (2,6-difluoro-3,5-dimethoxyphenyl)-N-(4-((dimethylamino)methyl)-1H-imidazol-2- yl)quinoxaline-5-carboxamide(Compound A7), or a compound disclosed in PCT
- the FGFR inhibitor or 8-(2,6-difluoro-3,5- dimethoxyphenyl)-N-(4-((dimethylamino)methyl)-1H-imidazol-2-yl)quinoxaline-5- carboxamide is administered at a dose of e.g., from approximately 3 mg to approximately 5 g, more preferably from approximately 10 mg to approximately 1.5 g per person per day, optionally divided into 1 to 3 single doses which may, for example, be of the same size.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a PI3K inhibitor, (S)-N1-(4-methyl-5-(2-(1,1,1-trifluoro-2-methylpropan-2-yl)pyridin-4- yl)thiazol-2-yl)pyrrolidine-1,2-dicarboxamide (Compound A8) or a compound disclosed PCT Publication No. WO 2010/029082, to treat a disorder, e.g., a disorder described herein.
- a PI3K inhibitor e.g., (S)-N1-(4-methyl-5-(2-(1,1,1-trifluoro-2-methylpropan-2-yl)pyridin-4- yl)thiazol-2-yl)pyrrolidine-1,2-dicarboxamide (Compound A8) or a compound disclosed PCT Publication No. WO 2010/029082, to treat a disorder,
- the PI3K inhibitor is (S)-N1-(4-methyl-5-(2-(1,1,1-trifluoro- 2-methylpropan-2-yl)pyridin-4-yl)thiazol-2-yl)pyrrolidine-1,2-dicarboxamide
- the mono- or di-F-CDN compound is used in combination with (S)-N1- (4-methyl-5-(2-(1,1,1-trifluoro-2-methylpropan-2-yl)pyridin-4-yl)thiazol-2- yl)pyrrolidine-1,2-dicarboxamide (Compound A8), or a compound disclosed PCT Publication No. WO 2010/029082, to treat a disorder such as a gastric cancer, a breast cancer, a pancreatic cancer, a digestive/ gastrointestinal cancer, a solid tumor, and a head and neck cancer.
- a disorder such as a gastric cancer, a breast cancer, a pancreatic cancer, a digestive/ gastrointestinal cancer, a solid tumor, and a head and neck cancer.
- the PI3K inhibitor or (S)-N1-(4-methyl-5-(2- (1,1,1-trifluoro-2-methylpropan-2-yl)pyridin-4-yl)thiazol-2-yl)pyrrolidine-1,2- dicarboxamide is administered at a dose of about 150-300, 200-300, 200-400, or 300-400 mg (e.g., per day), e.g., about 200, 300, or 400 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an inhibitor of cytochrome P450 (e.g., a CYP17 inhibitor) or a compound disclosed in PCT Publication No. WO 2010/149755, to treat a disorder, e.g., a disorder described herein.
- cytochrome P450 inhibitor e.g., the CYP17 inhibitor
- the mono- or di-F-CDN compound is used in combination with a compound disclosed in PCT Publication No.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an HDM2 inhibitor, (S)-1-(4-chlorophenyl)-7-isopropoxy-6-methoxy-2-(4-(methyl(((1r,4S)- 4-(4-methyl-3-oxopiperazin-1-yl)cyclohexyl)methyl)amino)phenyl)-1,2- dihydroisoquinolin-3(4H)-one(Compound A10) or a compound disclosed in PCT
- the HDM2 inhibitor is (S)-1-(4-chlorophenyl)-7-isopropoxy-6- methoxy-2-(4-(methyl(((1r,4S)-4-(4-methyl-3-oxopiperazin-1- yl)cyclohexyl)methyl)amino)phenyl)-1,2-dihydroisoquinolin-3(4H)-one (Compound A10) or a compound disclosed in PCT Publication No. WO 2011/076786.
- the mono- or di-F-CDN compound is used in combination with (S)-1-(4- chlorophenyl)-7-isopropoxy-6-methoxy-2-(4-(methyl(((1r,4S)-4-(4-methyl-3- oxopiperazin-1-yl)cyclohexyl)methyl)amino)phenyl)-1,2-dihydroisoquinolin-3(4H)-one (Compound A10), or a compound disclosed in PCTPublication No. WO 2011/076786, to treat a disorder such as a solid tumor.
- the HDM2 inhibitor or (S)-1- (4-chlorophenyl)-7-isopropoxy-6-methoxy-2-(4-(methyl(((1r,4S)-4-(4-methyl-3- oxopiperazin-1-yl)cyclohexyl)methyl)amino)phenyl)-1,2-dihydroisoquinolin-3(4H)-one is administered at a dose of about 400 to 700 mg, e.g., administered three times weekly, 2 weeks on and one week off. In some embodiments, the dose is about 400, 500, 600, or 700 mg; about 400-500, 500-600, or 600-700 mg, e.g., administered three times weekly.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an iron chelating agent, Deferasirox (also known as EXJADE; Compound A11), or a compound disclosed in PCT Publication No. WO 1997/049395, to treat a disorder, e.g., a disorder described herein.
- an iron chelating agent Deferasirox
- the iron chelating agent is Deferasirox or a compound disclosed in PCT Publication No. WO 1997/049395.
- the iron chelating agent is Deferasirox (Compound A11).
- the mono- or di-F-CDN compound is used in combination with Deferasirox (Compound A11), or a compound disclosed in PCT Publication No. WO 1997/049395, to treat iron overload, hemochromatosis, or myelodysplasia.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an aromatase inhibitor, Letrozole (also known as FEMARA; Compound A12), or a compound disclosed in US 4,978,672, to treat a disorder, e.g., a disorder described herein.
- the aromatase inhibitor is Letrozole (Compound A12) or a compound disclosed in US Patent 4,978,672.
- the mono- or di-F-CDN compound is used in combination with Letrozole (Compound A12), or a compound disclosed in US Patent 4,978,672, to treat a disorder such as a cancer, a leiomyosarcoma, an endometrium cancer, a breast cancer, a female reproductive system cancer, or a hormone deficiency.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a PI3K inhibitor e.g., a pan-PI3K inhibitor, (4S,5R)-3-(2'-amino-2-morpholino-4'- (trifluoromethyl)-[4,5'-bipyrimidin]-6-yl)-4-(hydroxymethyl)-5-methyloxazolidin-2-one (Compound A13) or a compound disclosed in PCT Publication No. WO2013/124826, to treat a disorder, e.g., a disorder described herein.
- a PI3K inhibitor e.g., a pan-PI3K inhibitor, (4S,5R)-3-(2'-amino-2-morpholino-4'- (trifluoromethyl)-[4,5'-bipyrimidin]-6-yl)-4-(hydroxymethyl)-5-methyloxazolidin-2-one (Compound A13) or
- the PI3K inhibitor is (4S,5R)-3-(2'-amino-2-morpholino-4'-(trifluoromethyl)-[4,5'-bipyrimidin]-6-yl)-4- (hydroxymethyl)-5-methyloxazolidin-2-one (Compound A13) or a compound disclosed in PCT Publication No. WO2013/124826.
- the mono- or di-F-CDN compound is used in combination with (4S,5R)-3-(2'-amino-2-morpholino-4'- (trifluoromethyl)-[4,5'-bipyrimidin]-6-yl)-4-(hydroxymethyl)-5-methyloxazolidin-2-one (Compound A13), or a compound disclosed in PCT Publication No. WO2013/124826, to treat a disorder such as a cancer or an advanced solid tumor.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an inhibitor of p53 and/or a p53/Mdm2 interaction, (S)-5-(5-chloro-1-methyl-2-oxo-1,2- dihydropyridin-3-yl)-6-(4-chlorophenyl)-2-(2,4-dimethoxypyrimidin-5-yl)-1-isopropyl- 5,6-dihydropyrrolo[3,4-d]imidazol-4(1H)-one (Compound A14), or a compound disclosed in PCT Publication No.
- the p53 and/or a p53/Mdm2 interaction inhibitor is (S)-5-(5-chloro-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)-6-(4-chlorophenyl)-2-(2,4- dimethoxypyrimidin-5-yl)-1-isopropyl-5,6-dihydropyrrolo[3,4-d]imidazol-4(1H)-one (Compound A14) or a compound disclosed in PCT Publication No. WO2013/111105.
- the mono- or di-F-CDN compound is used in combination with (S)-5- (5-chloro-1-methyl-2-oxo-1,2-dihydropyridin-3-yl)-6-(4-chlorophenyl)-2-(2,4- dimethoxypyrimidin-5-yl)-1-isopropyl-5,6-dihydropyrrolo[3,4-d]imidazol-4(1H)-one (Compound A14), or a compound disclosed in PCT Publication No. WO2013/111105, to treat a disorder such as a cancer or a soft tissue sarcoma.
- a disorder such as a cancer or a soft tissue sarcoma.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a CSF- 1R tyrosine kinase inhibitor, 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide (Compound A15), or a compound disclosed in PCT Publication No. WO 2005/073224, to treat a disorder, e.g., a disorder described herein.
- a CSF- 1R tyrosine kinase inhibitor 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide (Compound A15), or a compound disclosed in PCT Publication No. WO 2005/073224, to treat a disorder, e.
- the CSF-1R tyrosine kinase inhibitor is 4-((2-(((1R,2R)-2-hydroxycyclohexyl)amino)benzo[d]thiazol-6- yl)oxy)-N-methylpicolinamide (Compound A15) or a compound disclosed in PCT Publication No. WO 2005/073224.
- the mono- or di-F-CDN compound is used in combination with 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide (Compound A15) or a compound disclosed in PCT Publication No.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an apoptosis inducer and/or an angiogenesis inhibitor, such as Imatinib mesylate (also known as GLEEVEC; Compound A16) or a compound disclosed in PCT Publication No. WO1999/003854, to treat a disorder, e.g., a disorder described.
- the apoptosis inducer and/or an angiogenesis inhibitor is Imatinib mesylate (Compound A16) or a compound disclosed in PCT Publication No.
- the mono- or di-F-CDN compound is used in combination with Imatinib mesylate (Compound A16), or a compound disclosed in PCT Publication No. WO1999/003854, to treat a disorder such as a cancer, a multiple myeloma, a prostate cancer, a non-small cell lung cancer, a lymphoma, a gastric cancer, a melanoma, a breast cancer, a pancreatic cancer, a digestive/gastrointestinal cancer, a colorectal cancer, a glioblastoma multiforme, a liver cancer, a head and neck cancer, asthma, multiple sclerosis, allergy, Alzheimer’s dementia, amyotrophic lateral sclerosis, or rheumatoid arthritis.
- a disorder such as a cancer, a multiple myeloma, a prostate cancer, a non-small cell lung cancer, a lymphoma, a gastric cancer, a melanoma, a
- Imatinib mesylate (Compound A16) is administered at a dose of about 100 to 1000 mg, e.g., about 200 mg to 800 mg, about 300 mg to 700 mg, or about 400 mg to 600 mg, e.g., about 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, or 700 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- Imatinib mesylate is administered at an oral dose from about 100 mg to 600 mg daily, e.g., about 100 mg, 200 mg, 260 mg, 300 mg, 400 mg, or 600 mg daily.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a JAK inhibitor, 2-fluoro-N-methyl-4-(7-(quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2- yl)benzamide (Compound A17), or a dihydrochloric salt thereof, or a compound disclosed in PCT Publication No. WO 2007/070514, to treat a disorder, e.g., a disorder described herein.
- a JAK inhibitor 2-fluoro-N-methyl-4-(7-(quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2- yl)benzamide
- Compound A17 2-fluoro-N-methyl-4-(7-(quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2- yl)benzamide
- the JAK inhibitor is 2-fluoro-N-methyl-4-(7- (quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2-yl)benzamide (Compound A17), or a dihydrochloric salt thereof, or a compound disclosed in PCT Publication No. WO
- the mono- or di-F-CDN compound is used in combination with 2-fluoro-N-methyl-4-(7-(quinolin-6-ylmethyl)imidazo[1,2- b][1,2,4]triazin-2-yl)benzamide (Compound A17), or a dihydrochloric salt thereof, or a compound disclosed in PCT Publication No. WO 2007/070514, to treat a disorder such as colorectal cancer, myeloid leukemia, hematological cancer, autoimmune disease, non- Hodgkin lymphoma, or thrombocythemia.
- a disorder such as colorectal cancer, myeloid leukemia, hematological cancer, autoimmune disease, non- Hodgkin lymphoma, or thrombocythemia.
- the JAK inhibitor or a 2- fluoro-N-methyl-4-(7-(quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2-yl)benzamide (Compound A17), or a dihydrochloric salt thereof is administered at a dose of about 400- 600 mg (e.g., per day), e.g., about 400, 500, or 600 mg, or about 400-500 or 500-600 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a JAK inhibitor e.g., Ruxolitinib Phosphate (also known as JAKAFI; Compound A18) or a compound disclosed in PCT Publication No. WO 2007/070514 to treat a disorder, e.g., a disorder described herein.
- the JAK inhibitor is Ruxolitinib
- the mono- or di-F-CDN compound is used in combination with Ruxolitinib Phosphate (Compound A18), or a compound disclosed in PCT Publication No.
- WO 2007/070514 to treat a disorder such as a prostate cancer, a lymphocytic leukemia, a multiple myeloma, a lymphoma, a lung cancer, a leukemia, cachexia, a breast cancer, a pancreatic cancer, rheumatoid arthritis, psoriasis, a colorectal cancer, a myeloid leukemia, a hematological cancer, an autoimmune disease, a non- Hodgkin lymphoma, or thrombocythemia.
- the JAK inhibitor or Ruxolitinib Phosphate is administered at a dose of about 15-25 mg, e.g., twice daily.
- the dose is about 15, 20, or 25 mg, or about 15- 20 or 20-25 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a histone deacetylase (HDAC) inhibitor.
- HDAC histone deacetylase
- the HDAC inhibitor is selected from the group consisting of panobinostat, vorinostat, romidepsin, chidamide, valproic acid, belinostat, pyroxamide, mocetinostat, abexinostat, entinostat, pracinostat, resminostat, givinostat, quisinostat, ricolinostat, CUDC-101, AR-42, CHR-2845, CHR- 3996, 4SC-202, and CG200745.
- the combination comprising a mono- or di-F-CDN compound as described herein is used in combination with a histone deacetylase (HDAC) inhibitor, Panobinostat (Compound A19), or a compound disclosed in PCT Publication No. WO 2014/072493, to treat a disorder, e.g., a disorder described herein.
- HDAC histone deacetylase
- the HDAC inhibitor is Panobinostat (Compound A19) or a compound disclosed in PCT Publication No. WO 2014/072493.
- the mono- or di-F-CDN compound is used in combination with Panobinostat (Compound A19), a compound disclosed in PCT Publication No.
- WO 2014/072493 to treat a disorder such as a small cell lung cancer, a respiratory/thoracic cancer, a prostate cancer, a multiple myeloma, myelodysplastic syndrome, a bone cancer, a non-small cell lung cancer, an endocrine cancer, a lymphoma, a neurologic cancer, a leukemia, HIV/AIDS, an immune disorder, transplant rejection, a gastric cancer, a melanoma, a breast cancer, a pancreatic cancer, a colorectal cancer, a glioblastoma multiforme, a myeloid leukemia, a hematological cancer, a renal cancer, a non-Hodgkin lymphoma, a head and neck cancer, a hematopoiesis disorders, or a liver cancer.
- a disorder such as a small cell lung cancer, a respiratory/thoracic cancer, a prostate cancer, a multiple myeloma, myelodysplastic
- the HDAC inhibitor or Panobinostat is administered at a dose of about 20 mg (e.g., per day).
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an inhibitor of one or more of cytochrome P450 (e.g., 11B2), aldosterone or angiogenesis, Osilodrostat (Compound A20), or a compound disclosed in PCT Publication No.
- WO2007/024945 to treat a disorder, e.g., a disorder described herein.
- a disorder e.g., a disorder described herein.
- the inhibitor of one or more of cytochrome P450 (e.g., 11B2), aldosterone or angiogenesis is Osilodrostat (Compound A20) or a compound disclosed in PCT Publication No. WO2007/024945.
- the mono- or di-F-CDN compound is used in combination with Osilodrostat (Compound A20), or a compound disclosed in PCT Publication No. WO2007/024945, to treat a disorder such as Cushing’s syndrome, hypertension, or heart failure therapy.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a IAP inhibitor e.g., a IAP inhibitor, (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2-yl)pyrrolidin-1- yl)-2-oxoethyl)-2-(methylamino)propanamide (Compound A21) or a compound disclosed in US 8,552,003, to treat a disorder, e.g., a disorder described herein.
- a disorder e.g., a disorder described herein.
- the IAP inhibitor is (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2- yl)pyrrolidin-1-yl)-2-oxoethyl)-2-(methylamino)propanamide (Compound A21) or a compound disclosed in US Patent 8,552,003.
- the mono- or di-F- CDN compound is used in combination with (S)-N-((S)-1-cyclohexyl-2-((S)-2-(4-(4- fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2-oxoethyl)-2-(methylamino)propanamide (Compound A21), or a compound disclosed in US Patent 8,552,003, to treat a disorder such as a multiple myeloma, a breast cancer, an ovarian cancer, a pancreatic cancer, or a hematopoiesis disorder.
- a disorder such as a multiple myeloma, a breast cancer, an ovarian cancer, a pancreatic cancer, or a hematopoiesis disorder.
- the IAP inhibitor or (S)-N-((S)-1- cyclohexyl-2-((S)-2-(4-(4-fluorobenzoyl)thiazol-2-yl)pyrrolidin-1-yl)-2-oxoethyl)-2- (methylamino)propanamide (Compound A21) or a compound disclosed in US 8,552,003 is administered at a dose of approximately 1800 mg, e.g., once weekly.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a Smoothened (SMO) inhibitor, Sonidegib phosphate (Compound A22), (R)-2-(5-(4-(6-benzyl-4,5- dimethylpyridazin-3-yl)-2-methylpiperazin-1-yl)pyrazin-2-yl)propan-2-ol (Compound A25), or a compound disclosed in PCT Publication No. WO 2007/131201 or WO 2010/007120, to treat a disorder, e.g., a disorder described herein.
- SMO Smoothened
- Compound A22 Sonidegib phosphate
- R -2-(5-(4-(6-benzyl-4,5- dimethylpyridazin-3-yl)-2-methylpiperazin-1-yl)pyrazin-2-yl)propan-2-ol
- Compound A25 a compound disclosed
- the SMO inhibitor is Sonidegib phosphate (Compound A22), (R)-2-(5-(4-(6-benzyl-4,5- dimethylpyridazin-3-yl)-2-methylpiperazin-1-yl)pyrazin-2-yl)propan-2-ol (Compound A25), or a compound disclosed in PCT Publication No. WO 2007/131201 or WO 2010/007120.
- the mono- or di-F-CDN compound is used in combination with Sonidegib phosphate (Compound A22), (R)-2-(5-(4-(6-benzyl-4,5- dimethylpyridazin-3-yl)-2-methylpiperazin-1-yl)pyrazin-2-yl)propan-2-ol (Compound A25), or a compound disclosed in PCT Publication No. WO 2007/131201 or WO 2010/007120 to treat a disorder such as a cancer, a medulloblastoma, a small cell lung cancer, a prostate cancer, a basal cell carcinoma, a pancreatic cancer, or an inflammation.
- a disorder such as a cancer, a medulloblastoma, a small cell lung cancer, a prostate cancer, a basal cell carcinoma, a pancreatic cancer, or an inflammation.
- Sonidegib phosphate (Compound A22) is administered at a dose of about 20 to 500 mg, e.g., about 40 mg to 400 mg, about 50 mg to 300 mg, or about 100 mg to 200 mg, e.g., about 50 mg, 100 mg, 150 mg, 200 mg, 250 mg, or 300 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an Alk inhibitor, ceritinib (also known as ZYKADIA; Compound A23) or a compound disclosed in PCT Publication No. WO 2007/131201, to treat a disorder, e.g., a disorder described herein.
- the Alk inhibitor is ceritinib (Compound A23) or a compound disclosed in PCT Publication No. WO 2007/131201.
- the mono- or di-F-CDN compound is used in combination with ceritinib (Compound A23), or a compound disclosed in PCT Publication No.
- the Alk inhibitor or ceritinib is administered at a dose of approximately 750 mg, e.g., once daily.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a JAK and/or CDK4/6 inhibitor, 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2- yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide (Compound A24), or a compound disclosed in US Patent 8,415,355 or US Patent 8,685,980, to treat a disorder, e.g., a disorder described herein.
- a JAK and/or CDK4/6 inhibitor 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2- yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide
- Compound A24 7-cyclopentyl-N,N
- the JAK and/or CDK4/6 inhibitor is 7- cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3- d]pyrimidine-6-carboxamide (Compound A24) or a compound disclosed in US Patent 8,415,355 or US Patent 8,685,980.
- the mono- or di-F-CDN compound is used in combination with 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1- yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide (Compound A24), or a compound disclosed in US 8,415,355 or US 8,685,980, to treat a disorder such as a lymphoma, a neurologic cancer, a melanoma, a breast cancer, or a solid tumor.
- a disorder such as a lymphoma, a neurologic cancer, a melanoma, a breast cancer, or a solid tumor.
- the JAK and/or CDK4/6 inhibitor or 7-cyclopentyl-N,N-dimethyl-2-((5- (piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide is administered at a dose of approximately 200-600 mg, e.g., per day. In one embodiment, the compound is administered at a dose of about 200, 300, 400, 500, or 600 mg, or about 200-300, 300-400, 400-500, or 500-600 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a PIM Kinase inhibitor N-(4-((1R,3S,5S)-3-amino-5-methylcyclohexyl)pyridin-3-yl)-6-(2,6- difluorophenyl)-5-fluoropicolinamide (Compound A27) or a compound disclosed in PCT Publication No. WO 2010/026124, to treat a disorder, e.g., a disorder described herein.
- the PIM Kinase inhibitor is N-(4-((1R,3S,5S)-3-amino-5- methylcyclohexyl)pyridin-3-yl)-6-(2,6-difluorophenyl)-5-fluoropicolinamide (Compound A27) or a compound disclosed in PCT Publication No. WO 2010/026124.
- the mono- or di-F-CDN compound is used in combination with N-(4- ((1R,3S,5S)-3-amino-5-methylcyclohexyl)pyridin-3-yl)-6-(2,6-difluorophenyl)-5- fluoropicolinamide (Compound A27), or a compound disclosed in PCT Publication No. WO 2010/026124, to treat a disorder such as a multiple myeloma, myelodysplastic syndrome, a myeloid leukemia, or a non-Hodgkin lymphoma.
- a disorder such as a multiple myeloma, myelodysplastic syndrome, a myeloid leukemia, or a non-Hodgkin lymphoma.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a Wnt signaling inhibitor 2-(2',3-dimethyl-[2,4'-bipyridin]-5-yl)-N-(5-(pyrazin-2-yl)pyridin-2- yl)acetamide (Compound A28) or a compound disclosed in PCT publication No. WO 2010/101849, to treat a disorder, e.g., a disorder described herein.
