WO2016142445A2 - A method of treatment of a bacterial infection - Google Patents
A method of treatment of a bacterial infection Download PDFInfo
- Publication number
- WO2016142445A2 WO2016142445A2 PCT/EP2016/055076 EP2016055076W WO2016142445A2 WO 2016142445 A2 WO2016142445 A2 WO 2016142445A2 EP 2016055076 W EP2016055076 W EP 2016055076W WO 2016142445 A2 WO2016142445 A2 WO 2016142445A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- seq
- bactericidal
- intracellular
- aureus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4706—4-Aminoquinolines; 8-Aminoquinolines, e.g. chloroquine, primaquine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/4164—1,3-Diazoles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
- A61K31/431—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems containing further heterocyclic rings, e.g. ticarcillin, azlocillin, oxacillin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5375—1,4-Oxazines, e.g. morpholine
- A61K31/5383—1,4-Oxazines, e.g. morpholine ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/54—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame
- A61K31/542—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame ortho- or peri-condensed with heterocyclic ring systems
- A61K31/545—Compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins, cefaclor, or cephalexine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2462—Lysozyme (3.2.1.17)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to the field of medicine, specifically the field of bacterial infection and treatment thereof.
- the human pathogen Staphylococcus aureus colonizes approximately a third of all humans and is one of the leading causes of bacteremia and infective endocarditis in the industrialized world (1).
- persisting and recurrent infections substantially add to morbidity and mortality (2,3).
- Recurrence rates in particular after osteomyelitis or endocarditis, are high and infections may relapse even years after apparent cure (4).
- Infection recurrence is associated with SCVs (small colony variants) and/or non-replicating persisters for several reasons (5-8). Their arrested or slow growth and reduced metabolism renders antibiotics inefficient (9-13).
- they preferentially hide in privileged locations such as in abscesses and within host cells (14-16).
- reversible persisters and reversible SCV's can be induced by low pH and that low pH adapted bacteria persisted mtracellularly, specifically within lysosomes (low pH organelles).
- Low pH induced SCVs and persisters reverted to the highly virulent phenotype upon raising the pH. Raising the pH mtracellularly reverted the low pH adapted bacteria in vitro and in vivo and rendered the SCV's and persisters susceptible to antibacterial agents that are usually not effective mtracellularly.
- pneumoniae-induced monocyte-derived macrophage apoptosis or treating tuberculosis, leprosy, listeriosis, typhoid fever, bacillary dysenteria, plague, brucellosis, typhus, Rocky Mountains spotted fever, chlamydia, trachoma..
- the invention provides for a method of treatment of a bacterial infection in a subject in need thereof, comprising:
- the increase in pH activates a non- replicating intracellular bacterium and the bactericidal agent kills the activated intracellular bacterium.
- the bacterial infection is preferably a persistent bacterial infection and may be related to a persistent S. aureus infection of various tissues such as but not limited to skin, respiratory epithelium, tonsillar tissue, mastitis.
- the bacterial infection is preferably an infection by a species selected from the group bacteria consisting of Staphylococcus, Streptococcus (such as S. pyogenes, S. agalactiae and S. pneumonia), Actinomyces, Nocardia, Bacillus (such as B. anthracis), Coxiella (such as Coxiella burnetii), Rickettsia, Mycobacteria (such as M.
- a more preferred bacterium is a species of Staphylococcus; a preferred species of Staphylococcus is S. aureus.
- a bacterium causing the bacterial infection is preferably present intracellularly in a host cell, such as in the cytosol; more preferably a bacterium causing the bacterial infection is preferably present within an intracellular compartment S. aureus
- the bacterial infection comprises a population of bacteria comprising at least one subpopulation of bacteria that is resistant to a bactericidal agent (e.g. an antibiotic), such as, but not limited to MRSA.
- the intracellular compartment may be any intracellular compartment wherein a bacterium can be persistently present and/or persistently present; preferably the intracellular compartment is a compartment with low pH.
- a preferred intracellular compartment is a compartment selected from the group consisting of an endosome, a lysozome, a phagosome, a phagolysosome, an autophagosome and an autolysosome'a more preferred intracellular compartment is a phagosome, lysozome of phagolysosome; an even more preferred intracellular compartment is a phagolysosome.
- the infected host cell is preferably a eukaryotic host cell; the eukaryotic host cell is preferably selected from the group consisting of professional and non-professional phagocytes, a lymphoid cell, a tonsillar tissue cell, a respiratory epithelial cell, a buccal epithelial cell, a bone marrow cell, an osteoblast, a keratinocyte, a muscle cell, a monocyte, a macrophage, a dendritic cell, an endothelial cell, an epithelial cell, a fibroblasts, an astrocyte, and an microglial cell; a more preferred eukaryotic host cell is a professional or a non- professional phagocyte.
- the subject may be any subject susceptible to or suffering from a persistent bacterial infection, such as, but not limited to, a human being or an animal.
- the animal may be a domestic animal or may be a breeding animal, pet, cattle, poultry or the like.
- a preferred subject is a human being and may be a newborn, a juvenile, an adult or an aged subject.
- the agent that increases the intracellular pH and/or the pH of the intracellular compartment may be any agent known to the person skilled in the art that effectively increases the intracellular pH and/or the pH of the intracellular compartment.
- the agent that increases the intracellular pH and/or the pH of the intracellular compartment is an alkalizing agent, preferably an lysosomotropic alkalizing agent, preferably selected from the group of chloroquine, bafilomycin Al, ammonium chloride; a more preferred alkalizing agent is chloroquine.
- a preferred alkalyzing agent is one that is capable of entering the host cell and more preferably is targeted to the intracellular compartment wherein the infecting bacterium is present.
- the alkalizing agent may passively enter the cell or a vehicle may be used.