- the Wnt signaling inhibitor is 2-(2',3-dimethyl-[2,4'-bipyridin]-5-yl)-N-(5-(pyrazin-2- yl)pyridin-2-yl)acetamide (Compound A28) or a compound disclosed in PCT publication No. WO 2010/101849. In one embodiment, the Wnt signaling inhibitor is 2-(2',3- dimethyl-[2,4'-bipyridin]-5-yl)-N-(5-(pyrazin-2-yl)pyridin-2-yl)acetamide (Compound A28).
- the mono- or di-F-CDN compound is used in combination with 2-(2',3-dimethyl-[2,4'-bipyridin]-5-yl)-N-(5-(pyrazin-2-yl)pyridin-2-yl)acetamide (Compound A28), or a compound disclosed in PCT publication No. WO 2010/101849, to treat a disorder such as a solid tumor (e.g., a head and neck cancer, a squamous cell carcinoma, a breast cancer, a pancreatic cancer, or a colon cancer).
- a solid tumor e.g., a head and neck cancer, a squamous cell carcinoma, a breast cancer, a pancreatic cancer, or a colon cancer.
- a solid tumor e.g., a head and neck cancer, a squamous cell carcinoma, a breast cancer, a pancreatic cancer, or a colon cancer.
- a solid tumor e.g., a head
- 2-(2',3-dimethyl-[2,4'-bipyridin]-5-yl)-N-(5-(pyrazin-2-yl)pyridin-2- yl)acetamide (Compound A28) is administered at a dose of about 1 to 50 mg, e.g., about 2 mg to 45 mg, about 3 mg to 40 mg, about 5 mg to 35 mg, 5 mg to 10 mg, or about 10 mg to 30 mg, e.g., about 2 mg, 5 mg, 10 mg, 20 mg, 30 mg, or 40 mg.
- the dosing schedule can vary from e.g., every other day to daily, twice or three times a day.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a BRAF inhibitor, Encorafenib (Compound A29), or a compound disclosed in PCT Publication No. WO 2011/025927, to treat a disorder, e.g., a disorder described herein.
- the BRAF inhibitor is Encorafenib (Compound A29) or a compound disclosed in PCT Publication No. WO 2011/025927.
- the mono- or di-F-CDN compound is used in combination with Encorafenib (Compound A29), or a compound disclosed in PCT Publication No.
- the BRAF inhibitor or Encorafenib is administered at a dose of about 200- 300, 200-400, or 300-400 mg, e.g., per day. In one embodiment, the compound is administered at a dose of about 200, about 300 or about 400 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a CDK4/6 inhibitor, 7-cyclopentyl-N,N-dimethyl-2-((5-((1R,6S)-9-methyl-4-oxo-3,9- diazabicyclo[4.2.1]nonan-3-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide (Compound A30), or a compound disclosed in PCT publication No. WO 2011/101409, to treat a disorder, e.g., a disorder described herein.
- a CDK4/6 inhibitor 7-cyclopentyl-N,N-dimethyl-2-((5-((1R,6S)-9-methyl-4-oxo-3,9- diazabicyclo[4.2.1]nonan-3-yl)pyridin-2-yl)amino)
- the CDK4/6 inhibitor is 7-cyclopentyl-N,N-dimethyl-2-((5-((1R,6S)-9-methyl-4-oxo-3,9- diazabicyclo[4.2.1]nonan-3-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide (Compound A30) or a compound disclosed in PCT publication No. WO 2011/101409.
- the mono- or di-F-CDN compound is used in combination with 7-cyclopentyl-N,N-dimethyl-2-((5-((1R,6S)-9-methyl-4-oxo-3,9- diazabicyclo[4.2.1]nonan-3-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide (Compound A30), or a compound disclosed in PCT publication No.
- WO 2011/101409 to treat a disorder such as a cancer, a mantle cell lymphoma, a liposarcoma, a non-small cell lung cancer, a melanoma, a squamous cell esophageal cancer, or a breast cancer.
- a disorder such as a cancer, a mantle cell lymphoma, a liposarcoma, a non-small cell lung cancer, a melanoma, a squamous cell esophageal cancer, or a breast cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a MEK inhibitor, Binimetinib (Compound A34), or a compound disclosed in PCT Publication No. WO 2003/077914, to treat a disorder, e.g., a disorder described herein.
- the MEK inhibitor is Binimetinib (Compound A34), or a compound disclosed in PCT Publication No. WO 2003/077914.
- the mono- or di-F-CDN compound is used in combination with Binimetinib (Compound A34), or a compound disclosed in PCT Publication No. WO 2003/077914, to treat a disorder such as a non-small cell lung cancer, a multisystem genetic disorder, a melanoma, an ovarian cancer, a digestive/gastrointestinal cancer, a rheumatoid arthritis, or a colorectal cancer.
- the MEK inhibitor or Binimetinib is administered at a dose of about 45 mg, e.g., twice daily.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination an inhibitor of one or more of c-KIT, histamine release, Flt3 (e.g., FLK2/STK1) or PKC, Midostaurin (Compound A35) or a compound disclosed in PCT Publication No. WO 2003/037347, to treat a disorder, e.g., a disorder described herein.
- the inhibitor is Midostaurin (Compound A35) or compound disclosed in PCT Publication No. WO 2003/037347.
- the inhibitor of one or more of c-KIT, histamine release, Flt3 (e.g., FLK2/STK1) or PKC is Midostaurin.
- the mono- or di-F-CDN compound is used in combination with Midostaurin (Compound A35), or compound disclosed in PCT Publication No.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a TOR inhibitor (e.g., mTOR inhibitor), Everolimus (also known as AFINITOR; Compound A36) or a Compound disclosed in PCT Publication No. WO 2014/085318, to treat a disorder, e.g., a disorder described herein).
- a TOR inhibitor e.g., mTOR inhibitor
- Everolimus also known as AFINITOR; Compound A36
- a Compound disclosed in PCT Publication No. WO 2014/085318 to treat a disorder, e.g., a disorder described herein.
- the TOR inhibitor is Everolimus (Compound A36) or a Compound disclosed in PCT Publication No. WO 2014/085318.
- the mono- or di-F-CDN compound is used in combination with Everolimus (Compound A36) to treat a disorder such as an interstitial lung disease, a small cell lung cancer, a respiratory/thoracic cancer, a prostate cancer, a multiple myeloma, a sarcoma, an age-related macular degeneration, a bone cancer, tuberous sclerosis, a non-small cell lung cancer, an endocrine cancer, a lymphoma, a neurologic disorders, an astrocytoma, a cervical cancer, a neurologic cancer, a leukemia, an immune disorders, transplant rejection, a gastric cancer, a melanoma, epilepsy, a breast cancer, or a bladder cancer.
- a disorder such as an interstitial lung disease, a small cell lung cancer, a respiratory/thoracic cancer
- the TOR inhibitor or Everolimus is (Compound A36) administered at a dose of about 2.5-20 mg/day. In one embodiment, the compound is administered at a dose of about 2.5, 5, 10, or 20 mg/day, e.g., about 2.5- 5, 5-10, or 10-20 mg/day.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination an inhibitor of one or more of VEGFR-2, PDGFRbeta, KIT or Raf kinase C, 1-methyl-5-((2-(5- (trifluoromethyl)-1H-imidazol-2-yl)pyridin-4-yl)oxy)-N-(4-(trifluoromethyl)phenyl)-1H- benzo[d]imidazol-2-amine (Compound A37) or a compound disclosed in PCT
- the inhibitor of one or more of VEGFR-2, PDGFRbeta, KIT or Raf kinase C is 1-methyl-5-((2-(5-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-4-yl)oxy)-N-(4- (trifluoromethyl)phenyl)-1H-benzo[d]imidazol-2-amine (Compound A37) or a compound disclosed in PCT Publication No. WO 2007/030377.
- the mono- or di-F-CDN compound is used in combination with 1-methyl-5-((2-(5-(trifluoromethyl)- 1H-imidazol-2-yl)pyridin-4-yl)oxy)-N-(4-(trifluoromethyl)phenyl)-1H-benzo[d]imidazol- 2-amine (Compound A37), or a compound disclosed in PCT Publication No. WO 2011/001100, 1, 3-methyl-3-phenyl-N-(4-(trifluoromethyl)phenyl)-1H-benzo[d]imidazol- 2-amine (Compound A37), or a compound disclosed in PCT Publication No. WO
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a somatostatin agonist and/or growth hormone release inhibitor, Pasireotide diaspartate (also known as SIGNIFOR; Compound A38) or a compound disclosed in PCT Publication No.
- a somatostatin agonist and/or growth hormone release inhibitor e.g., a somatostatin agonist and/or growth hormone release inhibitor, Pasireotide diaspartate (also known as SIGNIFOR; Compound A38) or a compound disclosed in PCT Publication No.
- the somatostatin agonist and/or growth hormone release inhibitor is Pasireotide diaspartate (Compound A38) or a compound disclosed in PCT Publication No. WO2002/010192 or US Patent No.7,473,761.
- the mono- or di-F-CDN compound is used in combination with Pasireotide diaspartate (Compound A38), or a compound disclosed in PCT Publication No. WO2002/010192 or US Patent No.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a signal transduction modulator and/or angiogenesis inhibitor, Dovitinib (Compound A39) or a compound disclosed in PCT Publication No.
- the signal transduction modulator and/or angiogenesis inhibitor is Dovitinib (Compound A39) or a compound disclosed in PCT Publication No. WO 2009/115562.
- the mono- or di-F-CDN compound is used in combination with Dovitinib (Compound A39), or a compound disclosed in PCT Publication No. WO 2009/115562, to treat a disorder such as a cancer, a respiratory/thoracic cancer, a multiple myeloma, a prostate cancer, a non-small cell lung cancer, an endocrine cancer, or a neurological genetic disorder.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein
- a combination comprising a mono- or di-F-CDN compound as described herein
- an EGFR inhibitor (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-1H- benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A40) or a compound disclosed in PCT Publication No. WO 2013/184757, to treat a disorder, e.g., a disorder described herein.
- an EGFR inhibitor (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-1H- benzo[d]imidazol-2-yl)-2-methylisonicotinamide
- the EGFR inhibitor is (R,E)-N-(7-chloro-1-(1-(4- (dimethylamino) but-2-enoyl)azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2- methylisonicotinamide (Compound A40) or a compound disclosed in PCT Publication No. WO 2013/184757.
- the mono- or di-F-CDN compound is used in combination with (R,E)-N-(7-chloro-1-(1-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)- 1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A40), or a compound disclosed in PCT Publication No. WO 2013/184757, to treat a disorder such as a cancer, e.g., a solid tumor.
- a cancer e.g., a solid tumor.
- the EGFR inhibitor or (R,E)-N-(7-chloro-1-(1-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2- methylisonicotinamide is administered at a dose of 150-250 mg, e.g., per day. In one embodiment, the compound is administered at a dose of about 150, 200, or 250 mg, or about 150-200 or 200-250 mg.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination an ALK inhibitor, N 6 -(2-isopropoxy-5-methyl-4-(1-methylpiperidin-4-yl)phenyl)-N 4 -(2- (isopropylsulfonyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidine-4,6-diamine (Compound A42) or a compound disclosed in PCT Publication No. WO 2008/073687, to treat a disorder, e.g., a disorder described herein.
- a disorder e.g., a disorder described herein.
- the ALK inhibitor is N 6 -(2- isopropoxy-5-methyl-4-(1-methylpiperidin-4-yl)phenyl)-N 4 -(2- (isopropylsulfonyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidine-4,6-diamine (Compound A42) or a compound disclosed in PCT Publication No. WO 2008/073687.
- the mono- or di-F-CDN compound is used in combination with N 6 -(2-isopropoxy-5-
- pyrazolo[3,4-d]pyrimidine-4,6-diamine (Compound A42), or a compound disclosed in PCT Publication No. WO 2008/073687, to treat a disorder such as a cancer, an anaplastic large-cell lymphoma (ALCL), a non-small cell lung carcinoma (NSCLC), or a
- a disorder such as a cancer, an anaplastic large-cell lymphoma (ALCL), a non-small cell lung carcinoma (NSCLC), or a
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination an IGF-1R inhibitor, 3-(4-(4-((5-chloro-4-((5-methyl-1H-pyrazol-3-yl)amino)pyrimidin-2-yl)amino)- 5-fluoro-2-methylphenyl)piperidin-1-yl)thietane 1,1-dioxide (Compound A43), 5-chloro- N 2 -(2-fluoro-5-methyl-4-(1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)phenyl)-N 4 -(5- methyl-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (Compound A44), or 5-chloro-N2-(4-(1- ethylpiperidin-4-y
- the IGF- 1R inhibitor is 3-(4-(4-((5-chloro-4-((5-methyl-1H-pyrazol-3-yl)amino)pyrimidin-2- yl)amino)-5-fluoro-2-methylphenyl)piperidin-1-yl)thietane 1,1-dioxide (Compound A43), 5-chloro-N 2 -(2-fluoro-5-methyl-4-(1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)phenyl)- N 4 -(5-methyl-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (Compound A44), 5-chloro-N2- (4-(1-ethylpiperidin-4-yl)-2-fluoro-5-methylphenyl)-N 4 -(5-methyl
- the mono- or di-F-CDN compound is used in combination with 3-(4-(4-((5-chloro-4-((5-methyl-1H-pyrazol-3- yl)amino)pyrimidin-2-yl)amino)-5-fluoro-2-methylphenyl)piperidin-1-yl)thietane 1,1- dioxide (Compound A43), 5-chloro-N 2 -(2-fluoro-5-methyl-4-(1-(tetrahydro-2H-pyran-4- yl)piperidin-4-yl)phenyl)-N 4 -(5-methyl-1H-pyrazol-3-yl)pyrimidine-2,4-diamine
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination a P- Glycoprotein 1 inhibitor, Valspodar (also known as AMDRAY; Compound A46) or a compound disclosed in EP 296122, to treat a disorder, e.g., a disorder described herein.
- the P-Glycoprotein 1 inhibitor is Valspodar (Compound A46) or a compound disclosed in EP 296122.
- the mono- or di-F-CDN compound is used in combination with Valspodar (Compound A46), or a compound disclosed in EP 296122, to treat a disorder such as a cancer or a drug-resistant tumor.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination one or more of a VEGFR inhibitor, Vatalanib succinate (Compound A47) or a compound disclosed in WO 98/35958, to treat a disorder, e.g., a disorder described herein.
- the VEGFR inhibitor is Vatalanib succinate (Compound A47) or a compound disclosed in WO 98/35958.
- the mono- or di-F-CDN compound is used in combination with Vatalanib succinate (Compound A47), or a compound disclosed in EP 296122, to treat cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an IDH inhibitor or a compound disclosed in WO2014/141104, to treat a disorder, e.g., a disorder described herein.
- the IDH inhibitor is a compound disclosed in PCT Publication No. WO2014/141104.
- the mono- or di-F-CDN compound is used in combination with a compound disclosed in WO2014/141104 to treat a disorder such as a cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a BCL- ABL inhibitor or a compound disclosed in PCT Publication No. WO2013/171639, WO2013/171640, WO2013/171641, or WO2013/171642, to treat a disorder, e.g., a disorder described herein.
- the BCL-ABL inhibitor is a compound disclosed in PCT Publication No. WO2013/171639, WO2013/171640, WO2013/171641, or WO2013/171642.
- the mono- or di-F-CDN compound is used in combination with a compound disclosed in PCT Publication No. WO2013/171639, WO2013/171640, WO2013/171641, or WO2013/171642 to treat a disorder such as a cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with a c-RAF inhibitor or a compound disclosed in PCT Publication No. WO2014/151616, to treat a disorder, e.g., a disorder described herein.
- the c-RAF inhibitor is Compound A50 or a compound disclosed in PCT Publication No.
- the mono- or di-F-CDN compound is used in combination with a compound disclosed in PCT Publication No. WO2014/151616 to treat a disorder such as a cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is used in combination with an ERK1/2 ATP competitive inhibitor or a compound disclosed in PCT Publication No. WO2015/066188, to treat a disorder, e.g., a disorder described herein.
- a disorder e.g., a disorder described herein.
- the ERK1/2 ATP competitive inhibitor is a compound disclosed in PCT Publication No. WO2015/066188.
- the mono- or di-F-CDN compound is used in combination with Compound A51 or a compound disclosed in PCT Publication No. WO2015/066188 to treat a disorder such as a cancer.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound described herein, and Compound A51 or a compound disclosed in PCT Publication No. WO2015/066188, is administered in combination with one or more agents selected from, Compound A8, Compound A17, Compound A23, Compound A24, Compound A27, Compound A29, and Compound A33.
- the combination e.g., a combination comprising a mono- or di-F-CDN compound as described herein, is administered in combination with an anti-cancer agent having a known activity in an immune cell assay, e.g., in one or more of a huMLR assay, a T cell proliferation assay, and a B-cell proliferation assay, where such assays are known in the art, and can be used to demonstrate the compounds will not inhibit an immune response (i.e. demonstrate little or no inhibition in such assays).
- An IC50 in such assays can be determined for the compounds to be used in combination with the mono- or di-F-CDN compound.
- the anti-cancer agent has an IC50 of, e.g., >1 ⁇ M, 1-4 ⁇ M, or greater than 4 ⁇ M, e.g., 4-10 ⁇ M or 4-20 ⁇ M, or greater than 20 ⁇ M.
- the second therapeutic agent is chosen from one or more of: Compound A9, Compound A16, Compound A17, Compound A21, Compound A22, Compound A25, Compound A28, Compound A48, and Compound A49. [00317]
- the Compound A28 (or a compound related to
- Compound A28 is administered at a dose of approximately 5-10 or 10-30 mg.
- the Compound A22 (or compound related to Compound A22) is administered at a dose of about 200 mg.
- the Compound A17 (or compound related to Compound A17) is administered at a dose of approximately 400-600 mg.
- the Compound A16 (or compound related to Compound A16) is administered at a dose of approximately 400-600 mg PO qDay.
- the Compound A29 (or compound related to Compound A29) is administered at a dose of approximately 200-400 or 300-400 mg.
- the Compound A24 (or compound related to Compound A24) is administered at a dose of approximately 200-600 mg.
- the Compound A23 (ceritinib) (or compound related to ceritinib) is administered at a dose of approximately 750 mg once daily. In some embodiments, the Compound A8 (or compound related to Compound A8) is administered at a dose of approximately 200-400 or 300-400 mg. In some
- the Compound A5 (or compound related to Compound A5) is administered at a dose of approximately 100-125 mg.
- the Compound A6 (or compound related to Compound A6) is administered at a dose of about 100 mg.
- the Compound A1 (or compound related to Compound A1) is administered at a dose of approximately 200-300 or 200-600 mg. In some embodiments, the
- Compound A40 (or compound related to Compound A40) is administered at a dose of approximately 150-250 mg.
- the Compound A10 (or compound related to Compound A10) is administered at a dose of approximately 400 to 700 mg, e.g., administered three times weekly, 2 weeks on and one week off.
- the BCR-ABL inhibitor is administered at a dose of approximately 20 mg bid-80 mg bid. [00318] Table 2. Therapeutic agents that can be administered in combination with the mono- or di-F-CDN compounds as described herein.
- a tumor cell is meant a tumor cell (either “autologous” or “allogeneic” to the patient) which has been treated to prevent division of the cells.
- tumor cells preserve their immunogenicity and their metabolic activity.
- tumor cells are genetically modified to express a transgene which is expressed within a patient as part of cancer therapy.
- a composition or vaccine of the invention comprises neoplastic (e.g., tumor) cells that are autologous or allogeneic to the patient undergoing treatment and is most preferably the same general type of tumor cell as is afflicting the patient.
- a patient suffering from melanoma will typically be administered a genetically modified cell derived from a melanoma.
- Methods for inactivating tumor cells for use in the present invention such as the use of irradiation, are well known in the art.
- the inactivated tumor cells of the present invention are modified to express and secrete one or more heat shock proteins.
- gp96-Ig fusion proteins can be expressed and secreted to stimulate an immune response
- the inactivated tumor cells are modified to express and secrete a gp96-Ig fusion protein.
- the inactivated tumor cells of the present invention are administered to the patient together with one or more costimulatory molecules or agents.
- a preferred costimulatory agent comprises one or more cytokines which stimulate dendritic cell induction, recruitment, and/or maturation. Methods for assessing such costimulatory agents are well known in the literature.
- Induction and maturation of DCs is typically assessed by increased expression of certain membrane molecules such as CD80 and CD86, and/or secretion of pro-inflammatory cytokines, such as IL-12 and type I interferons following stimulation.
- the inactivated tumor cells themselves are modified to express and secrete one or more cytokines which stimulate dendritic cell induction, recruitment, and/or maturation.
- the present invention is described in exemplary terms with regard to the use of GM-CSF.
- the tumor cell may express a transgene encoding GM-CSF as described in U.S. Pat.
- GM-CSF-expressing genetically modified cancer cells or a "cytokine-expressing cellular vaccine" for the treatment of pancreatic cancer is described in U.S. Pat. Nos. 6,033,674 and 5,985,290.
- suitable cytokines which may be expressed by such inactivated tumor cells and/or bystander cells instead of, or together with, GM-CSF include, but are not limited to, one or more of CD40 ligand, FLT-3 ligand, IL-12, CCL3, CCL20, and CCL21.
- the tumor cell line may be accompanied by an inactivated bystander cell line which expresses and secretes one or more cytokines which stimulate dendritic cell induction, recruitment, and/or maturation.
- the bystander cell line may provide all of the cytokines which stimulate dendritic cell induction, recruitment, and/or maturation, or may supplement cytokines which stimulate dendritic cell induction, recruitment, and/or maturation expressed and secreted by the inactivated tumor cells.
- immunomodulatory cytokine-expressing bystander cell lines are disclosed in U.S. Pat. Nos. 6,464,973, and 8,012,469, Dessureault et al., Ann.
- GM-CSF Granulocyte-macrophage colony stimulating factor
- polypeptide is meant a cytokine or fragment thereof having immunomodulatory activity and having at least about 85% amino acid sequence identity to GenBank Accession No.
- the CDN compositions are administered in
- the target antigen may also be a fragment or fusion polypeptide comprising an immunologically active portion of the antigens listed in the table. This list is not meant to be limiting.
- Table 1 Antigens. Antigen Reference Tumor antigens Mesothelin GenBank Acc. No. NM_005823; U40434; NM_013404; BC003512
- WT-1 Wilms’ tumor-1 WT-1 isoform A (GenBank Acc. Nos. NM_000378; NP_000369). associated protein WT-1 isoform B (GenBank Acc. Nos. NM_024424; NP_077742). (Wt-1), including WT-1 isoform C (GenBank Acc. Nos. NM_024425; NP_077743). isoform A; isoform B; WT-1 isoform D (GenBank Acc. Nos. NM_024426; NP_077744). isoform C; isoform D. Table 1. Antigens. Antigen Reference Stratum corneum GenBank Acc. No.
- NM_005046; NM_139277; AF332583 See also, chymotryptic enzyme e.g., Bondurant, et al. (2005) Clin. Cancer Res.11:3446-3454; Santin, (SCCE), and variants et al. (2004) Gynecol. Oncol. 94:283-288; Shigemasa, et al. (2001) thereof. Int. J. Gynecol. Cancer 11:454-461; Sepehr, et al. (2001) Oncogene
- MHC class I See, e.g., Groh, et al. (2005) Proc. Natl. Acad. Sci. USA 102:6461- chain-related protein A 6466; GenBank Acc. Nos. NM_000247; BC_016929; AY750850; (MICA); MHC class I
- Glypican-3 an antigen GenBank Acc. No. NM_004484. Nakatsura, et al. (2003) Biochem. of, e.g., hepatocellular Biophys. Res. Commun.306:16-25; Capurro, et al. (2003) carcinoma and Gasteroenterol.125:89-97; Nakatsura, et al. (2004) Clin. Cancer Res. melanoma). 10:6612-6621). Coactosin-like protein. Nakatsura, et al. (2002) Eur. J. Immunol. 32:826-836; Laheru and
- Antigens Antigen Reference KNSL6; TRIP4;
- Ras e.g., wild type ras, GenBank Acc. Nos. P01112; P01116; M54969; M54968; P01111; ras with mutations at P01112; K00654.
- Cyclophilin B (Cyp-B). Tamura, et al. (2001) Jpn. J. Cancer Res.92:762-767.
- Antigens Antigen Reference forms of adenomatous et al. (2003) Appl. Immunohistochem. Mol. Morphol.11:230-237; polyposis coli (APC); Jungck, et al. (2004) Int. J. Colorectal. Dis.19:438-445; Wang, et al. beta-catenin; c-met; (2004) J. Surg. Res. 120:242-248; Abutaily, et al. (2003) J. Pathol. p53; E-cadherin; 201:355-362; Liang, et al. (2004) Br. J. Surg. 91:355-361; Shirakawa, cyclooxygenase-2 et al. (2004) Clin. Cancer Res. 10:4342-4348.
- EphA2 See, e.g., U.S. Patent Publication No. 2005/0281783 A1; Genbank
- NM_010139 (Mouse); Genbank Accession No. AB038986 (Chicken, partial sequence); GenBank Accession Nos. NP_004422, AAH37166, and AAA53375 (human); GenBank Accession Nos. NP_034269 (mouse), AAH06954 (mouse), XP_345597 (rat), and BAB63910 (chicken).
- EGFRvIII See, e.g., WO/2012/068360 Francisella tularensis antigens Francisella tularensis Complete genome of subspecies Schu S4 (GenBank Acc. No.
- Antigenic components of F. tularensis include, e.g., 80 antigens, including 10 kDa and 60 kDa chaperonins (Havlasova, et al. (2002) Proteomics 2:857-86), Table 1. Antigens. Antigen Reference nucleoside diphosphate kinase, isocitrate dehydrogenase,
- RNA-binding protein Hfq the chaperone ClpB (Havlasova, et al. (2005) Proteomics 5:2090-2103). See also, e.g., Oyston and Quarry (2005) Antonie Van Leeuwenhoek 87:277-281; Isherwood, et al. (2005) Adv. Drug Deliv. Rev.57:1403-1414; Biagini, et al. (2005) Anal. Bioanal. Chem. 382:1027-1034. Malarial antigens Circumsporozoite See, e.g., Haddad, et al.
- AMA1 antigen 1 (AMA1). (see, e.g., GenBank Acc. No. A ⁇ 13; AJ494905; AJ490565). Viruses and viral antigens Table 1. Antigens. Antigen Reference Hepatitis A GenBank Acc. Nos., e.g., NC_001489; AY644670; X83302; K02990;
- Hepatitis B Complete genome see, e.g., GenBank Acc. Nos. AB214516;
- Human T-cell See, e.g., Capdepont, et al. (2005) AIDS Res. Hum. Retrovirus 21:28- lymphotropic virus 42; Bhigjee, et al. (1999) AIDS Res. Hum. Restrovirus 15:1229-1233; (HTLV) types I and II, Vandamme, et al. (1998) J. Virol.72:4327-4340; Vallejo, et al. (1996) including the J. Acquir. Immune Defic. Syndr. Hum. Retrovirol.13:384-391.
- HTLV type I subtypes HTLV type I subtypes HTLV type I (see, e.g., GenBank Acc. Nos. AY563954; AY563953. Cosmopolitan, Central HTLV type II (see, e.g., GenBank Acc. Nos. L03561; Y13051;
- Antigens including, e.g., human enterovirus A (GenBank Acc. Nos. NC_001612); human
- enterovirus A HEV-A, enterovirus B (NC_001472); human enterovirus C (NC_001428); CAV2 to CAV8, human enterovirus D (NC_001430).
- Simian enterovirus A GenBank CAV10, CAV12, Acc. No. NC_003988).
- Polioviruses including See, e.g., He, et al. (2003) J. Virol.77:4827-4835; Hahsido, et al. PV1, PV2, and PV3. (1999) Microbiol. Immunol.43:73-77. GenBank Acc. No. AJ132961
- Viral encephalitides See, e.g., Hoke (2005) Mil. Med.170:92-105; Estrada-Franco, et al. viruses, including (2004) Emerg. Infect. Dis. 10:2113-2121; Das, et al. (2004) Antiviral equine encephalitis, Res.64:85-92; Aguilar, et al. (2004) Emerg. Infect. Dis. 10:880-888; Venezuelan equine Weaver, et al. (2004) Arch. Virol. Suppl. 18:43-64; Weaver, et al. encephalitis (VEE) (2004) Annu. Rev. Entomol.
- Eastern equine encephalitis including subtypes IA, (GenBank Acc. No. NC_003899; AY722102); Western equine IB, IC, ID, IIIC, IIID), encephalitis (NC_003908).
- EEE encephalitis
- Streptococcus agalactia Group B Strep
- Streptococcus pneumonia Staphylococcus aureus
- Escherichia coli Haemophilus influenzae
- Neisseria meningitidis Neisseria gonorrheae
- Vibrio cholerae Salmonella species (including typhi, typhimurium)
- enterica including Helicobactor pylori Shigella flexneri and other Group D shigella species
- Burkholderia mallei Burkholderia pseudomallei
- Klebsiella pneumonia Clostridium species (including C. difficile), Vibrio parahaemolyticus and V. vulnificus.
- compositions refers to a chemical substance intended for use in the cure, treatment, or prevention of disease and which is subject to an approval process by the U.S. Food and Drug Administration (or a non-U.S. equivalent thereof) as a prescription or over-the-counter drug product. Details on techniques for formulation and administration of such compositions may be found in Remington, The Science and Practice of Pharmacy 21 st Edition (Mack Publishing Co., Easton, PA) and Nielloud and Marti-Mestres, Pharmaceutical Emulsions and Suspensions: 2 nd Edition (Marcel Dekker, Inc, New York).
- the pharmaceutical compositions may be administered by a variety of means including non-parenterally, parenterally, by inhalation spray, topically, or rectally in formulations containing pharmaceutically acceptable carriers, adjuvants and vehicles.
- “Non-parenteral administration” encompasses oral, buccal, sublingual, topical, transdermal, ophthalmic, otic, nasal, rectal, cervical, pulmonary, mucosal, and vaginal routes.
- parenteral as used here includes but is not limited to subcutaneous, intravenous, intramuscular, intraarterial, intradermal, intrathecal and epidural injections with a variety of infusion techniques. Intraarterial and intravenous injection as used herein includes administration through catheters.
- Intra-tumoral (directly into the tumor mass) or peri-tumoral (around the tumor mass) administration of the compounds of the present invention may directly activate locally infiltrating DC, directly promote tumor cell apoptosis or sensitize tumor cells to cytotoxic agents.
- oral as used herein includes, but is not limited to oral ingestion, or delivery by a sublingual or buccal route.
- Oral administration includes fluid drinks, energy bars, as well as pill formulations.
- Pharmaceutical compositions may be in any form suitable for the intended method of administration.
- compositions intended for oral use may be prepared according to any method known to the art for the manufacture of pharmaceutical compositions and such compositions may contain one or more agents including sweetening agents, flavoring agents, coloring agents and preserving agents, in order to provide a palatable preparation.
- Tablets containing a drug compound in admixture with non-toxic pharmaceutically acceptable excipient which are suitable for manufacture of tablets are acceptable.
- excipients may be, for example, inert diluents, such as calcium or sodium carbonate, lactose, calcium or sodium phosphate; granulating and disintegrating agents, such as maize starch, or alginic acid; binding agents, such as starch, gelatin or acacia; and lubricating agents; such as magnesium stearate, stearic acid or talc. Tablets may be uncoated, or may be coated by known techniques including enteric coating, colonic coating, or microencapsulation to delay disintegration and adsorption in the gastrointestinal tract and/or provide a sustained action over a longer period.
- inert diluents such as calcium or sodium carbonate, lactose, calcium or sodium phosphate
- granulating and disintegrating agents such as maize starch, or alginic acid
- binding agents such as starch, gelatin or acacia
- lubricating agents such as magnesium stearate, stearic acid or tal
- a time delay material such as glyceryl monostearate or glyceryl distearate alone or with a wax may be employed.
- Formulations for oral use may be also presented as hard gelatin capsules where the drug compound is mixed with an inert solid diluent, for example calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, such as peanut oil, liquid paraffin or olive oil.
- Pharmaceutical compositions may be formulated as aqueous suspensions in admixture with excipients suitable for the manufacture of aqueous-suspensions.
- Such excipients include a suspending agent, such as sodium carboxymethylcellulose, methylcellulose, hydroxypropyl methylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia, and dispersing or wetting agents such as a naturally occurring phosphatide (e.g., lecithin), a condensation product of an alkylene oxide with a fatty acid (e.g., polyoxyethylene stearate), a condensation product of ethylene oxide with a long chain aliphatic alcohol (e.g., heptadecaethyleneoxycetanol), a condensation product of ethylene oxide with a partial ester derived from a fatty acid and a hexitol anhydride (e.g., polyoxyethylene sorbitan monooleate).
- a suspending agent such as sodium carboxymethylcellulose, methylcellulose, hydroxypropyl methylcellulose, sodium alginate, polyvinylpyrrolidone, gum trag
- the aqueous suspension may also contain one or more preservatives such as ethyl or n-propyl p-hydroxy-benzoate, one or more coloring agents, one or more flavoring agents and one or more sweetening agents, such as sucrose or saccharin.
- Oil suspensions may be formulated by suspending the active ingredient in a vegetable oil, such as arachis oil, olive oil, sesame oil or coconut oil, or a mineral oil such as liquid paraffin.
- the oral suspensions may contain a thickening agent, such as beeswax, hard paraffin or cetyl alcohol. Sweetening agents, such as those set forth above, and flavoring agents may be added to provide a palatable oral preparation.
- compositions may be preserved by the addition of an antioxidant such as ascorbic acid.
- Dispersible powders and granules of the disclosure suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, a suspending agent, and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those disclosed above. Additional excipients, for example sweetening, flavoring and coloring agents, may also be present.
- the pharmaceutical compositions of the disclosure may also be in the form of oil-in-water emulsions.
- the oily phase may be a vegetable oil, such as olive oil or arachis oil, a mineral oil, such as liquid paraffin, or a mixture of these.
- Suitable emulsifying agents include naturally-occurring gums, such as gum acacia and gum tragacanth, naturally occurring phosphatides, such as soybean lecithin, esters or partial esters derived from fatty acids and hexitol anhydrides, such as sorbitan monooleate, and condensation products of these partial esters with ethylene oxide, such as polyoxyethylene sorbitan monooleate.
- the emulsion may also contain sweetening and flavoring agents.
- Syrups and elixirs may be formulated with sweetening agents, such as glycerol, sorbitol or sucrose. Such formulations may also contain a demulcent, a preservative, a flavoring or a coloring agent.
- the pharmaceutical compositions of the disclosure may be in the form of a sterile injectable preparation, such as a sterile injectable aqueous or oleaginous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents which have been mentioned above.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent such as a solution in 1,3-butane-diol or prepared as a lyophilized powder.
- a non-toxic parenterally acceptable diluent or solvent such as a solution in 1,3-butane-diol or prepared as a lyophilized powder.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile fixed oils may conventionally be employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or diglycerides.
- fatty acids such as oleic acid may likewise be used in the preparation of injectables.
- the amount of active ingredient that may be combined with the carrier material to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
- a time-release formulation intended for oral administration to humans may contain approximately 20 to 500 mg of active material compounded with an appropriate and convenient amount of carrier material which may vary from about 5 to about 95% of the total compositions. It is preferred that the pharmaceutical composition be prepared which provides easily measurable amounts for administration.
- an effective amount to be administered systemically is about 0.1 mg/kg to about 100 mg/kg and depends upon a number of factors including, for example, the age and weight of the subject (e.g., a mammal such as a human), the precise condition requiring treatment and its severity, the route of administration, and will ultimately be at the discretion of the attendant physician or veterinarian. It will be understood, however, that the specific dose level for any particular patient will depend on a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex and diet of the individual being treated; the time and route of administration; the rate of excretion; other drugs which have previously been administered; and the severity of the particular condition undergoing therapy, as is well understood by those skilled in the art.
- formulations of the disclosure suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets each containing a predetermined amount of the active ingredient, as a powder or granules; as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water liquid emulsion or a water-in-oil liquid emulsion.
- the pharmaceutical compositions may also be administered as a bolus, electuary or paste.
- a tablet may be made by compression or molding, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared by compressing in a suitable machine the active ingredient in a free flowing form such as a powder or granules, optionally mixed with a binder (e.g., povidone, gelatin, hydroxypropyl ethyl cellulose), lubricant, inert diluent, preservative, disintegrant (e.g., sodium starch glycolate, cross-linked povidone, cross-linked sodium carboxymethyl cellulose) surface active or dispersing agent. Molded tablets may be made in a suitable machine using a mixture of the powdered compound moistened with an inert liquid diluent.
- a binder e.g., povidone, gelatin, hydroxypropyl ethyl cellulose
- lubricant e.g., lubricant, inert diluent, preservative, disintegrant (e.g., sodium starch glycolate, cross-linked povidone, cross-linked sodium carboxymethyl
- the tablets may optionally be coated or scored and may be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropyl methylcellulose in varying proportions to provide the desired release profile. Tablets may optionally be provided with an enteric or colonic coating to provide release in parts of the gut other than the stomach. This is particularly advantageous with the mono- or di-F- CDN compounds as described herein when such compounds are susceptible to acid hydrolysis.
- Formulations suitable for topical administration in the mouth include lozenges comprising the active ingredient in a flavored base, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert base such as gelatin and glycerin, or sucrose and acacia; and mouthwashes comprising the active ingredient in a suitable liquid carrier.
- Formulations for rectal administration may be presented as a suppository with a suitable base comprising for example cocoa butter or a salicylate.
- Formulations suitable for vaginal administration may be presented as pessaries, tampons, creams, gels, pastes, foams or spray formulations containing in addition to the active ingredient such carriers as are known in the art to be appropriate.
- Formulations suitable for parenteral administration include aqueous and non- aqueous isotonic sterile injection solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
- a disclosed compound or its salt is named or depicted by structure, it is to be understood that the compound or salt, including solvates (particularly, hydrates) thereof, may exist in crystalline forms, non-crystalline forms or a mixture thereof.
- the compound or salt, or solvates (particularly, hydrates) thereof may also exhibit polymorphism (i.e.
- polymorphs typically known as“polymorphs.” It is to be understood that when named or depicted by structure, the disclosed compound, or solvates (particularly, hydrates) thereof, also include all polymorphs thereof. Polymorphs have the same chemical composition but differ in packing, geometrical arrangement, and other descriptive properties of the crystalline solid state. Polymorphs may have different physical properties such as density, shape, hardness, stability, and dissolution properties. Polymorphs typically exhibit different melting points, IR spectra, and X-ray powder diffraction patterns, which may be used for identification.
- solvates of compounds of this invention, or salts thereof, that are in crystalline form may involve nonaqueous solvents such as ethanol, isopropanol, dimethyl sulfoxide, acetic acid, ethanolamine, and ethyl acetate, or they may involve water as the solvent that is incorporated into the crystalline lattice.
- Solvates wherein water is the solvent that is incorporated into the crystalline lattice are typically referred to as“hydrates.” Hydrates include stoichiometric hydrates as well as
- compositions containing variable amounts of water The invention includes all such solvates.
- the salts of the compounds of this invention are preferably pharmaceutically acceptable. Suitable pharmaceutically acceptable salts include those described by P. Heinrich Stahl and Camille G. Wermuth in Handbook of Pharmaceutical Salts: Properties, Selection, and Use, 2 nd ed. (Wiley-VCH: 2011) and also Remington’s Pharmaceutical Sciences, 18 th ed. (Mack Publishing, Easton PA: 1990) and also Remington: The Science and Practice of Pharmacy, 19 th ed. (Mack Publishing, Easton PA: 1995). Salt encompassed within the term“pharmaceutically acceptable salts” refer to non-toxic salts of the compounds in this invention.
- Salts of the compounds of this invention containing a basic amine or other basic functional group may be prepared by any suitable method known in the art, including treatment of the free bases with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like, or with an organic acid, such as acetic acid, trifluoroacetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, formic acid, alginic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, pyranosildyl acid, such as glucuronic acid or galacturonic acid, alphahydroxy acid, such as citric acid or tartaric acid, amino acid, such as aspartic acid or glutamic acid, aromatic acid, such as benzoic acid or cinnamic acid, sulfonic acid, such as p-toluenesulfonic acid, me
- Examples of pharmaceutically acceptable salts include sulfates, pyrosulfates, bisulfates, sulfites, bisulfites, phosphates, chlorides, bromides, iodides, acetates, propionates, decanoates, caprylates, acrylates, formates, isobutyrates, caproates, heptanoates, propiolates, oxalates, malonates succinates, suberates, sebacates, fumarates, maleates, butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates, methylbenzoates, dinitrobenzoates, hydroxybenzoates, methoxybenzoates, phthalates, phenylacetates, phenylpropionates, phenylbutrates, citrates, lactates, glycolate, resinate,lactates, camsylates, tartrates, mande
- Salts of the compounds of this invention containing a phosphate diester, phosphorothioate diester or other acidic functional group can be prepared by reacting with a suitable base.
- Pharmaceutically acceptable salts include, but are not limited to: acetate, pyridine, ammonium, piperazine, diethylamine, nicotinamide, formic, urea, sodium, potassium, calcium, magnesium, zinc, lithium, cinnamic, methylamino, methanesulfonic, picric, tartaric, triethylamino, dimethylamino, and tris(hydoxymethyl)aminomethane. Additional pharmaceutically acceptable salts are known to those skilled in the art.
- Such a pharmaceutically acceptable salt may be made with a base which affords a pharmaceutically acceptable cation, which includes alkali metal salts (especially sodium and potassium), alkaline earth metal salts (especially calcium and magnesium), aluminum salts and ammonium salts, zinc, as well as salts made from physiologically acceptable organic bases such as diethylamine, isopropylamine, olamine, benzathine, benethamine, tromethamine (2-amino-2-(hydroxymethyl)propane-1,3-diol), morpholine, epolamine, piperidine, piperazine, picoline, dicyclohexylamine, N,N’- dibenzylethylenediamine, 2-hydroxyethylamine, tri-(2-hydroxyethyl)amine,
- a base which affords a pharmaceutically acceptable cation, which includes alkali metal salts (especially sodium and potassium), alkaline earth metal salts (especially calcium and magnesium), aluminum salts and ammonium salts
- the mono- or di-F-CDN compounds as described herein that include salts thereof can be described by structures wherein the -SH or -OH in the phosphate or thiophosphate bond (e.g.
- R5 or R6 of the compound of Formula I as described herein are represented as -S- or -O- with a corresponding cation to form salts of the compounds as described herein.
- a salt of the compound of Formula II of the third aspect as described herein can be represented by the following structures:
- a y+ represents a mono or polyvalent salt cation
- n and m are the lowest possible whole number for a given y.
- a y+ is monovalent, i.e. when y is 1, such as Na + , K + , NH4 + , TEAH + or the like, n is 1 and m is 2; when y is 2, such as Ca 2+ , Mg 2+ and the like, n is 1 and m is 1; when y is 3, e.g. Al 3+ or the like, n is 3 and m is 2.
- salts of a monovalent or divalent salt cation can be represented as
- monovalent salts can be depicted with A + adjacent each of the -S- or -O-.
- the sodium salt of a mono- or di-F-RR-CDN compounds of Formula II as described herein can be depicted as
- the compounds may include salts of the 2’OH group as well, for example, tris-triethylammonium salts of a compound of Formula II, e.g. wherein R19 is F and R20 is OH ma have the structure re resented as
- non-pharmaceutically acceptable salts e.g. trifluoroacetate or triethylammonium may be used, for example in the isolation of compounds of the invention, and are included within the scope of this invention.
- the invention includes within its scope all possible stoichiometric and non-stoichiometric forms of the salts of the compounds of this invention.
- a compound of this invention containing a basic amine or other basic functional group is isolated as a salt
- the corresponding free base form of that compound may be prepared by any suitable method known to the art, including treatment of the salt with an inorganic or organic base, suitably an inorganic or organic base having a higher pK a than the free base form of the compound.
- a compound of this invention containing a phosphate diester, phosphorothioate diester or other acidic functional group is isolated as a salt
- the corresponding free acid form of that compound may be prepared by any suitable method known to the art, including treatment of the salt with an inorganic or organic acid, suitably an inorganic or organic acid having a lower pKa than the free acid form of the compound.
- pharmaceutically acceptable hydrate thereof as described herein, for a particular patient may vary depending on factors such as the condition being treated, the overall health of the patient, the route and dose of administration and the severity of side effects.
- Guidance for methods of treatment and diagnosis is available (see, e.g., Maynard, et al. (1996) A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, FL; Dent (2001) Good Laboratory and Good Clinical Practice, Urch Publ., London, UK).
- An effective amount may be given in one dose, but is not restricted to one dose.
- the administration can be two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more, administrations of a pharmaceutical composition comprising the mono- or di-F- CDN compound, or a pharmaceutically acceptable salt, pharmaceutically acceptable solvate or pharmaceutically acceptable hydrate thereof as described herein.
- the administrations can be spaced by time intervals of one minute, two minutes, three, four, five, six, seven, eight, nine, ten, or more minutes, by intervals of about one hour, two hours, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, and so on.
- the term“about” means plus or minus any time interval within 30 minutes.
- the administrations can also be spaced by time intervals of one day, two days, three days, four days, five days, six days, seven days, eight days, nine days, ten days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, and combinations thereof.
- the invention is not limited to dosing intervals that are spaced equally in time, but encompass doses at non-equal intervals.
- a dosing schedule of, for example, once/week, twice/week, three times/week, four times/week, five times/week, six times/week, seven times/week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, and the like, is available for the invention.
- the dosing schedules encompass dosing for a total period of time of, for example, one week, two weeks, three weeks, four weeks, five weeks, six weeks, two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, and twelve months.
- the cycle can be repeated about, e.g., every seven days; every 14 days; every 21 days; every 28 days; every 35 days; 42 days; every 49 days; every 56 days; every 63 days; every 70 days; and the like.
- An interval of non dosing can occur between a cycle, where the interval can be about, e.g., seven days; 14 days; 21 days; 28 days; 35 days; 42 days; 49 days; 56 days; 63 days; 70 days; and the like.
- the term“about” means plus or minus one day, plus or minus two days, plus or minus three days, plus or minus four days, plus or minus five days, plus or minus six days, or plus or minus seven days.
- co-administration or administration together indicates treating a subject with two or more agents, where the agents can be administered simultaneously or at different times.