- the vehicle may be any vehicle known to a person skilled in the art that enables delivery into a host cell.
- low pH in the embodiments of the invention is defined as a pH that is lower than pH 7.4; preferably low pH is about pH 7.0, 6.8, 6.6, 6.4, 6.2, 6.0, 5.8, 5.6, 5.4, 5.2, 5.0, 4.8, 4.6, 4.4, 4.2, 4.0, 3.8, 3.6, 3.4, 3.2, 3.0 or about 2.8.
- a low pH is preferably a pH lower than about 6.5
- a more preferred low pH is about 5.0.
- the term raising the pH and increasing the pH are used interchangeably and are defined as raising the pH about 0.2, 0.4, 0.6, 0.8, 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4, 3.6, 3.8, 4.0, 4.2, 4.4, 4.6 or about 4.8.
- the pH is raised to within the range of about pH 6 to about7; preferably to within the range of about 6.5 to about 7
- an effective amount in the embodiments of the invention in the context of an agent that increases the intracellular pH and/or the pH of an intracellular compartment is defined as any amount that is sufficient to raise the intracellular pH and/or the pH of an intracellular compartment at least about 0.2, 0.4, 0.6, 0.8, 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0 to reach the range as depicted here above..
- the exact amount used will inter alia depend on the agent used and on the bodyweight of the subject.
- an effective amount in the embodiments of the invention in the context of a bactericidal agent is defined as any amount that is sufficient to have a bactericidal affect intracellularly and/or within the intracellular compartment. The exact amount used will inter alia depend on the agent used and on the bodyweight of the subject.
- Intracellular pH and the pH of an intracellular compartment can be assessed by any means known to the person skilled in the art.
- the bactericidal agent may be any bactericidal agent known to the person skilled in the art and preferably is a bactericidal agent capable of entering the host cell and/or the intracellular compartment of the host cell.
- a preferred bactericidal agent is a chimeric bactericidal agent.
- a preferred bactericidal agent is selected from the group consisting of a bacteriocin or a functional part thereof, a bacterial lysin or autolysin or a functional part thereof, a bacteriophage lysin or a functional part thereof, a viral lysin or a part thereof, an antimicrobial peptide and an antibiotic.
- a further preferred bactericidal agent is a bacteriophage derived lytic structural protein (such as a tail lysin and a virion associated lytic protein) or an isolated lytic domain from such lytic structural protein or bacteriophage lysin.
- the bactericidal agents of the invention may be used alone or may be used in combinations of two or three or more bactericidal agents of the invention.
- a preferred bactericidal agent is one that is capable of entering the host cell and more preferably is targeted to the intracellular compartment wherein the infecting bacterium is present.
- the bactericidal agent may passively enter the cell or a vehicle may be used.
- the vehicle may be any vehicle known to a person skilled in the art that enables delivery into a host cell.
- the antibiotic may be any antibiotic known to the person skilled in the art.
- a preferred antibiotic is selected from the group consisting of beta-lactam antibiotics such as penicillin derivatives, cephalosporins, monobactams, carbapenems, vancomycins, daptomycin, fluoroquinolones, metronidazole, nitrofurantoin, co-trimoxazole, telithromycin, aminoglycosidic antibiotics; a more preferred antibiotic is flucloxacillin.
- the bacteriocin may be any bacteriocin known to the person skilled in the art, preferably a bacteriocin of any Class I -IV.
- Class I bacteriocins herein are small peptide inhibitors and include nisin and other lantibiotics.
- Class II bacteriocins herein are small ( ⁇ 10 kDa) heat-stable proteins. This class is subdivided into five subclassses.
- the class Ila bacteriocins (pediocin-like bacteriocins) are the largest subgroup and contain an N-terminal consensus sequence -Tyr-Gly-Asn- Gly-Val-Xaa-Cys across this group. The C-terminal is responsible for species-specific activity, causing cell-leakage by permeabilizing the target cell wall.
- the class lib bacteriocins two-peptide bacteriocins require two different peptides for activity.
- lactococcin G which permeabilizes cell membranes for monovalent ions such as Na and K, but not for divalents ones. Almost all of these bacteriocins have a GxxxG motif. This motif is also found in transmembrane proteins where they are involved in helix-helix interactions. The bacteriocin's GxxxG motif can interact with the motifs in the membranes of the bacterial cells and kill the bacteria by doing so. Class lie encompasses cyclic peptides, which possesses the N-terminal and C-terminal regions covalentely linked. Enterocin AS-48 is the prototype of this group.
- Class lid cover single- peptide bacteriocins, which are not post-translated modified and do not show the pediocin-like signature.
- the best example of this group is the highly stable aureocin A53. This bacteriocin is stable under highly acidic environment (HC1 6 N), not affected by proteases and thermoresistant.
- the most recently proposed subclass is the Class He, which encompasses those bacteriocins composed by three or four non-pediocin like peptides.
- aureocin A70 a four-peptides bacteriocin, highly active against L. monocytogenes, with potential biotechnological applications.
- Class III bacteriocins are large, heat-labile (>10 kDa) protein bacteriocins. This class is subdivided in two subclasses: subclass Ilia or bacteriolysins and subclass Illb.
- Subclass Ilia comprises those peptides that kill bacterial cells by cell-wall degradation, thus causing cell lysis.
- the best studied bacteriolysin is lysostaphin, a 27 kDa peptide that hydro lises several Staphylococcus spp. cell walls, principally S. aureus.
- Subclass Illb in contrast, comprises those peptides that do not cause cell lysis, killing the target cells by disrupting the membrane potential, which causes ATP efflux .
- Class IV bacteriocins are defined as complex bacteriocins containing lipid or carbohydrate moities. Confirmatory experimental data was only recently established with the characterisation of Sublancin and Glycocin F (GccF) by two independent groups.