- agents may be delivered to a single subject as separate administrations, which may be at essentially the same time or different times, and which may be by the same route or different routes of administration.
- compositions of the present invention are preferably formulated as pharmaceutical compositions for parenteral or enteral delivery.
- a typical parenteral or enteral delivery A typical
- composition for administration to an animal subject comprises a pharmaceutically acceptable vehicle such as aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
- a pharmaceutically acceptable vehicle such as aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
- a pharmaceutically acceptable vehicle such as aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
- a pharmaceutically acceptable vehicle such as aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oil and injectable organic esters such as ethyloleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles such as sodium chloride, Ringer's dextrose, etc.
- Intravenous vehicles include fluid and nutrient replenishers.
- Preservatives include antimicrobial agents, anti-oxidants, chelating agents and inert gases.
- the pH and exact concentration of the various components the pharmaceutical composition are adjusted according to routine skills in the art.
- At least one prime or boost delivery comprises delivery of the inactivated tumor cell/mono- or di-F-CDN compound or compositions thereof described herein.
- the heterologous arm of the regimen may comprise delivery of antigen using one or more of the following strategies: inactivated or attenuated bacteria or viruses comprising the antigen of interest, which are particles that have been treated with some denaturing condition to render them ineffective or inefficient in mounting a pathogenic invasion; purified antigens, which are typically naturally-produced antigens purified from a cell culture of the pathogen or a tissue sample containing the pathogen, or a recombinant version thereof; live viral or bacterial delivery vectors recombinantly engineered to express and/or secrete antigens in the host cells of the subject.
- These strategies rely on: inactivated or attenuated bacteria or viruses comprising the antigen of interest, which are particles that have been treated with some denaturing condition to render them ineffective or inefficient in mounting a pathogenic invasion; purified antigens, which are typically naturally-produced antigens purified from a cell culture of the pathogen or a tissue sample containing the pathogen, or a recombinant
- antigen presenting cell such as a dendritic cell (DC) vector, which comprise cells that are loaded with an antigen, or transfected with a composition comprising a nucleic acid encoding the antigen (e.g., Provenge® (Dendreon Corporation) for the treatment of castration-resistant metastatic prostate cancer); liposomal antigen delivery vehicles; and naked DNA vectors and naked RNA vectors which may be administered by a gene gun, electroporation, bacterial ghosts, microspheres, microparticles, liposomes, polycationic nanoparticles, and the like.
- APC antigen presenting cell
- DC dendritic cell
- naked DNA vectors and naked RNA vectors which may be administered by a gene gun, electroporation, bacterial ghosts, microspheres, microparticles, liposomes, polycationic nanoparticles, and the like.
- a prime vaccine and a boost vaccine can be administered by any one or combination of the following routes.
- the prime vaccine and boost vaccine are administered by the same route.
- the prime vaccine and boost vaccine are administered by different routes.
- the term“different routes” encompasses, but is not limited to, different sites on the body, for example, a site that is oral, non-oral, enteral, parenteral, rectal, intranode (lymph node), intravenous, arterial, subcutaneous, intramuscular, peritumor, intratumor, infusion, mucosal, nasal, in the cerebrospinal space or cerebrospinal fluid, and so on, as well as by different modes, for example, oral, intravenous, and intramuscular.
- an effective amount of a prime or boost vaccine may be given in one dose, but is not restricted to one dose.
- the administration can be two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more, administrations of the vaccine.
- the administrations can be spaced by time intervals of one minute, two minutes, three, four, five, six, seven, eight, nine, ten, or more minutes, by intervals of about one hour, two hours, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, and so on.
- the term“about” means plus or minus any time interval within 30 minutes.
- the administrations can also be spaced by time intervals of one day, two days, three days, four days, five days, six days, seven days, eight days, nine days, ten days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, and combinations thereof.
- the invention is not limited to dosing intervals that are spaced equally in time, but encompass doses at non-equal intervals, such as a priming schedule consisting of administration at 1 day, 4 days, 7 days, and 25 days, just to provide a non- limiting example.
- the final compounds may exist as the triethylammonium (TEAH + or Et 3 NH + ) salt, which can be converted to other salt forms (including but not limited to sodium (Na + ) or ammonium (NH4 + )) using standard ion exchange techniques or other well known methods.
- TEAH + or Et 3 NH + triethylammonium
- other salt forms including but not limited to sodium (Na + ) or ammonium (NH4 + )
- Assignments of Stereochemistry at the phosphorus were made in analogy to literature methods (Zhao et al. Nucleosides, Nucleotides, and Nucleic Acid 289:352-378, 2009) or as discussed in the examples below.
- SalPCl Salicyl chlorophosphite (2-chloro- 4H-benzo[d][1,3,2]dioxaphosphinin-4-one).
- DCA dichloroacetic acid.
- DDTT 3- ((N,N-dimethyl-aminomethylidene)amino)-3H-1,2,4-dithiazole-5-thione.
- DAST diethylaminosulfur trifluoride.
- NaHCO 3 sodium bicarbonate.
- EtOH ethanol.
- EtOAc ethyl acetate.
- KOAc potassium acetate.
- MeCN acetonitrile.
- MeOH methanol.
- NH 4 OAc ammonium acetate.
- DMAP N,N-dimethylpyridin-4-amine.
- DMOCP 2-chloro-5,5-dimethyl-1,3,2- dioxaphosphorinane-2-oxide.
- DMTCl 4,4 ⁇ -dimethoxytrityl chloride.
- DMT 4,4- dimethoxytrityl.
- N-phenyltriflamide 1,1,1-trifluoro-N-phenyl-N- ((trifluoromethyl)sulfonyl)methanesulfonamide.
- TBAF tetrabutylammonium fluoride.
- TBS tert-butyldimethylsilyl.
- TEAA Triethylammonium acetate.
- TEA Triethylammonium acetate.
- TEA Triethylam
- TEAH + triethylammonium.
- TEAB trithylammonium bicarbonate.
- TFA trifluoroacetic acid.
- TMSCl trimethylsilyl chloride.
- HF hydrofluoric acid.
- THF tetrahydrofuran.
- G Guanine.
- G ib isobutyryl guanine.
- A adenine.
- a Bz benzoyl adenine.
- AMA ammonium hydroxide/40% methylamine solution in water.
- Step 1 Preparation of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4- fluoro-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (2): To a solution of N-(9-((2R,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-fluoro-4- hydroxytetrahydrofuran-2-yl)-9H-purin-6-yl)benzamide (1, 2.0 g, 3.0 mmol, ChemGenes) in 1,4-dioxane (25 mL) and pyridine (8 mL) was added a solution of SalPCl (0.84 g, 4.1 mmol) in 1,4-dioxane (12 mL).
- Step 2 Preparation of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2- ((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluorotetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (4): To a solution of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2- ((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-fluorotetrahydrofuran-3-yl (2- cyanoethyl) diis
- Step 3 Preparation of N,N'-(((2R,3R,3aR,7aR,9R,10R,10aR,12R,14aR)-5-(2- cyanoethoxy)-3,10-difluoro-12-mercapto-12-oxido-5-sulfidooctahydro-2H,7H-difuro[3,2- d:3',2'-j][1,3,7,9]tetraoxa[2,8]diphosphacyclododecine-2,9-diyl)bis(9H-purine-9,6- diyl))dibenzamide(5): To a solution of compound 4 in CH2Cl2 (60 mL) was added water (0.35 mL) and a 6% (v/v) solution of DCA in CH 2 Cl 2 (60 mL).
- Step 4 Preparation of 3’3’-RR-(2’F-A)(2’F-A) (6) and 3’3’-RS-(2’F-A)(2’F- A) (6a): To a stirred solution of compound 5 (65 mg, 0.07 mmol) in MeOH (0.9 mL) was added aqueous ammonium hydroxide (0.9 mL) and the orange slurry was heated at 50 oC. After two hours, the orange solution was allowed to cool and concentrated in vacuo.
- the washes were discarded.
- the resin was treated with 2 mL of 1 N aqueous sodium hydroxide solution. Afterwards, the condensed resin was washed six times with 2 mL of millipore filtered water.
- the TEAH + salt of compound 6 (5 mg) was dissolved in 2 mL of millipore filtered water and loaded onto the resin. The resin was washed six times with 2 mL of millipore filtered water and the desired product was collected from the eluting fractions and lyophilized overnight to provide the sodium salt of compound 6 (3 mg).
- Step 1 Preparation of (2R,3R,4R,5R)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(2-isobutyramido-6-oxo-1,6- dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (9): To a solution of (2R,3R,4R,5R)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(2- isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl (2-cyanoethyl) diisopropylphosphoramidite (8, 1 g, ChemGenes) in acetonitrile (5 mL) and water (36 ⁇ L) was added
- Step 2 Preparation of (2R,3R,4R,5R)-4-fluoro-2-(hydroxymethyl)-5-(2- isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (11): To a solution of compound 9 (1.7 g) and DCM (12 mL) was added water (0.18 mL) followed by a solution of 6% solution of DCA in DCM (12 mL).
- Step 3 Preparation of (2R,3R,4R,5R)-2-(((((((2R,3R,4R,5R)-5-(6-benzamido- 9H-purin-9-yl)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4- fluorotetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphorothioyl)oxy)methyl)-4-fluoro-5- (2-isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (12): A solution of compound 3 (co-evaporated in vacuo 3 x 6.6 mL with anhydrous acetonitrile, leaving 4 mL) in 4 mL of anhydrous acetonitrile was added and the 1.4 mL solution of compound 11 and
- Step 4 Preparation of N-(9-((2R,3R,3aR,5R,7aR,9R,10R,10aR,12R,14aR)-5- (2-cyanoethoxy)-3,10-difluoro-9-(2-isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)-12- mercapto-12-oxido-5-sulfidooctahydro-2H,7H-difuro[3,2-d:3',2'- j][1,3,7,9]tetraoxa[2,8]diphosphacyclododecin-2-yl)-9H-purin-6-yl)benzamide (13): To a solution of compound 12 (1.8 g) in D
- Step 5 Preparation of RR-(2’F-G)(2’F-A) (14) and 3’3’-RS-(2’F-G)(2’F-A) (14a): A solution of R p R p enriched compound 13 (50 mg) in AMA (0.84 mL) and EtOH (0.36mL) was heated to 50 °C for 4 h. The reaction mixture was cooled to room temperature and sparged with argon for 10 min, then concentrated in vacuo. Purification by reverse phase C18 MPLC and preparative HPLC gave 9 mg of compound 14 as the tris-triethylammonium salt. LCMS-ESI: 711.30 [M+H] + (calculated for
- Step 1 Preparation of (2R,3R,4R,5R)-2-((((((2R,3R,4R,5R)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(2-isobutyramido-6-oxo-1,6- dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-fluoro-5-(2-isobutyramido-6-oxo-1,6- dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (15): A solution of compound 8 (ChemGenes, coevapped 3 x 13 mL with anhydrous MeCN) in 8 mL of anhydrous MeCN was added to compound 11 (in 3
- Step 2 Preparation of N,N'-(((2R,3R,3aR,5R,7aR,9R,10R,10aR,12R,14aR)-5- (2-cyanoethoxy)-3,10-difluoro-12-mercapto-12-oxido-5-sulfidooctahydro-2H,7H- difuro[3,2-d:3',2'-j][1,3,7,9]tetraoxa[2,8]diphosphacyclododecine-2,9-diyl)bis(6-oxo-6,9- dihydro-1H-purine-9,2-diyl))bis(2-methylpropanamide) (16): To a solution of crude compound 15 (8.4 g) in DCM (48 mL)
- Step 3 Preparation of 3’3’-RR-(2’F-G)(2’F-G) (17): A solution of compound 16 (75 mg) in AMA (1.3 mL) and EtOH (0.54 mL) was heated to 50 °C for 4 h. The reaction mixture was cooled to room temperature and sparged with argon for 10 min, then concentrated in vacuo. Purification by reverse phase C18 MPLC and preparative HPLC gave 19 mg of compound 17 as the bis-triethylammonium salt.
- Step 1 Preparation of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4- ((tert-butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (19): To a solution of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2- ((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert- butyldimethylsilyl)oxy)tetrahydrofuran-3-yl (2-cyanoethyl) diisopropylphosphoramidite (18, 2.0 g, 2.0 mmol, ChemGenes) in MeCN (10 mL) was added water (0.07 mL) followed by pyridinium trifluoroacetate (0.47 g, 2.4 ).
- Step 2 Preparation of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2- ((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluorotetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert- butyldimethylsilyl)oxy)tetrahydrofuran-3-yl hydrogen phosphonate (20): To a solution of compound 3 (1.8 g, 2.0 mmol, ChemGenes) in MeCN (20 mL) was dried through concentration in vacuo.
- Step 3 Preparation of N,N'-(((2R,3R,3aR,5R,7aR,9R,10R,10aR,12R,14aR)-3- ((tert-butyldimethylsilyl)oxy)-12-(2-cyanoethoxy)-10-fluoro-5-mercapto-5-oxido-12- sulfidooctahydro-2H,7H-difuro[3,2-d:3',2'- j][1,3,7,9]tetraoxa[2,8]diphosphacyclododecine-2,9-diyl)bis(9H-purine-9,6- diyl))dibenzamide (21) and N,N'-(((2R,3R,3aR,5R,7aR,9R,10R,10aR,12S,14aR)-3-((tert- butyldimethylsilyl)oxy)-12
- Step 4 Preparation of 3’3’-RR-(A)(2’F-A) (22) and 3’3’-RS-(A)(2’F-A) (22a): To a stirred solution of compound 21 (150 mg), enriched in the Rp,Rp
- Step 1 Preparation of (2R,3R,4R,5R)-2-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-fluoro-5-(2-isobutyramido-6-oxo-1,6- dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (9): To a solution of compound 8 (10 g, 10 mmole, ChemGenes, see Example 2) in MeCN (50 mL) and water (360 ⁇ L) was added pyridinium trifluoroacetate (2.32 mg).
- Step 2 Preparation of (2R,3R,4R,5R)-4-fluoro-2-(hydroxymethyl)-5-(2- isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (11): To a solution of the crude mixture of compound 9 and 10 ( ⁇ 8.5 g, 5 mmole) and DCM (60 mL) was added water (0.09 mL) followed by a solution of 6% solution of DCA in DCM (60 mL). After 10 min the reaction mixture was quenched with pyridine (7.0 mL) and then concentrated in vacuo.
- Step 3 Preparation of (2R,3R,4R,5R)-2-(((((((2R,3R,4R,5R)-5-(6-benzamido- 9H-purin-9-yl)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4- fluorotetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-4-fluoro-5-(2- isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-3-yl hydrogen phosphonate (28): A solution of compound 3 was coevapped 3 x 35 mL with anhydrous MeCN, leaving 20 mL anhydrous MeCN, and was added to the crude solution of
- Step 4 Preparation of N-(9-((2R,3R,3aR,7aR,9R,10R,10aR,14aR)-5-(2- cyanoethoxy)-3,10-difluoro-12-hydroxy-9-(2-isobutyramido-6-oxo-1,6-dihydro-9R-purin- 9-yl)-5,12-dioxidooctahydro-2R,7H-difuro[3,2-d:3',2'- j][1,3,7,9]tetraoxa[2,8]diphosphacyclododecin-2-yl)-9H-purin-6-yl)benzamide (29): To a solution of compound 28 (22 g) in DCM (120 mL) was added water (600 ⁇ L) followed by a 6% solution of DCA in DCM (120 mL).
- reaction mixture was quenched with pyridine (50 mL) and concentrated in vacuo to remove the DCM.
- An additional amount of pyridine (150 mL) was added and the mixture was concentrated in vacuo to 100 mL.
- DMOCP (2.92 g) was added and the reaction was stirred for 3 min followed by the addition of water (3.2 mL) and then iodine (1.65 g).
- the reaction was quenched with a solution of sodium bisulfite (1 g NaHSO3 in 700 mL water) and extracted with a 1:1 mixture of ethyl ether and EtOAc (800 mL). The aqueous layer was further extracted with an additional 200 mL of DCM.
- Step 5 Preparation of 3’3’-(2’F-G)(2’F-A) (30): A solution of compound 30 (3.15 g) in AMA (22 mL) and EtOH (9.45mL) was heated to 50 °C for 4 h. The reaction mixture was cooled to room temperature and sparged with argon for 10 min. Purification by reverse phase C18 MPLC and preparative HPLC gave 22 mg of compound 30.
- Example 11 In vitro binding analysis of mono- or di-F-CDNs with purified STING protein [00421] DNA encoding amino acids 140-379 (amino acid numbering corresponding to Swiss Prot Q86WV6) was amplified from plasmids containing the full length sequence of human STING alleles via polymerase chain reaction with the following primers: forward TACTTCCAATCCAATGCAGCCCCAGCTGAGATCTCTG (SEQ ID NO: 8) and reverse TTATCCACTTCCAATGTTATTATTATCAAGAGAAATCCGTGCGGAG (SEQ ID NO: 9).
- STING variant alleles were assigned according to Yi, et al, (2013), PLoS One, 8(10), e77846 (DOI: 10.1371/journal.pone.0077846.
- PCR products were cloned into bacterial expression vector encoding a N-terminal hexa-histidine affinity tag (6xHIS) followed by a small ubiquitin-like modifier (SUMO) solubility sequence (Butt, et al, (2005) Protein expression and purification 43.1, 1-9) and tobacco etch virus protease cleavage site (TEV) using ligation independent cloning (Aslanidis, et al, (1990) Nucleic acids research, 18.20, 6069-6074).
- Plasmids encoding 6xHIS-SUMO-TEV-STING amino acids 140-379 were transformed into Rosetta2 (DE3) E. coli cells (EMD Millipore) for protein expression. Cells were grown in lysogeny broth at 37°C until a 600 nM absorbance of 0.6 was reached. Cells were then transferred to 18°C and protein expression was induced overnight by the addition of isopropyl ⁇ -D-1-thiogalactopyranoside to the media at a concentration of 0.25 mM. Cells were harvested by centrifugation at 6,000 times gravity for 10 minutes.
- Tris hydrochloride Tris hydrochloride pH 7.5, 500 mM sodium chloride (NaCl), 20 mM imidazole, 10% glycerol, 1 mM tris(2-carboxyethyl)phosphine hydrochloride (TCEP) and protease inhibitor tablet (Pierce) (Buffer A). Cells were lysed using an S-450D sonifier
- TEV protease Sigma
- TEV protease Sigma
- w:w a ratio of 1:250
- 6xHIS-SUMO tags were depleted by the addition of Ni-NTA resin (Qiagen) to the sample, purified STING amino acids 140-379 was collected by removal of the resin using a poly-prep column.
- STING AA140-379 was concentrated with a 10,000 Dalton molecular weight cutoff centrifuge concentrator (EMD Millipore) to a final concentration of approximately 10 mg/ml. Protein was aliquoted, flash frozen in liquid nitrogen and stored at -80°C until use.
- DSF Differential scanning fluorometry
- the protein is heated in the presence of a dye that binds to and fluoresces in hydrophobic environments. The protein is thermally denatured by heating resulting in increased dye binding to the unfolded protein and fluorescence.
- the temperature midpoint (T m ) of a proteins denaturation is established by calculating the half maximal value of the denaturation curve.
- the temperature midpoint of the protein in the presence of a ligand is directly related to the affinity of the ligand for the protein and therefore its ability to stabilize the protein at higher temperatures.
- DSF was performed in a 20 ⁇ L reaction comprising 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1:500 dilution of SYPRO Orange (Life Technologies), 1 mg/ml purified STING AA140-379 protein and ligand at a concentration of 1 mM. Samples were placed in hard shell PCR plate (Bio-Rad).
- the fluorescence as a function of temperature was recorded in a CFX 96 real time PCR machine (Bio-Rad) reading on the HEX channel, excitation 450–490, emission 560–580 nm.
- the temperature gradient was from 15-80°C ramping 0.5°C per 15 seconds and recording every 0.5°C. After subtraction of the background signal from a sample lacking protein and ligand.
- the midpoint temperature (Tm) was calculated by fitting the curves of the fluorescence as a function of temperature to a Boltzmann sigmoidal function (Graph Pad Prism).
- fluorine substituted CDN compounds 3’3’-RR-(2’F- A)(2’F-A) and 3’3’-RR-(2’F-G)(2’F-A) showed an increased Tm shift over non fluorine substituted compounds 3’3’-(A)(A), 3’3’-RR-(A)(A), 3’3’-(G)(A) and the endogenous cellular ligand 2’3’-(G)(A).
- CDNs containing (3’,5’)p (3’,5’)p intra-nucleotide phosphate linkages with 2’,2’’-difluoro- dithio-(Rp, Rp) substitutions could bind strongly to a variant that is weekly bound by unmodified CDNs containing (3’,5’)p (3’,5’)p intra-nucleotide phosphate linkages.
- Each of wild type hSTING, HAQ allele hSTING and REF allele hSTING were also used with each of the reference compounds and compounds of the invention as listed in the following Table 4.
- 3’3’-RR-(2’F-G)(2’F-A) showing improved binding over the naturally produced 2’3’- (G)(A).
- Example 7 Compound 25a 3’3’-RS-(2’F-iBuG)(2’F-BzA) 6.8 8.9 5.4
- Example 8 Compound 26 3’3’-RR-(2’F-iBuG)(2’F-A) 13.3 18.4 10.5 * Compound was not compatible with the assay.
- Example 12 3’3’-di-F-CDN derivative molecules activation of human STING
- hSTING(WT) and hSTING (REF) in response to native and fluorine substituted CDN compounds, we measured the activity of an IFN- ⁇ -reporter in human embryonic kidney (HEK) 293T cell lines that stably expressing hSTING(WT) or hSTING(REF).
- HEK human embryonic kidney
- the sequence of the hSTING(REF) allele has been described (Ishikawa, H., and Barber, G.N. (2008). Nature 455, 674–678), and has the NCBI Reference Sequence NP_938023 (Fig 6).
- the sequences of the hSTING(WT) and hSTING(REF) variant alleles were also described in Yi, et al., 2013, PLoS One, 8(10), e77846 (DOI: 10.1371/journal.pone.0077846.
- the parental HEK293T cell line does not express endogenous functional STING, so the responsiveness of exogenously expressed STING alleles to various CDN compounds can be evaluated using stable HEK293T STING-expressing cell lines. These lines were generated with MSCV2.2 retroviral plasmids which contain full length STING cDNA with a c-terminal HA epitope tag cloned upstream of an IRES in frame with green fluorescent protein (GFP).
- GFP green fluorescent protein
- Retroviral vectors were transfected into the amphotropic Phoenix packaging cell line using Lipofectamine (Invitrogen). After two days viral supernatants were harvested and used for transduction of HEK293T cells. [00431] GFP positive cells were sorted using a Mo Flo cell sorter at the Cancer Research Laboratory Flow Cytometry Facility at UC Berkeley.
- 10 4 HEK293T STING cells were seeded in 96-well plates and transiently transfected (using Lipofectamine 2000) with 50 ng of a human IFN- ⁇ reporter plasmid (pLuc-IFN- ⁇ ) expressing the human IFN- ⁇ promoter upstream of a firefly luciferase reporter gene (Fitzgerald et al., 2003, Nature Immunology, 4(5): 491-496) and 10 ng of plasmid expressing a constitutively active thymidine kinase (TK) Renilla reniformis luciferase reporter gene (Promega) for normalization.