- a preferred bacteriocin is selected from the group consisting of an acidocin, actagardine, agrocin, alveicin, aureocin, aureocin A53, aureocin A70, carnocin, carnocyclin circularin A, colicin, Curvaticin, divercin, duramycin, Enterocin, enterolysin, epidermin/gallidermin, erwiniocin, gassericin A, glycinecin, halocin, haloduracin, lactocin S, lactococin, lacticin, leucoccin, lysostaphin macedocin, mersacidin, mesentericin, microbisporicin, microcin S, mutacin, nisin, paenibacillin, planosporicin, pediocin, pentocin, plantaricin, pyocin, reutericin 6, saka
- the antimicrobial peptide may be any antimicrobial peptide known to the person skilled in the art. Sometimes in the art, antimicrobial peptides are considered bacteriocins as listed here above.
- a preferred antimicrobial peptide is selected from the group consisting of a cationic or polycationic peptide, an amphipatic peptide, a sushi peptide, a defensin and a hydrophobic peptide.
- the bacterial autolysin may be any a bacterial autolysin known to the persons killed in the art.
- a preferred bacterial autolysin is LytM.
- the bacteriophage lysin may be any bacteriophage lysin known to the persons skilled in the art.
- the terms bacteriophage lysin, bacteriophage endo lysin and endo lysin are used interchangeably.
- a preferred endo lysin is selected from the group defined in WO2012/150858, in WO2013/169104, in WO2011/023702, and in WO2012146738, which are herein incorporated by reference with their entire content.
- the bactericidal agent may be any agent described here above or be a functional fragment thereof.
- the term functional fragment is interchangeably used with the term functional domain.
- a functional fragment is herein defined as a fragment that still has at least 20, 30, 40, 50, 60, 70, 80, 90, 95, or 99, or at least or 99.9% bactericidal activity as compared to the parent wherefrom the functional fragment is derived when assayed in identical conditions.
- Preferred functional fragments of bactericidal agents are described in WO2012/150858 and in WO2013/169104.
- the bactericidal agent may be a fusion of a bactericidal agent and a functional fragment of bactericidal agents or may be a fusion of different, similar or identical bactericidal agents or of functional fragments of bactericidal agents.
- a preferred means is a protein transduction domain that is operably linked to the bactericidal agent; further referred to herein as a protein transduction domain according to the invention.
- the term "protein transduction domain” is herein interchangeably used with the term “cell permeable protein (CPP)” and with the term “membrane translocating sequence”. Operably linked is defined herein as such association of the protein transduction domain with the bactericidal agent that the bactericidal agent is targeted into the cell.
- a preferred operable linkage is fusion by means of covalent binding of the protein transduction domain to the bactericidal agent.
- the bactericidal agent preferably comprises a functional enzymatic domain of a cell wall lytic enzyme.
- a cell wall lytic enzyme is herein defined as any bactericidal agent that acts upon the cell wall of the bacterium it is effective against.
- the bactericidal agent comprises a functional domain from a cell wall lytic enzyme and further comprises a protein transduction domain according to the invention.
- the bactericidal agent may further comprise an antimicrobial peptide.
- Such fusion bactericidal agent preferably is a cell wall lytic enzyme fused to an antimicrobial peptide selected from the group consisting of a cationic or polycationic peptide, an amphipatic peptide, a sushi peptide, a defensin and a hydrophobic peptide, more preferably a fusion protein as defined in US8,383,102 which is herein incorporated by reference in its entirety.
- Such bactericidal agent fused to an antimicrobial peptide may further comprise a protein transduction domain according to the invention.
- the bactericidal agent as described here above comprising a functional enzymatic domain of a cell wall lytic enzyme and/or comprising a protein transduction domain and/or comprising an antimicrobial peptide, may further preferably further comprises a cell wall binding domain.
- Said cell wall binding domain preferably is a cell wall binding domain that binds the peptidoglycan cell wall of the bacteria causing the bacterial infection to be treated.
- the protein transduction domain may be any such domain known to the person skilled in the art.
- the protein transduction domain is selected from the group consisting of SEQ ID NO: 12 - 25, or a variant thereof, wherein the variant is a functional protein transduction domain and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 12 - 25, respectively.
- the functional enzymatic domain from a cell wall lytic enzyme is selected from the group consisting of SEQ ID NO: 1 - 7, or a variant thereof, wherein the variant is a functional enzymatic domain from a cell wall lytic enzyme and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 1 - 7, respectively.
- the cell wall binding domain is selected from the group consisting of SEQ ID NO: 8 - 11, or a variant thereof, wherein the variant is a functional cell wall binding domain and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 8 - 1 1 , respectively.
- the antimicrobial peptide is selected from the group consisting of SEQ ID NO: 70 - 90, or a variant thereof, wherein the variant is a functional cell wall binding domain and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 70 - 90, respectively.
- a preferred bactericidal agent according to the invention is a bactericidal agent with at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%) sequence identity with a sequence selected from the group consisting of SEQ ID NO: 27, 28, 29, 30 - 47, or is a bactericidal agent encoded by polynucleotide sequence with at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%o, 97%), 98%o, 99%) or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 50 - 67.
- a preferred bactericidal agent according to the invention is an expression product from a vector with a sequence of at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 91 - 108.
- a further preferred bactericidal agent according to the invention is one selected from the group consisting of a bactericidal agent comprising a protein transduction domain selected from the group consisting of SEQ ID NO: 12 - 25, or a variant thereof, a functional enzymatic domain from a cell wall lytic enzyme selected from the group consisting of SEQ ID NO: 1 - 7, or a variant thereof and, optionally, a cell wall binding domain selected from the group consisting of SEQ ID NO: 8 - 1 1 , or a variant thereof and/or an antimicrobial peptide selected from the group consisting of SEQ ID NO: 70 - 90, or a variant thereof; wherein a variant has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with the respective original sequence.
- this aspect relates to the embodiments of this aspect for the manufacture of a medicament for the treatment of a bacterial infection in a subject in need thereof. Further to a method of treatment, this aspect relates to the embodiments of this aspect for use in the treatment of a bacterial infection in a subject in need thereof.
- the invention provides for a chimeric bactericidal polypeptide comprising a functional enzymatic domain from a cell wall lytic enzyme selected from the group consisting of SEQ ID NO: 1 - 7, or a variant thereof, wherein the variant is a functional enzymatic domain from a cell wall lytic enzyme and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 1 - 7, respectively; and a protein transduction domain selected from the group consisting of SEQ ID NO: 12 - 25, or a variant thereof, wherein the variant is a functional protein transduction domain and has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 1
- the invention further provides for a chimeric bactericidal polypeptide having at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or 100%) sequence identity with a sequence selected from the group consisting of SEQ ID NO: 27, 28, 29, 30 - 47, or a chimeric bactericidal agent encoded by polynucleotide sequence with at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%o, 97%), 98%o, 99%) or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 50 - 67.
- the invention further provides for a chimeric bactericidal polypeptide selected from the group consisting of a bactericidal agent comprising a protein transduction domain selected from the group consisting of SEQ ID NO: 12 - 25, or a variant thereof, a functional enzymatic domain from a cell wall lytic enzyme selected from the group consisting of SEQ ID NO: 1 - 7, or a variant thereof and, optionally, a cell wall binding domain selected from the group consisting of SEQ ID NO: 8 - 11, or a variant thereof and/or an antimicrobial peptide selected from the group consisting of SEQ ID NO: 70 - 90, or a variant thereof; wherein a variant has at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with the respective original sequence.
- the invention further provides for a polynucleotide encoding a chimeric bactericidal polypeptide according to this aspect of the invention.
- the invention further provides for a polynucleotide construct comprising a polynucleotide encoding a chimeric bactericidal polypeptide according to the invention.
- the invention further provides for a vector for expression and production of a chimeric bactericidal polypeptide according to the invention.
- a vector according to the invention preferably comprises a polynucleotide construct according to the invention comprising a polynucleotide encoding a chimeric bactericidal polypeptide according to the invention.
- a preferred vector according to the invention is a vector with a sequence of at least 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity with a sequence selected from the group consisting of SEQ ID NO: 91 - 108.
- the invention further provides for a host cell for the production of a chimeric bactericidal polypeptide according to the invention, comprising a polynucleotide construct or a vector according to the invention.
- the host cell may be any host cell suitable for the production of a chimeric bactericidal polypeptide according to the invention such a prokaryotic and a eukaryotic host cell.
- the invention further provides for the production of a chimeric bactericidal polypeptide according to the invention, comprising culturing a host cell according to the invention, comprising a polynucleotide construct or a vector according to the invention under conditions conducive to the production of the a chimeric bactericidal polypeptide according to the invention and, optionally, isolating and/or purifying the chimeric bactericidal polypeptide produced.
- any suitable route of administration can be used to administer the alkalizing agent according to the invention and the bactericidal agent according to the invention including but not limited to: oral, aerosol or other device for delivery to the lungs, nasal spray, intravenous, intramuscular, intraperitoneal, intrathecal, vaginal, rectal, topical, lumbar puncture, intrathecal, and direct application to the brain and/or meninges.
- the alkalizing agent according to the invention and the bactericidal agent the invention may be administered to a subject in need thereof or to a cell, tissue or organ of said subject at least once a day, once a week, once a month, once every six months, once a year or whatever regime is suitable for the treatment.
- the word "about” or “approximately” when used in association with a numerical value preferably means that the value may be the given value (of 10) more or less 0.1% of the value.
- sequence identity with a particular sequence preferably means sequence identity over the entire length of said particular polypeptide or polynucleotide sequence.
- sequence information as provided herein should not be so narrowly construed as to require inclusion of erroneously identified bases. The skilled person is capable of identifying such erroneously identified bases and knows how to correct for such errors.
- similarity between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one peptide or polypeptide to the sequence of a second peptide or polypeptide. Preferably, identity or similarity is calculated over the whole SEQ ID NO as identified herein.
- Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include e.g. the GCG program package (Devereux, J., et al, Nucleic Acids Research 12 (1): 387 (1984)), BestFit, BLASTP, BLASTN, and FASTA (Altschul, S. F. et al, J. Mol. Biol. 215:403-410 (1990).
- the BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al, NCBI NLM NIH Bethesda, MD 20894; Altschul, S., et al, J. Mol. Biol. 215:403-410 (1990).
- the well-known Smith Waterman algorithm may also be used to determine identity.
- Preferred parameters for polypeptide sequence comparison include the following: Algorithm: Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970); Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad. Sci. USA. 89: 10915-10919 (1992); Gap Penalty: 12; and Gap Length Penalty: 4.
- a program useful with these parameters is publicly available as the "Ogap" program from Genetics Computer Group, located in Madison, WI. The aforementioned parameters are the default parameters for amino acid comparisons (along with no penalty for end gaps).
- amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and iso leucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine- leucine-iso leucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
- Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place.
- the amino acid change is conservative.
- Preferred conservative substitutions for each of the naturally occurring amino acids are as follows: Ala to ser; Arg to lys; Asn to gin or his; Asp to glu; Cys to ser or ala; Gin to asn; Glu to asp; Gly to pro; His to asn or gin; He to leu or val; Leu to ile or val; Lys to arg; gin or glu; Met to leu or ile; Phe to met, leu or tyr; Ser to thr; Thr to ser; Trp to tyr; Tyr to trp or phe; and, Val to ile or leu.