- TK thymidine kinase
- each STING cell line was stimulated in 25 ul digitonin buffer (50 mM HEPES, 100 mM KCL, 3 mM MgCl2, 0.1 mM DTT, 85 mM Sucrose, 0.2% BSA, 1 mM ATP, 0.1 mM GTP, 10 ug/ml digitonin) with 2-fold dilutions from 0.1 ⁇ M to 100 ⁇ M of each of the following CDN compounds: cyclic-[A(3’,5’)p-A(3’,5’)p] (CDA, 3’3’-(A)(A)), dithio-(Rp,Rp)- cyclic-[A(3’,5’)p-A(3’,5’)p] (3’3’-RR-(A)(A)),
- IFN ⁇ firefly luciferase reporter gene activity was normalized to TK renilla luciferase gene activity and plotted as fold induction over activity in unstimulated cells (mean +/- s.e.m.).
- the fluorine substituted CDN compound 3’3’-RR-(2’F-A)(2’F-A) induced higher levels of IFN ⁇ reporter activity by hSTING(WT) than the non-fluorine substituted compounds 3’3’- (A)(A) and the dithio-(Rp, Rp) derivative OH reference compound, 3’3’-RR-(A)(A), at the doses tested.
- 3’3’-RR-(2’F-A)(2’F-A) also stimulated higher levels of IFN ⁇ reporter activity by hSTING(WT) when compared to the endogenous cellular ligand 2’3’-(G)(A).
- the fluorine substituted CDN compound 3’3’-RR-(2’F-G)(2’F-A) also strongly induced IFN ⁇ reporter activity by hSTING(WT), and at lower doses, 3’3’-RR-(2’F-G)(2’F-A) more potently induced IFN ⁇ reporter activity by hSTING(WT) than the compound 3’3’- (G)(A).
- HEK 293T cells expressing hSTING responded poorly to stimulation with 3’3’-(A)(A), 3’3’- RR-(A)(A) and 3’3’-(G)(A), all of which contain canonical (3’,5’)p (3’,5’)p intra- nucleotide phosphate linkages.
- fluorine substituted CDN compounds 3’3’-RR-(2’F-A)(2’F-A) and 3’3’-RR-(2’F-G)(2’F-A) strongly induced IFN ⁇ reporter activity, to a level similar to the endogenous cellular ligand 2’3’-(G)(A) that has a
- Example 13 Induction of type I interferon by CDNs [00435] The induction of type I interferon was measured in human primary blood mononuclear cells (hPBMCs) to evaluate the potency of mono- or di-F-CDN compounds as described herein. hPBMCs from two unique donors were used: one donor was homozygous for the wild type (WT) STING allele (STING WT/WT ) and the other donor was homozygous for the so-called reference (REF) STING allele (STING REF/REF ).
- WT wild type
- REF reference
- genomic DNA was isolated from 10 4 hPBMCs using Quick Extract DNA Extraction Solution (Epicentre) and was used to amplify regions of exon 3, 6, and 7 of the human STING gene. Primers for amplification and sequencing were: hSTING exon3F
- Cryopreserved hPBMCs were thawed and 10 6 cells were either left untreated or treated with reference compounds 3’3’-RR-(A)(A), 3’3’-RR-(G)(G), 2’3’-(G)(A), 3’3’-(G)(A) or 3’3’-RR-(G)(A), or mono- or di-F compounds 3’3’-RR-(2’F-A)(2’F-A), 3’3’-RR-(2’F-A)(A), 3’3’-RR-(2’F-G)(2’F-G), 3’3’-RR-(2’F-G)(2’F-A), 3’3’-RR-(2’F- G)(A), and 3’3’-RR-(G)(2’F-A), in RMPI media supplemented with 10% fetal bovine serum, 1% L-
- Target genes included type I interferon (IFN ⁇ ), Th1-associated cytokines (IFN ⁇ , IL-12p40) and NF-kB dependent inflammatory cytokines (TNF ⁇ , IL-6).
- Fig. 7A and 8A dose course
- 7B and 8B (6.25 ⁇ M CDN) show the relative normalized IFN ⁇ expression by hPBMC homozygous for the WT STING allele (Fig. 7A, 7B) or for the REF STING allele (Fig.8A, 8B).
- both the 3’3’-RR-(A)(A) and 3’3’-RR-(2’F-A)(2’F-A) induced similar levels of IFN ⁇ ; however, both of these derivatives induced higher levels of IFN ⁇ transcript when compared to the 3’3’-(A)(A) compound, which was the least potent WT STING agonist in this example.
- 3’3’-RR-(2’F-A)(2’F-A) stimulated higher levels of IFN ⁇ transcript by STING WT/WT hPBMCs when compared to non-canonical 2’3’-(G)(A) naturally produced by mammalian cells.
- 3’3’-RR-(2’F-G)(2’F-A) was the most potent inducer of type I interferon in STING WT/WT hPBMCs, eliciting ⁇ 10-100-fold higher levels of IFN ⁇ when compared to the parent cGAMP compound in the dose range tested.
- STING REF/REF hPBMCs 3’3’-(A)(A), 3’3’-RR-(A)(A) and 3’3’-(G)(A) did not stimulate production of appreciable IFN ⁇ transcript levels at the doses tested.
- 3’3’-RR-(2’F-G)(2’F-A) was an extremely potent stimulator of the REF STING allele, as IFN ⁇ transcript levels were 12- to 70-fold higher when cells were stimulated with 3’3’-RR-(2’F-G)(2’F-A) compared to cells similarly dosed with 2’3’-(G)(A).
- 2’,2’’-diF-RR derivatives of CDA and cGAMP were more potent stimulators of human cells homozygous for WT or REF STING than their corresponding parent compounds or naturally-produced non-canonical 2’3’-(G)(A).
- STING WT/WT hPBMCs with the exception of 3’3’-RR- (G)(G), all of the compounds tested elicited potent, dose-dependent cytokine responses.
- responses in STING WT/WT hPBMCs were highest at 2 hours (IFN ⁇ , TNF ⁇ ) or 6 hours (IFN ⁇ ) stimulation.
- IL-6 and IL-12p40 responses were similar in STING WT/WT hPBMCs at both time points.
- STING REF/REF hPBMCs the naturally-produced mammalian compound 2’3’-(G)(A) induced robust, dose-dependent responses for all of the cytokines that peaked at 6 hours of stimulation.
- 3’3’-RR-(2’F-G)(A), 3’3’-RR- (G)(2’F-A), and 3’3’-RR-(2’F-G)(2’F-A) induced more robust dose-dependent responses of each of the cytokines tested.
- the presence of 2’F substitutions on both the adenine and guanine gave the most robust responses, and a mono 2’F substitution on the adenine base elicited more potent responses than a mono 2’F substitution on the guanine base.
- 3’3’-RR-(2’F-A)(2’F-A) induced more robust responses of all of the cytokines tested, with IFN ⁇ and TNF ⁇ responses peaking after 2 hours stimulation.
- the mono-F substituted 3’3’-RR-(2’F-A)(A) compound was also able to elicit cytokine responses at 6 hours stimulation with 100 ⁇ M of compound.
- the mono- and di-F-CDN compounds generally show a robust cytokine response in hPBMC, in particular the 3’3’-RR-(2’F-A)(2’F-A) and 3’3’-RR-(2’F-G)(2’F-A), demonstrating a more robust response than their OH reference compound in STING REF/REF , with responses similar to, or in some instances more robust than the naturally produced 2’3’-(G)(A).
- THP1-Dual cells a human monocyte cell line containing the hSTING HAQ allele transfected with an IRF-3 inducible secreted luciferase reporter gene (Invivogen) which express secreted luciferase under the control of a promoter comprised of five IFN-stimulated response elements
- IRF-3 inducible secreted luciferase reporter gene Invivogen which express secreted luciferase under the control of a promoter comprised of five IFN-stimulated response elements
- Example 1 Compound 6 3’3’-RR-(2’F-A)(2’F-A) 19
- Example 1 Compound 6a 3’3’-RS-(2’F-A)(2’F-A) 8
- Example 4 Compound 22 3’3’-RR-(A)(2’F-A) 59
- Example 9 Compound 27 3’3’-RR-(2’F-BzA)(2’F-BzA) >150
- Example 1 Compound 7 3’3’-RR-(2’ ⁇ F-A)(2’ ⁇ F-A) 284
- Example 1 Compound 7a 3’3’-RS-(2’ ⁇ F-A)(2’ ⁇ F-A) >150 Reference 3’3’-RR-(G)(G) 75
- 3’3’-RR-(A)(A) and di-F compound 3’3’-RR-(2’F-A)(2’F-A) (5, 50, 100 ⁇ g in a total volume of 40 ⁇ L HBSS), or HBSS vehicle control.
- Treatments began when tumors reached a volume of approximately 100 mm 3 , on day 9 post tumor implantation.
- the CDN compounds were administered by subcutaneous injection into the center of the tumor (IT) using a 27 gauge needle. Mice were bled on day 16 post tumor implantation and PBMCs were isolated by Ficoll gradient (Miltenyi Biotech).
- PBMCs 1 ⁇ 10 5 PBMCs were pre- incubated with anti-CD16/32 monoclonal antibody to block potential nonspecific binding, and labeled with PE-MHC class I pentamer (Proimmune) consisting of murine H-2Kb complexed to SIYRYYGL (SIY, SEQ ID NO: 16) peptide, anti–TCR+-AF700 (H57- 597), anti–CD8-Pacific Blue (53-6.7), anti-CD4-Pacific Orange (RM4-5) (all antibodies from BioLegend) and the Fixable Viability Dye eFluor 450 (eBioscience). Stained cells were analyzed using FACS Versa cytometer with FACSDiva software (BD).
- Example 16 Di-F-CDN derivatives induce potent anti-tumor efficacy in diverse murine tumor models.
- tumor cells were implanted (in 100 ⁇ L PBS) subcutaneously on the lower back of 6-8 week old C57BL/6 female mice.
- Treatments began when tumors reached a volume of approximately 100 mm 3 , on approximately day 14 post tumor implantation (see table below for tumor type, number of cells, and day of IT injection).
- the CDN compounds were administered by IT injection (10 or 100 ⁇ g in a total volume of 40 ⁇ L HBSS), and repeated every three days for a total of three injections.
- the compounds 3’3’-RR-(2’F-A)(2’F-A) and 3’3’-RR-(2’F-G)(2’F-A) and control mice given vehicle only (40 ⁇ L HBSS) were dosed. Tumors were measured twice weekly.
- IFN ⁇ ELISPOT assay with media alone (unstimulated) or with 1 ⁇ M HIVgag p55 CD4 + and CD8 + specific peptides.
- IFN ⁇ ELISPOTs were developed and quantified using a CTL plate reader and ImmunoSpot software.
- E.coli expression construct (human-STING[E149-S379]H232R) was prepared harboring the protein sequence: • MSGLNDIFEAQKIEWHEEKGNFNVAHGLAWSYYIGYLRLILPELQARIRT YNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGD RAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSR EDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRH LRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFSLEHH HH (SEQ ID NO: 17) human-STING[E149-S379]H232R expression in E.coli was induced at 18°C and the protein was subsequently purified using both nickel affinity chromatography and size- exclusion chromatography.
- N-terminal avi-tagged human-STING(E149-S379)H232R protein was immobilized ( ⁇ 2500 RUs) on a streptavidin chip at 15°C in a Biacore T200 (GE Healthcare).
Abstract
Description
Claims
Priority Applications (20)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/556,982 US10449211B2 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating “stimulator of interferon gene”—dependent signalling |
EP16762447.7A EP3268035A4 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
CR20170410A CR20170410A (en) | 2015-03-10 | 2016-03-09 | COMPOSITIONS AND METHODS TO ACTIVATE THE DEPENDENT SIGNALING OF THE "INTERFERON GEN STIMULATOR" |
EA201791999A EA035817B1 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
CN201680022466.9A CN107530415A (en) | 2015-03-10 | 2016-03-09 | For activating the composition and method of the conduction of " interferon gene stimulant " dependent signals |
MX2017011597A MX2017011597A (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling. |
AU2016229146A AU2016229146A1 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
CA2979215A CA2979215A1 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
TNP/2017/000375A TN2017000375A1 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
SG11201706756VA SG11201706756VA (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
JP2017547400A JP6692826B2 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activation of "interferon gene stimulator" dependent signaling |
BR112017018908-9A BR112017018908A2 (en) | 2015-03-10 | 2016-03-09 | compositions and methods for activating interferon gene stimulator-dependent signaling |
KR1020177028534A KR20170129802A (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulating factors" -dependent signaling of interferon genes |
MYPI2017703039A MY190404A (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
IL254047A IL254047A0 (en) | 2015-03-10 | 2017-08-17 | Compositions and methods for activating " stimulator of interferon gene" -dependent signalling |
PH12017501506A PH12017501506A1 (en) | 2015-03-10 | 2017-08-18 | Compositions and methods for activating``stimulator of interferon gene`` -dependent signalling |
CONC2017/0009104A CO2017009104A2 (en) | 2015-03-10 | 2017-09-08 | Dinucleotide derivatives of bis-2’-fluoro-bis-3’-5’-cyclic purine |
HK18106549.3A HK1247089A1 (en) | 2015-03-10 | 2018-05-21 | Copositions and methods for activing "stimulator of interferon gene"-dependent signalling |
HK18108617.6A HK1248603A1 (en) | 2015-03-10 | 2018-07-04 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
US16/659,093 US11040053B2 (en) | 2015-03-10 | 2019-10-21 | Compositions and methods for activating “stimulator of interferon gene”13 dependent signalling |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562131235P | 2015-03-10 | 2015-03-10 | |
US62/131,235 | 2015-03-10 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/556,982 A-371-Of-International US10449211B2 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating “stimulator of interferon gene”—dependent signalling |
US16/659,093 Continuation US11040053B2 (en) | 2015-03-10 | 2019-10-21 | Compositions and methods for activating “stimulator of interferon gene”13 dependent signalling |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2016145102A1 true WO2016145102A1 (en) | 2016-09-15 |
Family
ID=56879700
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2016/021597 WO2016145102A1 (en) | 2015-03-10 | 2016-03-09 | Compositions and methods for activating "stimulator of interferon gene" -dependent signalling |
Country Status (30)
Country | Link |
---|---|
US (2) | US10449211B2 (en) |
EP (1) | EP3268035A4 (en) |
JP (1) | JP6692826B2 (en) |
KR (1) | KR20170129802A (en) |
CN (1) | CN107530415A (en) |
AR (1) | AR103894A1 (en) |
AU (1) | AU2016229146A1 (en) |
BR (1) | BR112017018908A2 (en) |
CA (1) | CA2979215A1 (en) |
CL (1) | CL2017002272A1 (en) |
CO (1) | CO2017009104A2 (en) |
CR (1) | CR20170410A (en) |
DO (1) | DOP2017000205A (en) |
EA (1) | EA035817B1 (en) |
EC (1) | ECSP17064523A (en) |
GT (1) | GT201700200A (en) |
HK (2) | HK1247089A1 (en) |
IL (1) | IL254047A0 (en) |
JO (1) | JO3746B1 (en) |
MA (1) | MA42146A (en) |
MX (1) | MX2017011597A (en) |
MY (1) | MY190404A (en) |
PE (1) | PE20171448A1 (en) |
PH (1) | PH12017501506A1 (en) |
SG (1) | SG11201706756VA (en) |
SV (1) | SV2017005529A (en) |
TN (1) | TN2017000375A1 (en) |
TW (1) | TWI706958B (en) |
UY (1) | UY36579A (en) |
WO (1) | WO2016145102A1 (en) |
Cited By (94)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9718848B2 (en) | 2015-12-03 | 2017-08-01 | Glaxosmithkline Intellectual Property Development Limited | Compounds |
WO2018020476A1 (en) | 2016-07-29 | 2018-02-01 | Aduro Biotech Holdings, Europe B.V. | Anti-pd-1 antibodies |
WO2018060323A1 (en) | 2016-09-30 | 2018-04-05 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds |
WO2018065360A1 (en) | 2016-10-07 | 2018-04-12 | Biolog Life Science Institute Forschungslabor Und Biochemica-Vertrieb Gmbh | Cyclic dinucleotides containing benzimidazole, method for the production of same, and use of same to activate stimulator of interferon genes (sting)-dependent signaling pathways |
WO2018100558A2 (en) | 2016-12-01 | 2018-06-07 | Takeda Pharmaceutical Company Limited | Cyclic dinucleotide |
US10047115B2 (en) | 2015-01-29 | 2018-08-14 | Glaxosmithkline Intellectual Property Development Limited | Cyclic dinucleotides useful for the treatment of inter alia cancer |
WO2018152453A1 (en) | 2017-02-17 | 2018-08-23 | Eisai R&D Management Co., Ltd. | Cyclic di-nucleotides derivative for the treatment of cancer |
WO2018172206A1 (en) | 2017-03-22 | 2018-09-27 | Boehringer Ingelheim International Gmbh | Modified cyclic dinucleotide compounds |
WO2018190719A2 (en) | 2017-04-13 | 2018-10-18 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
US10106574B2 (en) | 2015-08-13 | 2018-10-23 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as sting agonists |
WO2018198076A1 (en) | 2017-04-28 | 2018-11-01 | Aduro Biotech, Inc. | Bis 2'-5'-rr-(3'f-a)(3'f-a) cyclic dinucleotide compound and uses thereof |
WO2018200812A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Antibody conjugates comprising sting agonist |
WO2018222711A2 (en) | 2017-05-30 | 2018-12-06 | Bristol-Myers Squibb Company | Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent |
WO2019043634A3 (en) * | 2017-08-30 | 2019-04-11 | Beijing Xuanyi Pharmasciences Co., Ltd. | Cyclic di-nucleotides as stimulator of interferon genes modulators |
WO2019092660A1 (en) | 2017-11-10 | 2019-05-16 | Takeda Pharmaceutical Company Limited | Sting modulator compounds, and methods of making and using |
WO2019172394A1 (en) * | 2018-03-09 | 2019-09-12 | 国立研究開発法人科学技術振興機構 | β-MODIFIED PHOSPHORIC ACID COMPOUND PRECURSOR, β-MODIFIED PHOSPHORIC ACID COMPOUND, REACTION INHIBITOR, AND MEDICINE INCLUDING SAME, AND REACTION INHIBITION METHOD |
US10414747B2 (en) | 2016-10-04 | 2019-09-17 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene compounds as sting agonists |
WO2019183578A1 (en) | 2018-03-23 | 2019-09-26 | Codiak Biosciences, Inc. | Extracellular vesicles comprising sting-agonist |
WO2019180683A1 (en) | 2018-03-23 | 2019-09-26 | Takeda Pharmaceutical Company Limited | Sting modulator compounds with sulfamate linkages, and methods of making and using |
WO2019185476A1 (en) | 2018-03-27 | 2019-10-03 | Boehringer Ingelheim International Gmbh | Modified cyclic dinucleotide compounds |
WO2019185477A1 (en) | 2018-03-27 | 2019-10-03 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds containing 2-aza-hypoxanthine or 6h-pytazolo[1,5-d][1,2,4]triazin-7-one as sting agonists |
WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
US10450341B2 (en) | 2014-06-04 | 2019-10-22 | Glaxosmithkline Intellectual Property Development Limited | Cyclic di-nucleotides as modulators of STING |
WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
WO2019232392A1 (en) | 2018-06-01 | 2019-12-05 | Eisai R&D Management Co., Ltd. | Methods for the treatment of bladder cancer |
US10519188B2 (en) | 2016-03-18 | 2019-12-31 | Immunesensor Therapeutics, Inc. | Cyclic di-nucleotide compounds and methods of use |
EP3481402A4 (en) * | 2016-07-06 | 2020-01-22 | Sperovie Biosciences, Inc. | Compounds, compositions, and methods for the treatment of disease |
WO2020041720A1 (en) | 2018-08-24 | 2020-02-27 | Codiak Biosciences, Inc. | Extracellular vesicles targeting dendritic cells and uses thereof |
WO2020050406A1 (en) | 2018-09-06 | 2020-03-12 | 第一三共株式会社 | Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof |
WO2020057546A1 (en) | 2018-09-21 | 2020-03-26 | 上海迪诺医药科技有限公司 | Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application |
WO2020065408A1 (en) | 2018-09-27 | 2020-04-02 | Pierre Fabre Medicament | Sulfomaleimide-based linkers and corresponding conjugates |
WO2020092617A1 (en) | 2018-10-31 | 2020-05-07 | Novartis Ag | Dc-sign antibody conjugates comprising sting agonists |
WO2020092633A1 (en) | 2018-10-30 | 2020-05-07 | Vanderbilt University | Graft copolymers, methods of forming graft copolymers, and methods of use thereof |
US10696985B1 (en) | 2016-06-06 | 2020-06-30 | Vanderbilt University | Reversibly crosslinked endosomolytic polymer vesicles for cytosolic drug delivery |
WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
WO2020191361A2 (en) | 2019-03-21 | 2020-09-24 | Codiak Biosciences, Inc. | Extracellular vesicles for vaccine delivery |
WO2020191377A1 (en) | 2019-03-21 | 2020-09-24 | Codiak Biosciences, Inc. | Extracellular vesicle conjugates and uses thereof |
US10793557B2 (en) | 2018-04-03 | 2020-10-06 | Merck Sharp & Dohme Corp. | Sting agonist compounds |
JP2020532529A (en) * | 2017-08-31 | 2020-11-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | Cyclic dinucleotide as an anticancer drug |
JP2020532542A (en) * | 2017-08-31 | 2020-11-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | Cyclic dinucleotide as an anticancer drug |
WO2020227421A1 (en) * | 2019-05-09 | 2020-11-12 | Aligos Therapeutics, Inc. | Modified cyclic dinucleoside compounds as sting modulators |
WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
EP3558327A4 (en) * | 2016-12-21 | 2020-12-09 | Fred Hutchinson Cancer Research Center | Scaffolds to treat solid tumor cells and escape variants |
WO2021003445A1 (en) | 2019-07-03 | 2021-01-07 | Codiak Biosciences, Inc. | Extracellular vesicles targeting t cells and uses thereof |
WO2021030251A1 (en) | 2019-08-12 | 2021-02-18 | Purinomia Biotech, Inc. | Methods and compositions for promoting and potentiating t-cell mediated immune responses through adcc targeting of cd39 expressing cells |
US10933078B2 (en) | 2017-02-21 | 2021-03-02 | Board Of Regents, The University Of Texas System | Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling |
WO2021041532A1 (en) | 2019-08-26 | 2021-03-04 | Dana-Farber Cancer Institute, Inc. | Use of heparin to promote type 1 interferon signaling |
WO2021062290A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Methods of producing extracellular vesicles |
WO2021062060A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Sting agonist comprising exosomes combined with il-12 displaying exosomes for treating a tumour |
WO2021062317A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Extracellular vesicle compositions |
WO2021062058A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Sting agonist comprising exosomes for treating neuroimmunological disorders |