- a polynucleotide is represented by a nucleotide sequence.
- a polypeptide is represented by an amino acid sequence.
- CBD CBD2638 GGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAE
- CPP 1 Kala WEAKLAKALAKALAKHLAKALAKALKACEA
- Ami-TAT Vector construct see sequence listing
- FIGURE LEGENDS Figure 1 A first figure.
- MRSA S. aureus strains 6850 (a), JE2 (b) and Cowan (c) were inoculated in media buffered at different pH as indicated. Colony phenotypes of viable bacteria were determined and the percentage of SCVs plotted over time. Three independent experiments done in triplicates are presented as mean ⁇ SEM.
- A549 cells were infected with S. aureus Cowan and extracellular bacteria were killed by addition of flucloxacillin.
- the number (a) and phenotype (b) of viable intracellular persisting bacteria were determined at indicated time points. Data are pooled from two experiments performed in triplicates, mean ⁇ SEM.
- S. aureus Cowan-infected A549 cells were treated with flucloxacillin alone (control) or supplemented with lysosomotropic alkalinizing agents (chloroquine (a), bafilomycin Al (b) and ammonium chloride (c)). Colony phenotypes of viable intracellular persisting bacteria were determined and enumerated at indicated time points. Data were pooled from three independent experiments done in triplicates, mean ⁇ SEM. Two-way ANOVA found the factors time and treatment to be significant (p-value ⁇ 0.01). Figure 4
- Intracellular targeting of S. aureus in osteosarcoma cells by mixtures of engineered endolysins.
- A Cells infected for 24h with S. aureus Newman treated by endolysin mixtures for 4h.
- B Cells infected for 24h with S. aureus Newman treated by endolysin mixtures for 4h in the presence of 20 ⁇ chloroquine.
- C Cells infected for 72h with S. aureus Cowan treated by endolysin mixtures for 4h.
- D Cells infected for 72h with S. aureus Cowan treated by endolysin mixtures for 4h in the presence of 20 ⁇ chloroquine.
- Activity of bactericidal agents according to the invention comprising a functional enzymatic domain from a cell wall lytic enzyme and further comprising a protein transduction domain on the N-terminal side of the molecule: (A) R9-CHAP-CBD, (B) R9-M23-CBD, (C) TAT-Ami-CBD, (D) TAT-CHAP-CBD, and (E) TAT-M23-CBD.
- S. aureus Cowan The pH-dependent growth of S. aureus Cowan was followed over time by labeling the bacterial cell wall with fluorescent cell wall binding domains (CBDs). Immediately after staining, bacterial cell walls were fully labeled. After three days in pH 4.0 growth medium, the majority of bacteria still exhibited fluorescent cell walls, consistent with absent bacterial replication. In contrast, bacteria grown at pH 7.4 proliferated extensively, demonstrated by highly fragmented and89 reduced fluorescent cell wall labeling . Scanning electron microscopy (SEM) of bacteria originating from a small colony, obtained under low-pH conditions, showed impaired cell division resulting in rod-shaped S. aureus, in contrast to large colony bacteria showing normal cell division.
- SEM scanning electron microscopy
- MSSA strain Cowan is highly invasive, but not cytotoxic which allowed maintaining this strain intracellularly over several days in the lung epithelial cell line A549. Extracellular bacteria were killed by adding a high dose of flucloxacillin to the infected host cells. Flucloxacillin is typically used to treat S. aureus endocarditis in patients. Absence of extracellular bacteria was confirmed by sterility of culture supernatants. Host cells were lysed to release intracellular bacteria and colony counts, as well as colony phenotypes, were determined at various time points. Five hours after infection, 0.2% of all viable intracellular bacteria had a SCV phenotype (Fig. 2a - b). The number of viable intracellular persisting bacteria decreased during the course of infection while the frequency of SCVs increased and reached 5.6% after seven days.
- Persisting bacteria are not unique to S. aureus but have also been described to occur in various other human pathogens, such as Salmonella spp., Pseudomonas aeruginosa, Escherichia coli and Mycobacterium tuberculosis.
- Salmonella spp. Pseudomonas aeruginosa
- Escherichia coli Escherichia coli
- Mycobacterium tuberculosis bacterial persisters can arise due to mechanisms that include the toxin- antitoxin systems. Accordingly, activation of a SOS response (ppGpp) in response to DNA damage due to oxidative stress results in decreased ATP levels. This leads to the shutdown of metabolism resulting in reduced growth.
- ppGpp SOS response
- Various toxin-antitoxin modules are activated by acidification and/or nutrient starvation in Salmonella, causing formation of persisters.
- Salmonella persister formation has been reported in macrophages triggered by the acidic and nutritionally poor environment of the Salmonella-containing vacuole that was reversible by addition of bafilomycin Al 44.
- chloroquine is routinely used in patients to treat malaria as well as some rheumatic diseases. Phago lysosomal pH neutralization with chloroquine may therefore provide a novel therapeutic eradication strategy against intracellular persisting staphylococcal reservoirs.
- the bactericidal agents according to the invention with a protein transduction domain for efficient delivery into the infected host cell with a sequence selected from the group consisting of SEQ ID NO: 30 - 47 are used for combination with phago lysosomal pH neutralization for treatment of intracellular S. aureus infection in vitro and in vivo.
- the treatment results in effective treatment of the intracellular S. aureus infection, with some variety in the efficiency depending on the specific bactericidal agent according to the invention used.
- the bactericidal agents according to the invention with a protein transduction domain for efficient delivery into the infected host cell with a sequence selected from the group consisting of SEQ ID NO: 27 - 47 were used for treatment of intracellular S. aureus infection, either combined or not with phago lysosomal pH neutralization.
- S. aureus was grown in LB broth at 37 °C, shaking at 220 rpm, overnight. The overnight culture was diluted in fresh LB (1 :10) and grown further for 2 h. Then, the bacteria were centrifuged, the pellet was washed with PBS and the culture was re-suspended in PBS with the OD600 adjusted to 0.4 (c.a. 2> ⁇ 10 8 CFU/mL). Bacterial cells were sonicated prior to infection (SONOPULS HD 2070) for 1 minute with 1 second pulses at 40% of the power.
- MG-63 osteosarcoma cells were grown in 12-well dishes with the amount of 5 ⁇ 10 5 cells/well in 1 mL EMEM culture media with 10 % fetal bovine serum (FBS) for 24 h prior infection. Then, the cells were infected with S. aureus Newman and Cowan at the following conditions: (A) S. aureus Newman at MOI of 0.1 for 3 h, (B) S. aureus Newman at MOI of 1.0 for 24 h, and (C) S. aureus Cowan at MOI of 1.0 for 72 h. The plates were centrifuged at 1200 rpm for 5 min and incubated at 37 °C with the flush of C02.
- Eukaryotic cells were treated with 1 mL of 1 ⁇ endolysin preparation (diluted in EMEM supplemented with 1 mg/mL floxacillin and +/- 20 ⁇ chloroquine) for (A) lh and 4h, (B and C) 4h.
- the control was treated with 1 mL of 1 mg/mL floxacillin, +/- 20 ⁇ chloroquine in EMEM.
- the cultures were then washed 3 X with PBS and examined under microscope to determine if there had been osteoblast cell lysis. Next, they were trypsinized (Trypsin-EDTA 0.25%, Gibco®) and lysed with 800 ⁇ , 0.1 % Triton X-100.
- the cell lysate was subjected to serial dilution plating on LB and overnight incubation at 37 °C. Table 2 Composition of the endolysin mixtures used for intracellular eradication of S. aureus.
- MG-63 osteosarcoma cells were used to mimic the condition of osteomyelitis. Cells were first infected for a certain time with the pathogen S. aureus Newman or Cowan and then treated with the endolysin mixture in presence or absence of chloroquine. We expected that increasing intracellular pH by application of chloroquine would create more favorable conditions for endolysin activity.
- Osteosarcoma cells were exposed to S. aureus Newman and Cowan for 3 h followed by 2 h floxacillin treatment to inactivate any non- internalized bacteria. Then, the tissue cells were treated for 1 h and 4 h with 1 ⁇ of endolysin mixture with and without chloroquine. The results are shown in Figure 5.
- Figure 5 A shows the result of treatment of S. aureus Newman by endolysin mixtures exclusively and
- Figure 5B shows the result of a combination treatment with chloroquine.
- 4h treatment was more effective in both experimental settings.
- endolysin treatment in the presence of chloroquine resulted in greater decrease in bacterial counts.
- CPP-free endolysins showed a very good killing efficacy, which was not expected. It is, however, possible that the vast amount of positive charge associated with CBD attracts the enzyme to the negatively charged cell membrane and induces its intracellular translocation. Such a putative mechanism for CPP-free endolysin translocation is the key of the translocation of CPPs. All endolysin mixtures displayed similar killing properties in this assay, even though their activity differed substantially depending on the presence of CBD and type of CPP tag. It is likely that different constructs have different penetrating properties, depending on the CPP, EAD and CBD presence.
- EAD-CBD mixture has very high activity but might not be transported via the cell membrane as efficient as any CPP-containing variants.
- EAD-CPP constructs do not have as high activity but are smaller and contain the transduction domain, which make their intracellular transport more efficient and their diffusivity better due to the lack of immobilization of the enzyme on the cell surface mediated by CBD binding.
- enzymes with different properties might have given similar results eventually.
- Figure 5C and Figure 5D show the results of the same experiment performed with a different strain of the pathogen: S. aureus Cowan. In this case, the treatment did not seem to be effective.
- FIG. 6A and Figure 6B show the results of the treatment of osteosarcoma cells infected for 24 h with S. aureus Newman in absence and in presence of chloroquine, respectively.
- Figure 6C and Figure 6D correspond to the results of treated cells infected for 72 h with S. aureus Cowan. In both cases treatment with endolysin mixtures seems effective, especially with the addition of chloroquine.
- bactericidal agents according to the invention comprising a functional enzymatic domain from a cell wall lytic enzyme and further comprising a protein transduction domain on the N-terminal side of the molecule were prepared and analyzed according to methods as described elsewhere herein (R9-CHAP-CBD, R9-M23-CBD, TAT-Ami- CBD, TAT-CHAP-CBD, and TAT-M23-CBD). All data were collected in turbidity reduction assays on S. aureus SA113 substrate cells and at ⁇ protein concentrations (except Ami-CBD constructs where 1 ⁇ was used) according as described previously in WO2013/169104. Figure 7 depicts the performance of the constructs.
- the N-terminal CPP tagged proteins are active, but perform less compared to un-tagged or C-terminal tagged variants when analyzed on S. aureus cells.
- the constructs should be tested in an intracellular S. aureus killing assay as in example 3.