US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
WO2021074695A1 (en) | 2019-10-16 | 2021-04-22 | Avacta Life Sciences Limited | PD-L1 INHIBITOR - TGFβ INHIBITOR BISPECIFIC DRUG MOIETIES. |
US11098077B2 (en) | 2016-07-05 | 2021-08-24 | Chinook Therapeutics, Inc. | Locked nucleic acid cyclic dinucleotide compounds and uses thereof |
US11110106B2 (en) | 2018-10-29 | 2021-09-07 | Venenum Biodesign, LLC | Sting agonists for treating bladder cancer and solid tumors |
WO2021177438A1 (en) | 2020-03-06 | 2021-09-10 | 第一三共株式会社 | Antibody-drug conjugate including novel cyclic dinucleotide derivative |
US11116835B2 (en) | 2017-05-10 | 2021-09-14 | Fred Hutchinson Cancer Research Center | Epstein Barr virus antibodies, vaccines, and uses of the same |
WO2021189047A2 (en) | 2020-03-20 | 2021-09-23 | Codiak Biosciences, Inc. | Extracellular vesicles for therapy |
WO2021206158A1 (en) | 2020-04-10 | 2021-10-14 | 小野薬品工業株式会社 | Method of cancer therapy |
US11161864B2 (en) | 2018-10-29 | 2021-11-02 | Venenum Biodesign, LLC | Sting agonists |
WO2021237100A1 (en) | 2020-05-21 | 2021-11-25 | Codiak Biosciences, Inc. | Methods of targeting extracellular vesicles to lung |
US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
WO2022050300A1 (en) | 2020-09-02 | 2022-03-10 | 第一三共株式会社 | NOVEL ENDO-β-N-ACETYLGLUCOSAMINIDASE |
US11285131B2 (en) | 2017-08-04 | 2022-03-29 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene STING agonists for cancer treatment |
WO2022066898A2 (en) | 2020-09-23 | 2022-03-31 | Codiak Biosciences, Inc. | Methods of producing extracellular vesicles |
WO2022066883A1 (en) | 2020-09-23 | 2022-03-31 | Codiak Biosciences, Inc. | Extracellular vesicles comprising kras antigens and uses thereof |
US11312772B2 (en) | 2017-08-04 | 2022-04-26 | Merck Sharp & Dohme Corp. | Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment |
WO2022083584A1 (en) | 2020-10-20 | 2022-04-28 | 泰励生物科技(上海)有限公司 | Multifunctional cyclic dinucleotide and use thereof |
WO2022133288A1 (en) | 2020-12-17 | 2022-06-23 | Trustees Of Tufts College | Fap-activated radiotheranostics, and uses related thereto |
RU2776060C2 (en) * | 2017-12-15 | 2022-07-13 | Янссен Байотек, Инк. | Cyclic dinucleotides as sting agonists |
WO2022163846A1 (en) | 2021-02-01 | 2022-08-04 | 第一三共株式会社 | Novel method for producing antibody-immunostimulator conjugate |
US11453697B1 (en) | 2015-08-13 | 2022-09-27 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
US11466047B2 (en) | 2017-05-12 | 2022-10-11 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
WO2022234003A1 (en) | 2021-05-07 | 2022-11-10 | Avacta Life Sciences Limited | Cd33 binding polypeptides with stefin a protein |
US11566061B2 (en) | 2017-01-05 | 2023-01-31 | Fred Hutchinson Cancer Center | Systems and methods to improve vaccine efficacy |
US11584774B2 (en) | 2017-09-11 | 2023-02-21 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
WO2023056468A1 (en) | 2021-09-30 | 2023-04-06 | Codiak Biosciences, Inc. | Extracellular vesicle comprising cholesterol tagged sting-agonist |
WO2023057567A1 (en) | 2021-10-07 | 2023-04-13 | Avacta Life Sciences Limited | Pd-l1 binding affimers |
US11638716B2 (en) | 2017-08-31 | 2023-05-02 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
US11685761B2 (en) | 2017-12-20 | 2023-06-27 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
US11691990B2 (en) | 2018-08-16 | 2023-07-04 | Eisai R&D Management Co., Ltd | Salts of compounds and crystals thereof |
US11702430B2 (en) | 2018-04-03 | 2023-07-18 | Merck Sharp & Dohme Llc | Aza-benzothiophene compounds as STING agonists |
US11707531B2 (en) | 2017-09-11 | 2023-07-25 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
US11725024B2 (en) | 2020-11-09 | 2023-08-15 | Takeda Pharmaceutical Company Limited | Antibody drug conjugates |
WO2023170606A1 (en) | 2022-03-08 | 2023-09-14 | Alentis Therapeutics Ag | Use of anti-claudin-1 antibodies to increase t cell availability |
WO2023218243A1 (en) | 2022-05-12 | 2023-11-16 | Avacta Life Sciences Limited | Lag-3/pd-l1 binding fusion proteins |
US11872195B2 (en) | 2016-04-14 | 2024-01-16 | Fred Hutchinson Cancer Center | Compositions and methods to program therapeutic cells using targeted nucleic acid nanocarriers |
US11874276B2 (en) | 2018-04-05 | 2024-01-16 | Dana-Farber Cancer Institute, Inc. | STING levels as a biomarker for cancer immunotherapy |
US11883485B2 (en) | 2018-08-29 | 2024-01-30 | Fred Hutchinson Cancer Center | Methods of eliciting antibodies that bind to full-length glycosylated HIV-1 Env using multimerized Env cores |
US11890303B2 (en) | 2013-01-14 | 2024-02-06 | Fred Hutchinson Cancer Center | Compositions and methods for delivery of immune cells to treat un-resectable or non-resected tumor cells and tumor relapse |
Families Citing this family (19)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
BR112015013440B1 (en) * | 2012-12-13 | 2020-12-08 | Aduro Biotech, Inc | compositions comprising cyclic purine dinucleotides with stereochemistry |
JO3746B1 (en) | 2015-03-10 | 2021-01-31 | Aduro Biotech Inc | Compositions and methods for activating “stimulator of interferon gene”-dependent signalling |
JP2018534295A (en) | 2015-10-28 | 2018-11-22 | アドゥロ バイオテック,インク. | Compositions and methods for activating "interferon gene stimulating factor" dependent signaling |
US20180369268A1 (en) * | 2015-12-16 | 2018-12-27 | Aduro Biotech, Inc. | Methods for identifying inhibitors of "stimulator of interferon gene"- dependent interferon production |
PE20181330A1 (en) | 2016-01-11 | 2018-08-20 | Innate Tumor Immunity Inc | CYCLIC DINUCLEOTIDES TO TREAT CONDITIONS ASSOCIATED WITH ACTIVITY OF THE INTERFERON GENES STIMULATOR (STING) SUCH AS CANCER |
EP3475292A1 (en) * | 2016-06-24 | 2019-05-01 | Biogen MA Inc. | Synthesis of thiolated oligonucleotides without a capping step |
JP2018090562A (en) * | 2016-12-01 | 2018-06-14 | 武田薬品工業株式会社 | Cyclic dinucleotide |
TW202028212A (en) | 2018-10-11 | 2020-08-01 | 日商小野藥品工業股份有限公司 | Sting agonist compound |
CN114173824A (en) | 2019-05-10 | 2022-03-11 | 武田药品工业株式会社 | Antibody drug conjugates |
AU2020310853A1 (en) | 2019-07-05 | 2022-01-27 | Tambo, Inc. | Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy |
TW202114710A (en) * | 2019-07-25 | 2021-04-16 | 英屬開曼群島商百濟神州有限公司 | Cyclic dinucleotides as sting agonists |
CN110508327B (en) * | 2019-09-19 | 2021-01-19 | 南京林业大学 | Catalyst system for asymmetric Henry reaction constructed based on benzimidazole pyridine heterocyclic derivative of rosin and application of catalyst system |
US20230114434A1 (en) | 2020-03-13 | 2023-04-13 | Codiak Biosciences, Inc. | Extracellular vesicles for treating neurological disorders |
US11857618B2 (en) | 2020-04-17 | 2024-01-02 | Emory University | Boosting immunogenicity of vaccines using saponins and agonists of the intracellular stimulator of interferon genes pathway |
WO2021216572A1 (en) | 2020-04-20 | 2021-10-28 | Massachusetts Institute Of Technology | Lipid compositions for delivery of sting agonist compounds and uses thereof |
CN111592570B (en) * | 2020-05-15 | 2022-04-29 | 清华大学 | Novel STING agonists, methods of preparation and uses thereof |
US11938152B2 (en) | 2020-08-06 | 2024-03-26 | Kedar N Prasad | High-dose antioxidants in cancer treatment |
CN111920946B (en) * | 2020-08-07 | 2021-05-28 | 合肥诺为尔基因科技服务有限公司 | Cyclic dinucleotide modified aluminum nanoparticle vaccine adjuvant-delivery system and SARS-CoV-2 subunit vaccine based on the same |
JP2023537066A (en) | 2020-08-07 | 2023-08-30 | タンボ・インコーポレイテッド | Trans-cyclooctene bioorthogonal agents and their use in cancer and immunotherapy |
Citations (112)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0296122A2 (en) | 1987-06-17 | 1988-12-21 | Sandoz Ag | Cyclosporins and their use as pharmaceuticals |
US4978672A (en) | 1986-03-07 | 1990-12-18 | Ciba-Geigy Corporation | Alpha-heterocyclc substituted tolunitriles |
US5637483A (en) | 1991-10-04 | 1997-06-10 | Whitehead Institute For Biomedical Research | Irradiated tumor cell vaccine engineered to express GM-CSF |
US5698432A (en) | 1991-05-17 | 1997-12-16 | Retroscreen Ltd. | Vaccines and methods for their production |
WO1997049395A1 (en) | 1996-06-25 | 1997-12-31 | Novartis-Erfindungen Verwaltungsgesellschaft M.B.H. | Substituted 3,5-diphenyl-1,2,4-triazoles and their use as pharmaceutical metal chelators |
WO1998035958A1 (en) | 1997-02-13 | 1998-08-20 | Novartis Ag | Phthalazines with angiogenesis inhibiting activity |
US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
WO1999003854A1 (en) | 1997-07-18 | 1999-01-28 | Novartis Ag | Crystal modification of a n-phenyl-2-pyrimidineamine derivative, processes for its manufacture and its use |
WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
US5904920A (en) | 1991-10-04 | 1999-05-18 | Whitehead Institute For Biomedical Research | Regulation of systemic immune responses utilizing cytokines and antigens |
WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
US5985290A (en) | 1995-12-28 | 1999-11-16 | Johns Hopkins University School Of Medicine | Purified pancreatic tumor cell lines and related compositions and method |
US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
US6277368B1 (en) | 1996-07-25 | 2001-08-21 | The Regents Of The University Of California | Cancer immunotherapy using autologous tumor cells combined with cells expressing a membrane cytokine |
WO2002010192A2 (en) | 2000-08-01 | 2002-02-07 | Novartis Ag | Somatostatin analogues |
US6464973B1 (en) | 1998-02-02 | 2002-10-15 | Johns Hopkins University, School Of Medicine | Universal GM-CSF expressing bystander human K562 cell line |
WO2003037347A1 (en) | 2001-10-30 | 2003-05-08 | Novartis Ag | Staurosporine derivatives as inhibitors of flt3 receptor tyrosine kinase activity |
WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
WO2004072051A1 (en) | 2003-02-11 | 2004-08-26 | Vernalis (Cambridge) Limited | Isoxazole compounds as inhibitors of heat shock proteins |
WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
WO2005039549A1 (en) | 2003-10-27 | 2005-05-06 | Novartis Ag | Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation |
WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
WO2005073224A2 (en) | 2004-01-23 | 2005-08-11 | Amgen Inc | Quinoline quinazoline pyridine and pyrimidine counds and their use in the treatment of inflammation angiogenesis and cancer |
WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
WO2007024945A1 (en) | 2005-08-25 | 2007-03-01 | Novartis Ag | Condensed imidazolo derivatives for the inhibition of aldosterone synthase and aromatase |
WO2007030377A1 (en) | 2005-08-30 | 2007-03-15 | Novartis Ag | Substituted benzimidazoles as kinase inhibitors |
WO2007054279A2 (en) | 2005-11-08 | 2007-05-18 | Helmholtz-Zentrum für Infektionsforschung GmbH | Cyclic-dinucleotides and its conjugates as adjuvants and their uses in pharmaceutical compositions |
WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
WO2007131201A2 (en) | 2006-05-05 | 2007-11-15 | Irm Llc | Compounds and compositions as hedgehog pathway modulators |
WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
US7592326B2 (en) | 2004-03-15 | 2009-09-22 | Karaolis David K R | Method for stimulating the immune, inflammatory or neuroprotective response |
WO2009115562A2 (en) | 2008-03-19 | 2009-09-24 | Novartis Ag | Crystalline forms and two solvated forms of 4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1h-benzimidazol-2-yl]quinolin-2(1h)-one lactic acid salts |
US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
WO2010002655A2 (en) | 2008-06-25 | 2010-01-07 | Irm Llc | Compounds and compositions as kinase inhibitors |
WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
WO2010007120A1 (en) | 2008-07-18 | 2010-01-21 | Novartis Ag | Pyridazine derivatives as smo inhibitors |
US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
WO2010026124A1 (en) | 2008-09-02 | 2010-03-11 | Novartis Ag | Picolinamide derivatives as kinase inhibitors |
WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
US7709458B2 (en) | 2004-03-15 | 2010-05-04 | David K. R. Karaolis | Method for inhibiting cancer cell proliferation or increasing cancer cell apoptosis |
WO2010060937A2 (en) | 2008-11-28 | 2010-06-03 | Novartis Ag | Hsp90 inhibitor combinations |
US20100150946A1 (en) | 2008-08-28 | 2010-06-17 | Cell Genesys, Inc. | Methods and Compositions for Treating Prostate Cancer or Inducing a Humoral Immune Response Against Prostate Cancer |
WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
WO2010101849A1 (en) | 2009-03-02 | 2010-09-10 | Irm Llc | N- (hetero)aryl, 2- (hetero)aryl-substituted acetamides for use as wnt signaling modulators |
WO2010104833A1 (en) | 2009-03-10 | 2010-09-16 | Intelligent Implant Systems | Active bone screw |
US20100310602A1 (en) | 2009-06-05 | 2010-12-09 | Infectious Disease Research Institute | Synthetic glucopyranosyl lipid adjuvants |
WO2010149755A1 (en) | 2009-06-26 | 2010-12-29 | Novartis Ag | 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17 |
US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
WO2011101409A1 (en) | 2010-02-19 | 2011-08-25 | Novartis Ag | Pyrrolopyrimidine compounds as inhibitors of cdk4/6 |
WO2011155607A1 (en) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | Anti-tim-3 antibody |
WO2012004367A1 (en) | 2010-07-09 | 2012-01-12 | N.V. Organon | Agonistic antibody to cd27 |
US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
WO2012022814A1 (en) | 2010-08-20 | 2012-02-23 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (her3) |
US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
WO2013124826A1 (en) | 2012-02-24 | 2013-08-29 | Novartis Ag | Oxazolidin- 2 -one compounds and uses thereof as pi3ks inhibitors |
US8552003B2 (en) | 2006-08-02 | 2013-10-08 | Novartis Ag | (S)-N-((S)-1-cyclohexyl-2-{(S)-2-[4-4-(4-fluorobenzoyl)-thiazol-2-yl]pyrrolidin-1-yl}-2-oxoethyl)-2-methylamino-propionamide, or pharmaceutically acceptable salts thereof and their uses |
US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
US8562997B2 (en) | 2008-01-15 | 2013-10-22 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of treating acute myeloid leukemia by blocking CD47 |
US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
WO2013171640A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171642A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171639A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171641A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1 |
US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
US8728476B2 (en) | 2008-04-23 | 2014-05-20 | Stichting Sanquin Bloedvoorziening | Compositions and methods to enhance the immune system |
WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
WO2014093936A1 (en) | 2012-12-13 | 2014-06-19 | Aduro Biotech, Inc. | Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use |
WO2014141104A1 (en) | 2013-03-14 | 2014-09-18 | Novartis Ag | 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh |
WO2014151616A1 (en) | 2013-03-14 | 2014-09-25 | Novartis Ag | Biaryl amide compounds as kinase inhibitors |
WO2014160160A2 (en) | 2013-03-13 | 2014-10-02 | Novartis Ag | Antibody drug conjugates |
US8895705B2 (en) | 2009-03-02 | 2014-11-25 | Bionovion Holding B.V. | Antibodies against a proliferating inducing ligand (APRIL) and methods of use thereof |
WO2014189805A1 (en) | 2013-05-18 | 2014-11-27 | Auro Biotech, Inc. | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
WO2015066188A1 (en) | 2013-11-01 | 2015-05-07 | Novartis Ag | Aminoheteroaryl benzamides as kinase inhibitors |
US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
WO2016096174A1 (en) | 2014-12-16 | 2016-06-23 | Invivogen | Fluorinated cyclic dinucleotides for cytokine induction |
Family Cites Families (30)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB2257704B (en) | 1991-07-18 | 1995-03-01 | Erba Carlo Spa | Cyclic oligonucleotides phosphorothioates |
GB9721961D0 (en) | 1997-10-16 | 1997-12-17 | Glaxo Group Ltd | Novel molecules |
PE20020354A1 (en) | 2000-09-01 | 2002-06-12 | Novartis Ag | HYDROXAMATE COMPOUNDS AS HISTONE-DESACETILASE (HDA) INHIBITORS |
AU2004275696B2 (en) | 2003-07-28 | 2010-02-18 | Karagen Pharmaceuticals, Inc. | Method for attenuating virulence of microbial pathogens and for inhibiting microbial biofilm formation |
KR101532256B1 (en) | 2006-11-22 | 2015-06-29 | 인사이트 코포레이션 | Imidazotriazines and imidazopyrimidines as kinase inhibitors |
KR101364277B1 (en) | 2006-12-08 | 2014-02-21 | 아이알엠 엘엘씨 | Compounds as protein kinase inhibitors |
MX2009009304A (en) | 2007-03-01 | 2009-11-18 | Novartis Ag | Pim kinase inhibitors and methods of their use. |
HUE034716T2 (en) | 2008-05-21 | 2018-02-28 | Incyte Holdings Corp | Salts of 2-fluoro-n-methyl-4-[7-(quinolin-6-yl-methyl)- imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide and processes related to preparing the same |
EP2405758B1 (en) | 2009-03-09 | 2016-04-27 | Molecular Express, Inc. | Methods and compositions for liposomal formulation of antigens and uses thereof |
US20120178710A1 (en) | 2009-07-01 | 2012-07-12 | Rutgers, The State University Of New Jersey | Synthesis of cyclic diguanosine monophosphate and thiophosphate analogs thereof |
CN102199183B (en) | 2010-03-26 | 2013-12-18 | 北京大学 | C-di-GMP, analogues thereof and preparation method thereof |
JP5998370B2 (en) | 2010-11-17 | 2016-09-28 | アデュロ バイオテック | Methods and compositions for eliciting an immune response against EGFRVIII |
EP2844756A4 (en) | 2012-04-30 | 2016-02-24 | Glen N Barber | Modulating immune responses |
CN104508149A (en) | 2012-07-27 | 2015-04-08 | 诺华股份有限公司 | Prediction of treatment response to JAK/STAT inhibitor |
US9090646B2 (en) | 2012-12-05 | 2015-07-28 | Rutgers, The State University Of New Jersey | Biotinylated compounds |
WO2014179335A1 (en) | 2013-04-29 | 2014-11-06 | Memorial Sloan Kettering Cancer Center | Compositions and methods for altering second messenger signaling |
WO2014179760A1 (en) | 2013-05-03 | 2014-11-06 | The Regents Of The University Of California | Cyclic di-nucleotide induction of type i interferon |
US9549944B2 (en) | 2013-05-18 | 2017-01-24 | Aduro Biotech, Inc. | Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling |
WO2014189806A1 (en) | 2013-05-18 | 2014-11-27 | Aduro Biotech, Inc. | Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling |
US10176292B2 (en) | 2013-07-31 | 2019-01-08 | Memorial Sloan-Kettering Cancer Center | STING crystals and modulators |
EP3071209A4 (en) | 2013-11-19 | 2017-08-16 | The University of Chicago | Use of sting agonist as cancer treatment |
US10092644B2 (en) | 2013-11-22 | 2018-10-09 | Brock University | Use of fluorinated cyclic dinucleotides as oral vaccine adjuvants |
PE20170198A1 (en) | 2014-06-04 | 2017-04-08 | Glaxosmithkline Ip Dev Ltd | CYCLIC DINUCLEOTIDES AS STING MODULATORS |
EP3233191A1 (en) | 2014-12-16 | 2017-10-25 | Invivogen | Combined use of a chemotherapeutic agent and a cyclic dinucleotide for cancer treatment |
GB201501462D0 (en) | 2015-01-29 | 2015-03-18 | Glaxosmithkline Ip Dev Ltd | Novel compounds |
JO3746B1 (en) | 2015-03-10 | 2021-01-31 | Aduro Biotech Inc | Compositions and methods for activating “stimulator of interferon gene”-dependent signalling |
WO2017027645A1 (en) | 2015-08-13 | 2017-02-16 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as sting agonists |
RU2020113165A (en) | 2015-12-03 | 2020-06-09 | Глэксосмитклайн Интеллекчуал Проперти Дивелопмент Лимитед | CYCLIC PURINE DINUCLEOTIDES AS STING MODULATORS |
WO2017123657A1 (en) | 2016-01-11 | 2017-07-20 | Gary Glick | Cyclic dinucleotides for treating conditions associated with sting activity such as cancer |
PE20181330A1 (en) | 2016-01-11 | 2018-08-20 | Innate Tumor Immunity Inc | CYCLIC DINUCLEOTIDES TO TREAT CONDITIONS ASSOCIATED WITH ACTIVITY OF THE INTERFERON GENES STIMULATOR (STING) SUCH AS CANCER |
-
2016
- 2016-03-09 JO JOP/2016/0039A patent/JO3746B1/en active
- 2016-03-09 WO PCT/US2016/021597 patent/WO2016145102A1/en active Application Filing
- 2016-03-09 TW TW105107250A patent/TWI706958B/en not_active IP Right Cessation
- 2016-03-09 JP JP2017547400A patent/JP6692826B2/en not_active Expired - Fee Related
- 2016-03-09 TN TNP/2017/000375A patent/TN2017000375A1/en unknown
- 2016-03-09 AU AU2016229146A patent/AU2016229146A1/en not_active Abandoned
- 2016-03-09 CA CA2979215A patent/CA2979215A1/en not_active Abandoned
- 2016-03-09 CR CR20170410A patent/CR20170410A/en unknown
- 2016-03-09 MY MYPI2017703039A patent/MY190404A/en unknown
- 2016-03-09 BR BR112017018908-9A patent/BR112017018908A2/en not_active IP Right Cessation
- 2016-03-09 KR KR1020177028534A patent/KR20170129802A/en not_active Application Discontinuation
- 2016-03-09 CN CN201680022466.9A patent/CN107530415A/en active Pending
- 2016-03-09 EA EA201791999A patent/EA035817B1/en unknown