- Vesga, O., et al. Staphylococcus aureus small colony variants are induced by the endothelial cell intracellular milieu. J Infect Dis 173, 739-742 (1996).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2017547980A JP2018509415A (ja) | 2015-03-12 | 2016-03-10 | 細菌感染の治療方法 |
| BR112017019413-9A BR112017019413B1 (pt) | 2015-03-12 | 2016-03-10 | Uso de um agente que aumenta o ph intracelular de uma célula hospedeira e/ou de um compartimento intracelular de uma célula hospedeira e de um agente bactericida para o tratamento de uma infecção bacteriana |
| CA2979873A CA2979873C (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| EP16709389.7A EP3268023B1 (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| SG11201707345VA SG11201707345VA (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| KR1020177028879A KR102683284B1 (ko) | 2015-03-12 | 2016-03-10 | 세균 감염의 치료를 위한 살세균제와 라이소좀향성 알칼리화제와의 조합물 |
| AU2016231141A AU2016231141B2 (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| US15/557,296 US11690899B2 (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| HK18108776.3A HK1249033B (en) | 2015-03-12 | 2016-03-10 | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection |
| CN201680026953.2A CN107580503B (zh) | 2015-03-12 | 2016-03-10 | 用于治疗细菌感染的杀菌剂与亲溶酶体碱化剂的组合 |
| IL254457A IL254457B (en) | 2015-03-12 | 2017-09-12 | A combination of a bactericide and a lysosomotropic alkaline agent for the treatment of bacterial infection |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15158880 | 2015-03-12 | ||
| EP15158880.3 | 2015-03-12 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016142445A2 true WO2016142445A2 (en) | 2016-09-15 |
| WO2016142445A3 WO2016142445A3 (en) | 2016-11-10 |
Family
ID=52648929
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/055076 Ceased WO2016142445A2 (en) | 2015-03-12 | 2016-03-10 | A method of treatment of a bacterial infection |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US11690899B2 (enExample) |
| EP (1) | EP3268023B1 (enExample) |
| JP (1) | JP2018509415A (enExample) |
| KR (1) | KR102683284B1 (enExample) |
| CN (1) | CN107580503B (enExample) |
| AU (1) | AU2016231141B2 (enExample) |
| IL (1) | IL254457B (enExample) |
| SG (1) | SG11201707345VA (enExample) |
| WO (1) | WO2016142445A2 (enExample) |
Cited By (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018091707A1 (en) * | 2016-11-18 | 2018-05-24 | Lysando Ag | New antimicrobial agents against staphylococcus aureus |
| WO2019068875A1 (en) | 2017-10-06 | 2019-04-11 | Micreos Human Health B.V. | TREATMENT OF A HEALTH CONDITION ASSOCIATED WITH INFECTION BY ONCOGENIC BACTERIA |
| WO2019084343A1 (en) * | 2017-10-25 | 2019-05-02 | The Administrators Of The Tulane Educational Fund | PEPTIDE COMPOSITIONS AND METHODS OF USE THEREOF |
| WO2021185948A1 (en) | 2020-03-19 | 2021-09-23 | Micreos Human Health B.V. | A stabilized protein of interest |
| US11149068B2 (en) | 2018-01-05 | 2021-10-19 | The Administrator Of The Tulane Educational Fund | Pore-forming peptides and uses thereof |
| WO2024133850A1 (en) * | 2022-12-23 | 2024-06-27 | Micreos Pharmaceuticals Ag | A chimeric endolysin polypeptide |
| WO2024200687A1 (en) * | 2023-03-29 | 2024-10-03 | Universiteit Gent | Chimeric endolysins with activity against streptococci and staphylococci |
| WO2024241070A1 (en) | 2023-05-22 | 2024-11-28 | L'oreal | Cosmetic composition comprising an endolysin and a polyvinyl alcohol |
| WO2024246349A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and an organic filler |
| WO2024246325A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and an aromatic alcohol |
| WO2024246305A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and an oil |
| WO2024246335A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and a compound of formula (i) |
| WO2024246336A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and a nonionic surfactant comprising a carbohydrate residue |
| FR3149203A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition anhydre comprenant une endolysine et de l’hydroxypropylmethylcellulose et/ou du pullulane |
| FR3149209A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et un alcool aromatique |
| FR3149206A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique aqueuse comprenant une endolysine et du tréhalose |
| FR3149208A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique, notamment aqueuse, comprenant une endolysine et un pullulane |
| WO2025045893A1 (en) | 2023-08-28 | 2025-03-06 | L'oreal | Cosmetic composition comprising an endolysin and hydrophobic silica aerogel particles |
| WO2025045889A1 (en) | 2023-08-28 | 2025-03-06 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and a polyhydroxyalkane |
| FR3152393A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine dérivée d’un phage de Staphylococcus aureus et une charge minérale |
| FR3152395A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et la 4-hydroxyacetophenone |
| WO2025093666A1 (en) | 2023-11-01 | 2025-05-08 | University Of Copenhagen | Treatment of lymphoma |
| WO2026052743A1 (en) | 2024-09-04 | 2026-03-12 | Micreos Human Health B.V. | Reduction of trans-epidermal water loss by a polypeptide with antibacterial properties |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7131803B2 (ja) * | 2018-05-15 | 2022-09-06 | 学校法人大阪医科薬科大学 | Gb3蓄積起因性疾患の予防又は治療剤 |
| MX2020014006A (es) * | 2018-06-29 | 2021-05-27 | Res Inst Nationwide Childrens Hospital | Composiciones y métodos para mediar la eps. |