- 2016-03-09 SG SG11201706756VA patent/SG11201706756VA/en unknown
- 2016-03-09 PE PE2017001512A patent/PE20171448A1/en unknown
- 2016-03-09 EP EP16762447.7A patent/EP3268035A4/en not_active Withdrawn
- 2016-03-09 AR ARP160100626A patent/AR103894A1/en unknown
- 2016-03-09 MX MX2017011597A patent/MX2017011597A/en unknown
- 2016-03-09 US US15/556,982 patent/US10449211B2/en not_active Expired - Fee Related
- 2016-03-09 MA MA042146A patent/MA42146A/en unknown
- 2016-03-10 UY UY0001036579A patent/UY36579A/en not_active Application Discontinuation
-
2017
- 2017-08-17 IL IL254047A patent/IL254047A0/en unknown
- 2017-08-18 PH PH12017501506A patent/PH12017501506A1/en unknown
- 2017-09-06 DO DO2017000205A patent/DOP2017000205A/en unknown
- 2017-09-07 CL CL2017002272A patent/CL2017002272A1/en unknown
- 2017-09-08 CO CONC2017/0009104A patent/CO2017009104A2/en unknown
- 2017-09-08 GT GT201700200A patent/GT201700200A/en unknown
- 2017-09-08 SV SV2017005529A patent/SV2017005529A/en unknown
- 2017-10-02 EC ECIEPI201764523A patent/ECSP17064523A/en unknown
-
2018
- 2018-05-21 HK HK18106549.3A patent/HK1247089A1/en unknown
- 2018-07-04 HK HK18108617.6A patent/HK1248603A1/en unknown
-
2019
- 2019-10-21 US US16/659,093 patent/US11040053B2/en active Active
Patent Citations (131)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4978672A (en) | 1986-03-07 | 1990-12-18 | Ciba-Geigy Corporation | Alpha-heterocyclc substituted tolunitriles |
EP0296122A2 (en) | 1987-06-17 | 1988-12-21 | Sandoz Ag | Cyclosporins and their use as pharmaceuticals |
US5698432A (en) | 1991-05-17 | 1997-12-16 | Retroscreen Ltd. | Vaccines and methods for their production |
US5904920A (en) | 1991-10-04 | 1999-05-18 | Whitehead Institute For Biomedical Research | Regulation of systemic immune responses utilizing cytokines and antigens |
US5637483A (en) | 1991-10-04 | 1997-06-10 | Whitehead Institute For Biomedical Research | Irradiated tumor cell vaccine engineered to express GM-CSF |
US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US5985290A (en) | 1995-12-28 | 1999-11-16 | Johns Hopkins University School Of Medicine | Purified pancreatic tumor cell lines and related compositions and method |
US6033674A (en) | 1995-12-28 | 2000-03-07 | Johns Hopkins University School Of Medicine | Method of treating cancer with a tumor cell line having modified cytokine expression |
US6350445B1 (en) | 1995-12-28 | 2002-02-26 | Johns Hopkins University School Of Medicine | Method of treating cancer with a tumor cell line having modified cytokine expression |
WO1997049395A1 (en) | 1996-06-25 | 1997-12-31 | Novartis-Erfindungen Verwaltungsgesellschaft M.B.H. | Substituted 3,5-diphenyl-1,2,4-triazoles and their use as pharmaceutical metal chelators |
US6277368B1 (en) | 1996-07-25 | 2001-08-21 | The Regents Of The University Of California | Cancer immunotherapy using autologous tumor cells combined with cells expressing a membrane cytokine |
US7025962B1 (en) | 1996-08-16 | 2006-04-11 | Schering Corporation | Mammalian cell surface antigens; related reagents |
EP1947183B1 (en) | 1996-08-16 | 2013-07-17 | Merck Sharp & Dohme Corp. | Mammalian cell surface antigens; related reagents |
EP0920505B1 (en) | 1996-08-16 | 2008-06-04 | Schering Corporation | Mammalian cell surface antigens; related reagents |
US6111090A (en) | 1996-08-16 | 2000-08-29 | Schering Corporation | Mammalian cell surface antigens; related reagents |
WO1998035958A1 (en) | 1997-02-13 | 1998-08-20 | Novartis Ag | Phthalazines with angiogenesis inhibiting activity |
WO1999003854A1 (en) | 1997-07-18 | 1999-01-28 | Novartis Ag | Crystal modification of a n-phenyl-2-pyrimidineamine derivative, processes for its manufacture and its use |
WO1999020758A1 (en) | 1997-10-21 | 1999-04-29 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2 |
US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
US8012469B2 (en) | 1998-02-02 | 2011-09-06 | Johns Hopkins University School Of Medicine | Universal GM-CSF expressing bystander human K562 cell line |
US6464973B1 (en) | 1998-02-02 | 2002-10-15 | Johns Hopkins University, School Of Medicine | Universal GM-CSF expressing bystander human K562 cell line |
WO1999040196A1 (en) | 1998-02-09 | 1999-08-12 | Genentech, Inc. | Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
WO2001003720A2 (en) | 1999-07-12 | 2001-01-18 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs |
WO2002010192A2 (en) | 2000-08-01 | 2002-02-07 | Novartis Ag | Somatostatin analogues |
US7473761B2 (en) | 2000-08-01 | 2009-01-06 | Novartis Ag | Somatostatin analogues |
WO2003037347A1 (en) | 2001-10-30 | 2003-05-08 | Novartis Ag | Staurosporine derivatives as inhibitors of flt3 receptor tyrosine kinase activity |
WO2003077914A1 (en) | 2002-03-13 | 2003-09-25 | Array Biopharma, Inc | N3 alkylated benzimidazole derivatives as mek inhibitors |
WO2004005281A1 (en) | 2002-07-05 | 2004-01-15 | Novartis Ag | Inhibitors of tyrosine kinases |
WO2004045532A2 (en) | 2002-11-15 | 2004-06-03 | Chiron Corporation | Methods for preventing and treating cancer metastasis and bone loss associated with cancer metastasis |
US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
WO2004060319A2 (en) | 2002-12-30 | 2004-07-22 | 3M Innovative Properties Company | Immunostimulatory combinations |
WO2004072051A1 (en) | 2003-02-11 | 2004-08-26 | Vernalis (Cambridge) Limited | Isoxazole compounds as inhibitors of heat shock proteins |
US7618632B2 (en) | 2003-05-23 | 2009-11-17 | Wyeth | Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies |
WO2005007190A1 (en) | 2003-07-11 | 2005-01-27 | Schering Corporation | Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer |
WO2005039549A1 (en) | 2003-10-27 | 2005-05-06 | Novartis Ag | Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation |
WO2005055808A2 (en) | 2003-12-02 | 2005-06-23 | Genzyme Corporation | Compositions and methods to diagnose and treat lung cancer |
WO2005073224A2 (en) | 2004-01-23 | 2005-08-11 | Amgen Inc | Quinoline quinazoline pyridine and pyrimidine counds and their use in the treatment of inflammation angiogenesis and cancer |
US7709458B2 (en) | 2004-03-15 | 2010-05-04 | David K. R. Karaolis | Method for inhibiting cancer cell proliferation or increasing cancer cell apoptosis |
US7592326B2 (en) | 2004-03-15 | 2009-09-22 | Karaolis David K R | Method for stimulating the immune, inflammatory or neuroprotective response |
WO2005115451A2 (en) | 2004-04-30 | 2005-12-08 | Isis Innovation Limited | Methods for generating improved immune response |
WO2006083289A2 (en) | 2004-06-04 | 2006-08-10 | Duke University | Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity |
US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
US8388967B2 (en) | 2005-03-25 | 2013-03-05 | Gitr, Inc. | Methods for inducing or enhancing an immune response by administering agonistic GITR-binding antibodies |
US7812135B2 (en) | 2005-03-25 | 2010-10-12 | Tolerrx, Inc. | GITR-binding antibodies |
EP1866339A2 (en) | 2005-03-25 | 2007-12-19 | TolerRx, Inc | Gitr binding molecules and uses therefor |
US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
WO2006122806A2 (en) | 2005-05-20 | 2006-11-23 | Novartis Ag | 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors |
US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
WO2007024945A1 (en) | 2005-08-25 | 2007-03-01 | Novartis Ag | Condensed imidazolo derivatives for the inhibition of aldosterone synthase and aromatase |
WO2007030377A1 (en) | 2005-08-30 | 2007-03-15 | Novartis Ag | Substituted benzimidazoles as kinase inhibitors |
US20080286296A1 (en) * | 2005-11-08 | 2008-11-20 | Thomas Ebensen | Cyclic-Dinucleotides and Its Conjugates as Adjuvants and Their Uses in Pharmaceutical Compositions |
WO2007054279A2 (en) | 2005-11-08 | 2007-05-18 | Helmholtz-Zentrum für Infektionsforschung GmbH | Cyclic-dinucleotides and its conjugates as adjuvants and their uses in pharmaceutical compositions |
WO2007070514A1 (en) | 2005-12-13 | 2007-06-21 | Incyte Corporation | Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors |
WO2007133822A1 (en) | 2006-01-19 | 2007-11-22 | Genzyme Corporation | Gitr antibodies for the treatment of cancer |
WO2007084786A1 (en) | 2006-01-20 | 2007-07-26 | Novartis Ag | Pyrimidine derivatives used as pi-3 kinase inhibitors |
WO2007131201A2 (en) | 2006-05-05 | 2007-11-15 | Irm Llc | Compounds and compositions as hedgehog pathway modulators |
US8552003B2 (en) | 2006-08-02 | 2013-10-08 | Novartis Ag | (S)-N-((S)-1-cyclohexyl-2-{(S)-2-[4-4-(4-fluorobenzoyl)-thiazol-2-yl]pyrrolidin-1-yl}-2-oxoethyl)-2-methylamino-propionamide, or pharmaceutically acceptable salts thereof and their uses |
US7867493B2 (en) | 2006-08-18 | 2011-01-11 | Novartis Ag | PRLR-specific antibody and uses thereof |
WO2008073687A2 (en) | 2006-12-08 | 2008-06-19 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
US8591886B2 (en) | 2007-07-12 | 2013-11-26 | Gitr, Inc. | Combination therapies employing GITR binding molecules |
US8562997B2 (en) | 2008-01-15 | 2013-10-22 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of treating acute myeloid leukemia by blocking CD47 |
WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
WO2009115562A2 (en) | 2008-03-19 | 2009-09-24 | Novartis Ag | Crystalline forms and two solvated forms of 4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1h-benzimidazol-2-yl]quinolin-2(1h)-one lactic acid salts |
US8728476B2 (en) | 2008-04-23 | 2014-05-20 | Stichting Sanquin Bloedvoorziening | Compositions and methods to enhance the immune system |
WO2009141386A1 (en) | 2008-05-23 | 2009-11-26 | Novartis Ag | Derivatives of quinolines and quinoxalines as protein tyrosine kinase inhibitors |
WO2010002655A2 (en) | 2008-06-25 | 2010-01-07 | Irm Llc | Compounds and compositions as kinase inhibitors |
WO2010003118A1 (en) | 2008-07-02 | 2010-01-07 | Trubion Pharmaceuticals, Inc. | Tgf-b antagonist multi-target binding proteins |
WO2010007120A1 (en) | 2008-07-18 | 2010-01-21 | Novartis Ag | Pyridazine derivatives as smo inhibitors |
WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
US8415355B2 (en) | 2008-08-22 | 2013-04-09 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
US8685980B2 (en) | 2008-08-22 | 2014-04-01 | Novartis Ag | Pyrrolopyrimidine compounds and their uses |
WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
US8609089B2 (en) | 2008-08-25 | 2013-12-17 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
US20100150946A1 (en) | 2008-08-28 | 2010-06-17 | Cell Genesys, Inc. | Methods and Compositions for Treating Prostate Cancer or Inducing a Humoral Immune Response Against Prostate Cancer |
WO2010026124A1 (en) | 2008-09-02 | 2010-03-11 | Novartis Ag | Picolinamide derivatives as kinase inhibitors |
WO2010029082A1 (en) | 2008-09-10 | 2010-03-18 | Novartis Ag | Organic compounds |
US8586023B2 (en) | 2008-09-12 | 2013-11-19 | Mie University | Cell capable of expressing exogenous GITR ligand |
WO2010060937A2 (en) | 2008-11-28 | 2010-06-03 | Novartis Ag | Hsp90 inhibitor combinations |
WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
US8895705B2 (en) | 2009-03-02 | 2014-11-25 | Bionovion Holding B.V. | Antibodies against a proliferating inducing ligand (APRIL) and methods of use thereof |
WO2010101849A1 (en) | 2009-03-02 | 2010-09-10 | Irm Llc | N- (hetero)aryl, 2- (hetero)aryl-substituted acetamides for use as wnt signaling modulators |
WO2010104833A1 (en) | 2009-03-10 | 2010-09-16 | Intelligent Implant Systems | Active bone screw |
US20100310602A1 (en) | 2009-06-05 | 2010-12-09 | Infectious Disease Research Institute | Synthetic glucopyranosyl lipid adjuvants |
WO2010149755A1 (en) | 2009-06-26 | 2010-12-29 | Novartis Ag | 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17 |
WO2011025927A1 (en) | 2009-08-28 | 2011-03-03 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
US8709424B2 (en) | 2009-09-03 | 2014-04-29 | Merck Sharp & Dohme Corp. | Anti-GITR antibodies |
WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
WO2011051726A2 (en) | 2009-10-30 | 2011-05-05 | Isis Innovation Ltd | Treatment of obesity |
WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
WO2011076786A1 (en) | 2009-12-22 | 2011-06-30 | Novartis Ag | Substituted isoquinolinones and quinazolinones |
WO2011090754A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Polypeptide heterodimers and uses thereof |
WO2011101409A1 (en) | 2010-02-19 | 2011-08-25 | Novartis Ag | Pyrrolopyrimidine compounds as inhibitors of cdk4/6 |
US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
EP2581113A1 (en) | 2010-06-11 | 2013-04-17 | Kyowa Hakko Kirin Co., Ltd. | Anti-tim-3 antibody |
WO2011155607A1 (en) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | Anti-tim-3 antibody |
US20140044728A1 (en) | 2010-06-11 | 2014-02-13 | Kyushu University, National University Corporation | Anti-tim-3 antibody |
WO2012004367A1 (en) | 2010-07-09 | 2012-01-12 | N.V. Organon | Agonistic antibody to cd27 |
WO2012022814A1 (en) | 2010-08-20 | 2012-02-23 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (her3) |
WO2013039954A1 (en) | 2011-09-14 | 2013-03-21 | Sanofi | Anti-gitr antibodies |
WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
WO2013111105A1 (en) | 2012-01-26 | 2013-08-01 | Novartis Ag | Imidazopyrrolidinone compounds |
WO2013124826A1 (en) | 2012-02-24 | 2013-08-29 | Novartis Ag | Oxazolidin- 2 -one compounds and uses thereof as pi3ks inhibitors |
WO2013171639A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171641A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171642A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013171640A1 (en) | 2012-05-15 | 2013-11-21 | Novartis Ag | Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1 |
WO2013184757A1 (en) | 2012-06-06 | 2013-12-12 | Irm Llc | Compounds and compositions for modulating egfr activity |
US20140072566A1 (en) | 2012-06-08 | 2014-03-13 | National Cancer Center | Novel epitope for switching to th2 cell and use thereof |
WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
WO2014012479A1 (en) | 2012-07-18 | 2014-01-23 | Shanghai Birdie Biotech, Inc. | Compounds for targeted immunotherapy |
WO2014072493A1 (en) | 2012-11-08 | 2014-05-15 | Novartis Ag | Pharmaceutical combination comprising a b-raf inhibitor and a histone deacetylase inhibitor and their use in the treatment of proliferative diseases |
WO2014085318A1 (en) | 2012-11-28 | 2014-06-05 | Novartis Ag | Combination therapy |
WO2014093936A1 (en) | 2012-12-13 | 2014-06-19 | Aduro Biotech, Inc. | Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use |
US20140205653A1 (en) * | 2012-12-13 | 2014-07-24 | Aduro Biotech, Inc. | Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use |
WO2014160160A2 (en) | 2013-03-13 | 2014-10-02 | Novartis Ag | Antibody drug conjugates |
WO2014151616A1 (en) | 2013-03-14 | 2014-09-25 | Novartis Ag | Biaryl amide compounds as kinase inhibitors |
WO2014141104A1 (en) | 2013-03-14 | 2014-09-18 | Novartis Ag | 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh |
WO2014189805A1 (en) | 2013-05-18 | 2014-11-27 | Auro Biotech, Inc. | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling |
WO2015026684A1 (en) | 2013-08-20 | 2015-02-26 | Merck Sharp & Dohme Corp. | Modulation of tumor immunity |
WO2015066188A1 (en) | 2013-11-01 | 2015-05-07 | Novartis Ag | Aminoheteroaryl benzamides as kinase inhibitors |
US20150210769A1 (en) | 2014-01-24 | 2015-07-30 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
US20150218274A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
US20150259420A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
WO2016096174A1 (en) | 2014-12-16 | 2016-06-23 | Invivogen | Fluorinated cyclic dinucleotides for cytokine induction |
Non-Patent Citations (64)
Title |
---|
"Fundamental Immunology", 1993, RAVEN PRESS |
"Pharmacotherapeutics for Advanced Practice:A Practical Approach", 2001, LIPPINCOTT, WILLIAMS & WILKINS |
"Remington: The Science and Practice of Pharmacy", 1995, MACK PUBLISHING |
"Remington's Pharmaceutical Sciences", 1975, AMERICAN PHARMACEUTICAL ASSOCIATION, pages: 1405 - 1412,1461-1487 |
AHMED ET AL., NATURE IMMUNOL., vol. 12, 2011, pages 509 - 17 |
ASLANIDIS ET AL., NUCLEIC ACIDS RESEARCH, 18.20, 1990, pages 6069 - 6074 |
BARBER, IMMUNOL. REV, vol. 243, 2011, pages 99 - 108 |
BASUBASU: "Liposome Methods and Protocols (Methods in Molecular Biology)", 2002, HUMANA PRESS |
BURDETTE ET AL., NATURE, vol. 478, 2011, pages 515 - 18 |
BURDETTEVANCE, NAT IMMUNOL., vol. 14, 2013, pages 19 - 26 |
BUTT ET AL., PROTEIN EXPRESSION AND PURIFICATION, 2005, pages 1 - 9 |
C. AMMANP. MEIERA. E. MERBACH, J. MAGN. RESON., vol. 46, 1982, pages 319 - 321 |
CASKEY ET AL., J. EXP. MED., vol. 208, 2011, pages 2357 - 77 |
CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 946414-94-4 |
COFFMAN ET AL., IMMUNITY, vol. 33, 2010, pages 492 - 503 |
CONLON, J. IMMUNOL., vol. 190, 2013, pages 5216 - 5225 |
CRIMMINS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 105, 2008, pages 10191 - 10196 |
CRIT. REV. THER. DRUG CARRIER SYST., vol. 21, 2004, pages 387 - 422 |
DAVIES ET AL., CELL, vol. 149, 2012, pages 358 - 70 |
DESSUREAULT ET AL., ANN. SURG. ONCOL., vol. 14, 2007, pages 869 - 84 |
DINERGAO ET AL., CELL, vol. 153, 2013, pages 748 - 762 |
DINERGAOABLASSER ET AL., NATURE, vol. 498, 2013, pages 380 - 84 |
DUBENSKYREED, SEMIN. IMMUNOL., vol. 22, 2010, pages 155 - 61 |
EAGERNEMUNAITIS, MOL. THER., vol. 12, 2005, pages 18 - 27 |
EINSTEIN ET AL., HUMAN VACCINES, vol. 5, 2009, pages 705 - 19 |
FITZGERALD ET AL., NATURE IMMUNOLOGY,, vol. 4, no. 5, 2003, pages 491 - 496 |
GREGORIADIS: "Liposome Technology", 2006, INFORMA HEALTHCARE |
HAMID, O. ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 369, no. 2, 2013, pages 134 - 44 |
IRETONGALE, VIRUSES, vol. 3, 2011, pages 906 - 19 |
ISHIKAWA, H.BARBER, G.N., NATURE, vol. 455, 2008, pages 674 - 678 |
IWASAKIMEDZHITOV, SCIENCE, vol. 328, 2010, pages 1703 - 05 |
JIN ET AL., GENES AND IMMUNITY, vol. 12, 2011, pages 263 - 9 |
JINYI ET AL., PLOS ONE, vol. 8, 2011, pages e77846 |
KASTENMULLER ET AL., J. CLIN. INVEST., vol. 121, 2011, pages 1782 - 1796 |
KRANZUSCH ET AL., CELL REPORTS, vol. 3, 2013, pages 1362 - 68 |
LEBER ET AL., PLOS PATHOG, vol. 4, no. 1, 2008, pages e6 |
MAYNARD ET AL.: "A Handbook of SOPs for Good Clinical Practice", 1996, INTERPHARM PRESS |
MCCUNE ET AL., CANCER, vol. 43, 1979, pages 1619 |
MCWHIRTER ET AL., J. EXP. MED., vol. 206, 2009, pages 1899 - 1911 |
NANOMEDICINE: NANOTECHNOLOGY, BIOLOGY AND MEDICINE, vol. 1, 2005, pages 22 - 30 |
NELSONGRISWOLD, COMPUT. METHODS PROGRAMS BIOMED., vol. 27, 1988, pages 65 - 8 |
NIESEN ET AL., NATURE PROTOCOLS 2.9, 2007, pages 2212 - 2221 |
P. HEINRICH STAHLCAMILLE G. WERMUTH: "in Handbook of Pharmaceutical Salts: Properties, Selection, and Use", 2011, MACK PUBLISHING CO. |
PANDEY, COLD SPRING HARB PERSPECT BIOL, vol. 7, 2015, pages a016246 |
REED ET AL., TRENDS IMMUNOL., vol. 30, 2009, pages 23 - 32 |
ROMLING ET AL., MICRB. MOL. BIOL. REV., vol. 77, 2013, pages 1 - 52 |
SAUER ET AL., INFECT. IMMUN., vol. 79, 2011, pages 688 - 94 |
See also references of EP3268035A1 |
STRBO ET AL., IMMUNOL RES., vol. 57, no. 1-3, December 2013 (2013-12-01), pages 31 1 - 25 |
SUN ET AL., SCIENCE, vol. 339, no. 6121, 2013, pages 826 - 30 |
VAN ERP ET AL., J. IMMUNOASSAY, vol. 12, 1991, pages 425 - 43 |
VANCE ET AL., CELL HOST & MICROBE, vol. 6, 2009, pages 10 - 21 |
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
WILSON, J. IMMUNOL. METHODS, vol. 175, 1994, pages 267 - 273 |
WITTE ET AL., MBIO, vol. 4, 2012, pages e00282 - 13 |
XIAOFITZGERALD, MOL. CELL, vol. 51, 2013, pages 135 - 39 |
XIAOFITZGERALD, MOL. CELL, vol. 51, pages 135 - 39 |
YAMAZAKI ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 163, 1999, pages 5178 - 5182 |
YAN ET AL., BIOORG. MED. CHEM LETT., vol. 18, 2008, pages 5631 |
YARMUSH, J. BIOCHEM. BIOPHYS. METHODS, vol. 25, 1992, pages 85 - 97 |
YI ET AL., PLOS ONE, vol. 8, no. 10, 2013, pages e77846 |
YI ET AL., PLOS ONE, vol. 8, no. 10, 21 October 2013 (2013-10-21), pages e77846 |
ZHANG ET AL., MOL. CELL., vol. 51, 2013, pages 226 - 35 |
ZHAO ET AL., NUCLEOSIDES, NUCLEOTIDES, AND NUCLEIC ACID, vol. 289, 2009, pages 352 - 378 |
Cited By (152)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11890303B2 (en) | 2013-01-14 | 2024-02-06 | Fred Hutchinson Cancer Center | Compositions and methods for delivery of immune cells to treat un-resectable or non-resected tumor cells and tumor relapse |
US10450341B2 (en) | 2014-06-04 | 2019-10-22 | Glaxosmithkline Intellectual Property Development Limited | Cyclic di-nucleotides as modulators of STING |
US10047115B2 (en) | 2015-01-29 | 2018-08-14 | Glaxosmithkline Intellectual Property Development Limited | Cyclic dinucleotides useful for the treatment of inter alia cancer |
US10759825B2 (en) | 2015-08-13 | 2020-09-01 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as STING agonists |
US11453697B1 (en) | 2015-08-13 | 2022-09-27 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
US10766919B2 (en) | 2015-08-13 | 2020-09-08 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as sting agonists |
US10106574B2 (en) | 2015-08-13 | 2018-10-23 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as sting agonists |
US10738074B2 (en) | 2015-08-13 | 2020-08-11 | Merck Sharp & Dohme Corp. | Cyclic di-nucleotide compounds as STING agonists |
US9718848B2 (en) | 2015-12-03 | 2017-08-01 | Glaxosmithkline Intellectual Property Development Limited | Compounds |
JP2018516903A (en) * | 2015-12-03 | 2018-06-28 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited | Cyclic purine dinucleotides as regulators of STING |
US10364266B2 (en) | 2015-12-03 | 2019-07-30 | Glaxosmithkline Intellectual Property Development Limited | Compounds |
US10730907B2 (en) | 2015-12-03 | 2020-08-04 | Glaxosmithkline Intellectual Property Development Limited | Compounds |
US9994607B2 (en) | 2015-12-03 | 2018-06-12 | Glaxosmithkline Intellectual Property Development Limited | Compounds |
US11299512B2 (en) | 2016-03-18 | 2022-04-12 | Immunesensor Therapeutics, Inc. | Cyclic di-nucleotide compounds and methods of use |
US10519188B2 (en) | 2016-03-18 | 2019-12-31 | Immunesensor Therapeutics, Inc. | Cyclic di-nucleotide compounds and methods of use |
US11872195B2 (en) | 2016-04-14 | 2024-01-16 | Fred Hutchinson Cancer Center | Compositions and methods to program therapeutic cells using targeted nucleic acid nanocarriers |
US10696985B1 (en) | 2016-06-06 | 2020-06-30 | Vanderbilt University | Reversibly crosslinked endosomolytic polymer vesicles for cytosolic drug delivery |
US11098077B2 (en) | 2016-07-05 | 2021-08-24 | Chinook Therapeutics, Inc. | Locked nucleic acid cyclic dinucleotide compounds and uses thereof |
US11033569B2 (en) | 2016-07-06 | 2021-06-15 | Sperovie Biosciences, Inc. | Compounds,Compositions, and methods for the treatment of disease |
US11744845B2 (en) | 2016-07-06 | 2023-09-05 | F-star Therapeutics, Inc. | Compounds,compositions, and methods for the treatment of disease |
AU2017293781B2 (en) * | 2016-07-06 | 2022-12-22 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
EP3481402A4 (en) * | 2016-07-06 | 2020-01-22 | Sperovie Biosciences, Inc. | Compounds, compositions, and methods for the treatment of disease |
US10494436B2 (en) | 2016-07-29 | 2019-12-03 | Aduro Biotech Holdings, Europe B.V. | Anti-PD-1 antibodies |
WO2018020476A1 (en) | 2016-07-29 | 2018-02-01 | Aduro Biotech Holdings, Europe B.V. | Anti-pd-1 antibodies |
AU2017333933B2 (en) * | 2016-09-30 | 2022-01-06 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds |
US10537590B2 (en) | 2016-09-30 | 2020-01-21 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds |
WO2018060323A1 (en) | 2016-09-30 | 2018-04-05 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds |
JP2018536695A (en) * | 2016-09-30 | 2018-12-13 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Cyclic dinucleotide compound |
US10414747B2 (en) | 2016-10-04 | 2019-09-17 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene compounds as sting agonists |
US10730849B2 (en) | 2016-10-04 | 2020-08-04 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene compounds as STING agonists |
JP2019534876A (en) * | 2016-10-04 | 2019-12-05 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | Benzo [b] thiophene compounds as STING agonists |
US10703738B2 (en) | 2016-10-04 | 2020-07-07 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene compounds as STING agonists |
WO2018065360A1 (en) | 2016-10-07 | 2018-04-12 | Biolog Life Science Institute Forschungslabor Und Biochemica-Vertrieb Gmbh | Cyclic dinucleotides containing benzimidazole, method for the production of same, and use of same to activate stimulator of interferon genes (sting)-dependent signaling pathways |
CN110325543A (en) * | 2016-12-01 | 2019-10-11 | 武田药品工业有限公司 | Cyclic annular dinucleotides as STING (interferon gene stimulating factor) agonist |
CN110325543B (en) * | 2016-12-01 | 2023-03-31 | 武田药品工业株式会社 | Cyclic dinucleotides as STING (stimulator of interferon genes) agonists |
WO2018100558A2 (en) | 2016-12-01 | 2018-06-07 | Takeda Pharmaceutical Company Limited | Cyclic dinucleotide |
US10980825B2 (en) | 2016-12-01 | 2021-04-20 | Takeda Pharmaceutical Company Limited | Cyclic dinucleotide |
EP3868384A1 (en) | 2016-12-01 | 2021-08-25 | Takeda Pharmaceutical Company Limited | Cyclic dinucleotides as sting (stimulator of interferon genes) agonists |
US11666594B2 (en) | 2016-12-01 | 2023-06-06 | Takeda Pharmaceutical Company Limited | Antibody-drug conjugates comprising a cyclic dinucleotide |
EP3558327A4 (en) * | 2016-12-21 | 2020-12-09 | Fred Hutchinson Cancer Research Center | Scaffolds to treat solid tumor cells and escape variants |
US11566061B2 (en) | 2017-01-05 | 2023-01-31 | Fred Hutchinson Cancer Center | Systems and methods to improve vaccine efficacy |
JP2020508304A (en) * | 2017-02-17 | 2020-03-19 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | Compounds for the treatment of cancer |
US10246480B2 (en) | 2017-02-17 | 2019-04-02 | Eisai R&D Management Co., Ltd. | Compounds for the treatment of cancer |
EP4008403A1 (en) | 2017-02-17 | 2022-06-08 | Eisai R&D Management Co., Ltd. | Cyclic di-nucleotides compounds for the treatment of cancer |
WO2018152450A1 (en) | 2017-02-17 | 2018-08-23 | Eisai R&D Management Co., Ltd. | Cyclic di-nucleotides compounds for the treatment of cancer |
WO2018152453A1 (en) | 2017-02-17 | 2018-08-23 | Eisai R&D Management Co., Ltd. | Cyclic di-nucleotides derivative for the treatment of cancer |
US11339188B2 (en) | 2017-02-17 | 2022-05-24 | Eisai R&D Management Co., Ltd. | Compounds for the treatment of cancer |
JP2020510638A (en) * | 2017-02-17 | 2020-04-09 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | Cyclic dinucleotide derivatives for the treatment of cancer |
US10618930B2 (en) | 2017-02-17 | 2020-04-14 | Eisai R&D Management Co., Ltd. | Compounds for the treatment of cancer |
US10933078B2 (en) | 2017-02-21 | 2021-03-02 | Board Of Regents, The University Of Texas System | Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling |
US11400108B2 (en) | 2017-02-21 | 2022-08-02 | Board Of Regents, The University Of Texas System | Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling |
US10392419B2 (en) | 2017-03-22 | 2019-08-27 | Boehringer Ingelheim International Gmbh | Modified cyclic dinucleotide compounds |
JP2020514389A (en) * | 2017-03-22 | 2020-05-21 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Modified cyclic dinucleotide compound |
CN110382515A (en) * | 2017-03-22 | 2019-10-25 | 勃林格殷格翰国际有限公司 | Modified ring-type dinucleotides compound |
JP2020203887A (en) * | 2017-03-22 | 2020-12-24 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Modified cyclic dinucleotide compounds |
CN110382515B (en) * | 2017-03-22 | 2023-03-03 | 勃林格殷格翰国际有限公司 | Modified cyclic dinucleotide compounds |
WO2018172206A1 (en) | 2017-03-22 | 2018-09-27 | Boehringer Ingelheim International Gmbh | Modified cyclic dinucleotide compounds |
WO2018190719A2 (en) | 2017-04-13 | 2018-10-18 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
WO2018198076A1 (en) | 2017-04-28 | 2018-11-01 | Aduro Biotech, Inc. | Bis 2'-5'-rr-(3'f-a)(3'f-a) cyclic dinucleotide compound and uses thereof |
WO2018200812A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Antibody conjugates comprising sting agonist |
JP2020517700A (en) * | 2017-04-28 | 2020-06-18 | ノバルティス アーゲー | Antibody conjugate containing a STING agonist |
US10975114B2 (en) | 2017-04-28 | 2021-04-13 | Chinook Therapeutics, Inc. | Bis 2′-5′-RR-(3′F-A)(3′F-A) cyclic dinucleotide compound and uses thereof |
CN110799218A (en) * | 2017-04-28 | 2020-02-14 | 诺华股份有限公司 | Antibody conjugates comprising STING agonists |
US11116835B2 (en) | 2017-05-10 | 2021-09-14 | Fred Hutchinson Cancer Research Center | Epstein Barr virus antibodies, vaccines, and uses of the same |
US11466047B2 (en) | 2017-05-12 | 2022-10-11 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
WO2018222711A2 (en) | 2017-05-30 | 2018-12-06 | Bristol-Myers Squibb Company | Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent |
EP4245375A2 (en) | 2017-05-30 | 2023-09-20 | Bristol-Myers Squibb Company | Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent |
US11285131B2 (en) | 2017-08-04 | 2022-03-29 | Merck Sharp & Dohme Corp. | Benzo[b]thiophene STING agonists for cancer treatment |
US11312772B2 (en) | 2017-08-04 | 2022-04-26 | Merck Sharp & Dohme Corp. | Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment |
WO2019043634A3 (en) * | 2017-08-30 | 2019-04-11 | Beijing Xuanyi Pharmasciences Co., Ltd. | Cyclic di-nucleotides as stimulator of interferon genes modulators |
US11638716B2 (en) | 2017-08-31 | 2023-05-02 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
JP7209697B2 (en) | 2017-08-31 | 2023-01-20 | ブリストル-マイヤーズ スクイブ カンパニー | Cyclic dinucleotides as anticancer agents |
JP2020532529A (en) * | 2017-08-31 | 2020-11-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | Cyclic dinucleotide as an anticancer drug |
JP7208225B2 (en) | 2017-08-31 | 2023-01-18 | ブリストル-マイヤーズ スクイブ カンパニー | Cyclic dinucleotides as anticancer agents |
JP2020532542A (en) * | 2017-08-31 | 2020-11-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | Cyclic dinucleotide as an anticancer drug |
US11584774B2 (en) | 2017-09-11 | 2023-02-21 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
US11707531B2 (en) | 2017-09-11 | 2023-07-25 | F-star Therapeutics, Inc. | Compounds, compositions, and methods for the treatment of disease |
WO2019092660A1 (en) | 2017-11-10 | 2019-05-16 | Takeda Pharmaceutical Company Limited | Sting modulator compounds, and methods of making and using |
US11542293B2 (en) | 2017-11-10 | 2023-01-03 | Takeda Pharmaceutical Company Limited | Sting modulator compounds, and methods of making and using |
RU2776060C2 (en) * | 2017-12-15 | 2022-07-13 | Янссен Байотек, Инк. | Cyclic dinucleotides as sting agonists |
US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
US11685761B2 (en) | 2017-12-20 | 2023-06-27 | Merck Sharp & Dohme Llc | Cyclic di-nucleotide compounds as sting agonists |
JP7266896B2 (en) | 2018-03-09 | 2023-05-01 | 国立研究開発法人科学技術振興機構 | β-modified phosphate compound precursor, β-modified phosphate compound, reaction inhibitor, drug containing the same, and reaction inhibition method |
WO2019172394A1 (en) * | 2018-03-09 | 2019-09-12 | 国立研究開発法人科学技術振興機構 | β-MODIFIED PHOSPHORIC ACID COMPOUND PRECURSOR, β-MODIFIED PHOSPHORIC ACID COMPOUND, REACTION INHIBITOR, AND MEDICINE INCLUDING SAME, AND REACTION INHIBITION METHOD |
US11597745B2 (en) | 2018-03-09 | 2023-03-07 | Japan Science And Technology Agency | β-modified phosphoric acid compound precursor, β-modified phosphoric acid compound, reaction inhibitor and medicine containing the same, and method for inhibiting reaction |
JPWO2019172394A1 (en) * | 2018-03-09 | 2021-02-18 | 国立研究開発法人科学技術振興機構 | β-modified phosphoric acid compound precursor, β-modified phosphoric acid compound, reaction inhibitor and drugs containing it, and reaction inhibition method |
EP4242212A2 (en) | 2018-03-23 | 2023-09-13 | Takeda Pharmaceutical Company Limited | Sting modulator compounds with sulfamate linkages, and methods of making and using |
WO2019180683A1 (en) | 2018-03-23 | 2019-09-26 | Takeda Pharmaceutical Company Limited | Sting modulator compounds with sulfamate linkages, and methods of making and using |
WO2019183578A1 (en) | 2018-03-23 | 2019-09-26 | Codiak Biosciences, Inc. | Extracellular vesicles comprising sting-agonist |
WO2019185477A1 (en) | 2018-03-27 | 2019-10-03 | Boehringer Ingelheim International Gmbh | Cyclic dinucleotide compounds containing 2-aza-hypoxanthine or 6h-pytazolo[1,5-d][1,2,4]triazin-7-one as sting agonists |
WO2019185476A1 (en) | 2018-03-27 | 2019-10-03 | Boehringer Ingelheim International Gmbh | Modified cyclic dinucleotide compounds |
US10793557B2 (en) | 2018-04-03 | 2020-10-06 | Merck Sharp & Dohme Corp. | Sting agonist compounds |
US11702430B2 (en) | 2018-04-03 | 2023-07-18 | Merck Sharp & Dohme Llc | Aza-benzothiophene compounds as STING agonists |
US11874276B2 (en) | 2018-04-05 | 2024-01-16 | Dana-Farber Cancer Institute, Inc. | STING levels as a biomarker for cancer immunotherapy |
US11149052B2 (en) | 2018-04-06 | 2021-10-19 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′-cyclic dinucleotides |
AU2019247905B2 (en) * | 2018-04-06 | 2023-10-05 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
US11292812B2 (en) | 2018-04-06 | 2022-04-05 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotides |
WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
WO2019232392A1 (en) | 2018-06-01 | 2019-12-05 | Eisai R&D Management Co., Ltd. | Methods for the treatment of bladder cancer |
US11691990B2 (en) | 2018-08-16 | 2023-07-04 | Eisai R&D Management Co., Ltd | Salts of compounds and crystals thereof |
WO2020041720A1 (en) | 2018-08-24 | 2020-02-27 | Codiak Biosciences, Inc. | Extracellular vesicles targeting dendritic cells and uses thereof |
US11883485B2 (en) | 2018-08-29 | 2024-01-30 | Fred Hutchinson Cancer Center | Methods of eliciting antibodies that bind to full-length glycosylated HIV-1 Env using multimerized Env cores |
KR20210057066A (en) | 2018-09-06 | 2021-05-20 | 다이이찌 산쿄 가부시키가이샤 | Novel Cyclic Dinucleotide Derivatives and Antibody Drug Conjugates |
KR20230122685A (en) | 2018-09-06 | 2023-08-22 | 다이이찌 산쿄 가부시키가이샤 | Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof |
KR20230028589A (en) | 2018-09-06 | 2023-02-28 | 다이이찌 산쿄 가부시키가이샤 | Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof |
WO2020050406A1 (en) | 2018-09-06 | 2020-03-12 | 第一三共株式会社 | Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof |
WO2020057546A1 (en) | 2018-09-21 | 2020-03-26 | 上海迪诺医药科技有限公司 | Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application |
WO2020065408A1 (en) | 2018-09-27 | 2020-04-02 | Pierre Fabre Medicament | Sulfomaleimide-based linkers and corresponding conjugates |
US11161864B2 (en) | 2018-10-29 | 2021-11-02 | Venenum Biodesign, LLC | Sting agonists |
US11110106B2 (en) | 2018-10-29 | 2021-09-07 | Venenum Biodesign, LLC | Sting agonists for treating bladder cancer and solid tumors |
US11883420B2 (en) | 2018-10-29 | 2024-01-30 | Venenum Biodesign, LLC | Sting agonists for treating bladder cancer and solid tumors |
WO2020092633A1 (en) | 2018-10-30 | 2020-05-07 | Vanderbilt University | Graft copolymers, methods of forming graft copolymers, and methods of use thereof |
WO2020092617A1 (en) | 2018-10-31 | 2020-05-07 | Novartis Ag | Dc-sign antibody conjugates comprising sting agonists |
US11766447B2 (en) | 2019-03-07 | 2023-09-26 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
WO2020191377A1 (en) | 2019-03-21 | 2020-09-24 | Codiak Biosciences, Inc. | Extracellular vesicle conjugates and uses thereof |
WO2020191361A2 (en) | 2019-03-21 | 2020-09-24 | Codiak Biosciences, Inc. | Extracellular vesicles for vaccine delivery |
WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
US11787833B2 (en) | 2019-05-09 | 2023-10-17 | Aligos Therapeutics, Inc. | Modified cyclic dinucleoside compounds as sting modulators |
WO2020227421A1 (en) * | 2019-05-09 | 2020-11-12 | Aligos Therapeutics, Inc. | Modified cyclic dinucleoside compounds as sting modulators |
WO2021003445A1 (en) | 2019-07-03 | 2021-01-07 | Codiak Biosciences, Inc. | Extracellular vesicles targeting t cells and uses thereof |
WO2021030251A1 (en) | 2019-08-12 | 2021-02-18 | Purinomia Biotech, Inc. | Methods and compositions for promoting and potentiating t-cell mediated immune responses through adcc targeting of cd39 expressing cells |
WO2021041532A1 (en) | 2019-08-26 | 2021-03-04 | Dana-Farber Cancer Institute, Inc. | Use of heparin to promote type 1 interferon signaling |
WO2021062058A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Sting agonist comprising exosomes for treating neuroimmunological disorders |
WO2021062317A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Extracellular vesicle compositions |
WO2021062060A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Sting agonist comprising exosomes combined with il-12 displaying exosomes for treating a tumour |
WO2021062290A1 (en) | 2019-09-25 | 2021-04-01 | Codiak Biosciences, Inc. | Methods of producing extracellular vesicles |
WO2021074695A1 (en) | 2019-10-16 | 2021-04-22 | Avacta Life Sciences Limited | PD-L1 INHIBITOR - TGFβ INHIBITOR BISPECIFIC DRUG MOIETIES. |
WO2021177438A1 (en) | 2020-03-06 | 2021-09-10 | 第一三共株式会社 | Antibody-drug conjugate including novel cyclic dinucleotide derivative |
KR20220151630A (en) | 2020-03-06 | 2022-11-15 | 다이이찌 산쿄 가부시키가이샤 | Antibody Drug Conjugates Containing Novel Cyclic Dinucleotide Derivatives |
WO2021189047A2 (en) | 2020-03-20 | 2021-09-23 | Codiak Biosciences, Inc. | Extracellular vesicles for therapy |
WO2021206158A1 (en) | 2020-04-10 | 2021-10-14 | 小野薬品工業株式会社 | Method of cancer therapy |
WO2021237100A1 (en) | 2020-05-21 | 2021-11-25 | Codiak Biosciences, Inc. | Methods of targeting extracellular vesicles to lung |
WO2022050300A1 (en) | 2020-09-02 | 2022-03-10 | 第一三共株式会社 | NOVEL ENDO-β-N-ACETYLGLUCOSAMINIDASE |
WO2022066898A2 (en) | 2020-09-23 | 2022-03-31 | Codiak Biosciences, Inc. | Methods of producing extracellular vesicles |
WO2022066883A1 (en) | 2020-09-23 | 2022-03-31 | Codiak Biosciences, Inc. | Extracellular vesicles comprising kras antigens and uses thereof |
WO2022083584A1 (en) | 2020-10-20 | 2022-04-28 | 泰励生物科技(上海)有限公司 | Multifunctional cyclic dinucleotide and use thereof |
US11725024B2 (en) | 2020-11-09 | 2023-08-15 | Takeda Pharmaceutical Company Limited | Antibody drug conjugates |
WO2022133288A1 (en) | 2020-12-17 | 2022-06-23 | Trustees Of Tufts College | Fap-activated radiotheranostics, and uses related thereto |
KR20230142544A (en) | 2021-02-01 | 2023-10-11 | 다이이찌 산쿄 가부시키가이샤 | Novel method for preparing antibody-immune activator conjugate |
WO2022163846A1 (en) | 2021-02-01 | 2022-08-04 | 第一三共株式会社 | Novel method for producing antibody-immunostimulator conjugate |
WO2022234003A1 (en) | 2021-05-07 | 2022-11-10 | Avacta Life Sciences Limited | Cd33 binding polypeptides with stefin a protein |
WO2023056468A1 (en) | 2021-09-30 | 2023-04-06 | Codiak Biosciences, Inc. | Extracellular vesicle comprising cholesterol tagged sting-agonist |
WO2023057567A1 (en) | 2021-10-07 | 2023-04-13 | Avacta Life Sciences Limited | Pd-l1 binding affimers |
WO2023170606A1 (en) | 2022-03-08 | 2023-09-14 | Alentis Therapeutics Ag | Use of anti-claudin-1 antibodies to increase t cell availability |
WO2023218243A1 (en) | 2022-05-12 | 2023-11-16 | Avacta Life Sciences Limited | Lag-3/pd-l1 binding fusion proteins |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11040053B2 (en) | Compositions and methods for activating “stimulator of interferon gene”13 dependent signalling | |
US10975114B2 (en) | Bis 2′-5′-RR-(3′F-A)(3′F-A) cyclic dinucleotide compound and uses thereof | |
US10906930B2 (en) | Compositions and methods for activating “stimulator of interferon gene”-dependent signalling | |
US11098077B2 (en) | Locked nucleic acid cyclic dinucleotide compounds and uses thereof | |
US20200282049A1 (en) | Compositions and methods for activating "stimulator of interferon gene"-dependent signalling | |
JP6509445B2 (en) | Cyclic dinucleotide compound |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16762447 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 254047 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12017501506 Country of ref document: PH |
|
REEP | Request for entry into the european phase |
Ref document number: 2016762447 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 11201706756V Country of ref document: SG |
|
ENP | Entry into the national phase |
Ref document number: 2016229146 Country of ref document: AU Date of ref document: 20160309 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2979215 Country of ref document: CA Ref document number: 2017547400 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: NC2017/0009104 Country of ref document: CO Ref document number: 001512-2017 Country of ref document: PE Ref document number: CR2017-000410 Country of ref document: CR Ref document number: MX/A/2017/011597 Country of ref document: MX |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017018908 Country of ref document: BR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201791999 Country of ref document: EA |
|
ENP | Entry into the national phase |
Ref document number: 20177028534 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 112017018908 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170904 |