| CN109350618B (zh) * | 2018-12-10 | 2021-09-28 | 山东农业大学 | 自噬调节剂在消除牛乳腺上皮细胞内金黄色葡萄球菌中的应用 |
| CN120136980A (zh) * | 2019-05-08 | 2025-06-13 | 生物技术公司 | 新的加德纳菌内溶素及其用途 |
| GB201906653D0 (en) * | 2019-05-10 | 2019-06-26 | Cc Biotech Ltd | Polypeptides for treatment of bacterial infections |
| WO2024020533A1 (en) * | 2022-07-22 | 2024-01-25 | Endolytix Technology, Inc. | Immunogenic compositions for treating or preventing actinomycetia infections |
| CN120513297A (zh) * | 2023-01-09 | 2025-08-19 | 华中农业大学 | 细菌裂解酶及其应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011023702A1 (en) | 2009-08-24 | 2011-03-03 | Katholieke Universiteit Leuven, K.U. Leuven R&D | New endolysin obpgplys |
| WO2012146738A1 (en) | 2011-04-27 | 2012-11-01 | Lysando Holding Ag | New antimicrobial agents |
| WO2012150858A1 (en) | 2011-05-04 | 2012-11-08 | Micreos Human Health B.V. | A polypeptide |
| US8383102B2 (en) | 2009-05-21 | 2013-02-26 | The United States Of America As Represented By The Secretary Of Agriculture | Fusion of peptidoglycan hydrolase enzymes to a protein transduction domain allows eradication of both extracellular and intracellular gram positive pathogens |
| WO2013169104A1 (en) | 2012-05-07 | 2013-11-14 | Micreos Human Health B.V. | Polypeptide mixes with antibacterial activity |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20020187136A1 (en) * | 2000-04-28 | 2002-12-12 | Lawrence Loomis | Use of bacterial phage associated lysing enzymes for treating various illnesses |
| US20040023897A1 (en) * | 2001-11-13 | 2004-02-05 | Caplan Michael J. | Methods for preventing or treating disease mediated by toxin-secreting bacteria |
| KR100759988B1 (ko) * | 2006-08-04 | 2007-09-19 | 주식회사 인트론바이오테크놀로지 | 황색포도상구균에 특이적인 항균 단백질 |
| US20100028334A1 (en) * | 2006-12-15 | 2010-02-04 | Trustees Of Boston University | Compositions and methods to potentiate colistin activity |
| EP2338916A1 (en) | 2009-12-23 | 2011-06-29 | Hyglos Invest GmbH | Chimeric polypeptides and their use in bacterial decoloniation |
| KR20210121313A (ko) * | 2012-05-09 | 2021-10-07 | 콘트라펙트 코포레이션 | 그람 양성 박테리아에 대한 박테리오파지 리신과 항생제의 병용물 |
| US9603909B2 (en) * | 2012-05-29 | 2017-03-28 | Intron Biotechnology, Inc. | Composition capable of improving stability of bacteriophage lysin proteins |
| US9206411B2 (en) * | 2012-06-13 | 2015-12-08 | The United States Of America, As Represented By The Secretary Of Agriculture | Staphylococcal Phage2638A endolysin amidase domain is lytic for Staphylococcus aureus |
| EP2679677A1 (en) | 2012-06-29 | 2014-01-01 | Lysando Aktiengesellschaft | Composition for use in Mycobacteria therapy |
| US20160097044A1 (en) | 2014-10-01 | 2016-04-07 | The United States Of America, As Represented By The Secretary Of Agriculture | Antimicrobial Enzyme Fusions Reduce Resistance and Kill Intracellular Staphylococcus aureus |
-
2016
- 2016-03-10 SG SG11201707345VA patent/SG11201707345VA/en unknown
- 2016-03-10 EP EP16709389.7A patent/EP3268023B1/en active Active
- 2016-03-10 AU AU2016231141A patent/AU2016231141B2/en active Active
- 2016-03-10 WO PCT/EP2016/055076 patent/WO2016142445A2/en not_active Ceased
- 2016-03-10 US US15/557,296 patent/US11690899B2/en active Active
- 2016-03-10 CN CN201680026953.2A patent/CN107580503B/zh active Active
- 2016-03-10 JP JP2017547980A patent/JP2018509415A/ja active Pending
- 2016-03-10 KR KR1020177028879A patent/KR102683284B1/ko active Active
-
2017
- 2017-09-12 IL IL254457A patent/IL254457B/en active IP Right Grant
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8383102B2 (en) | 2009-05-21 | 2013-02-26 | The United States Of America As Represented By The Secretary Of Agriculture | Fusion of peptidoglycan hydrolase enzymes to a protein transduction domain allows eradication of both extracellular and intracellular gram positive pathogens |
| WO2011023702A1 (en) | 2009-08-24 | 2011-03-03 | Katholieke Universiteit Leuven, K.U. Leuven R&D | New endolysin obpgplys |
| WO2012146738A1 (en) | 2011-04-27 | 2012-11-01 | Lysando Holding Ag | New antimicrobial agents |
| WO2012150858A1 (en) | 2011-05-04 | 2012-11-08 | Micreos Human Health B.V. | A polypeptide |
| WO2013169104A1 (en) | 2012-05-07 | 2013-11-14 | Micreos Human Health B.V. | Polypeptide mixes with antibacterial activity |
Non-Patent Citations (44)
| Title |
|---|
| "326 and oxacillin against Staphylococcus aureus in pharmacodynamic models of extracellular and intracellular infections", THE JOURNAL OF ANTIMICROBIAL CHEMOTHERAPY, vol. 59, 2007, pages 246 - 253 |
| "Biocomputing: Informatics and Genome Projects", 1993, ACADEMIC PRESS |
| "Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS |
| "Computer Analysis of Sequence Data, Part I", 1994, HUMANA PRESS |
| "Nucleic Acid Hybridization" |
| "Oligonucleotide Synthesis" |
| "Sequence Analysis Primer", 1991, M STOCKTON PRESS |
| ALTSCHUL, S. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL, S. ET AL.: "BLAST Manual", NCBI NLM NIH BETHESDA |
| ALTSCHUL, S. F. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", vol. 1, 2, 1994, CURRENT PROTOCOLS |
| BARCIA-MACAY, M.; SERAI, C.; MINGEOT-LECLERCQ, M.P.; TULKENS, P.M.; VAN BAMBEKE, F.: "Pharmacodynamic evaluation of the intracellular activities of antibiotics against Staphylococcus aureus in a model of THP-1 macrophages", ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, vol. 50, 2006, pages 841 - 851 |
| BAUDOUX, P. ET AL., COMBINED EFFECT OF PH AND CONCENTRATION ON THE ACTIVITIES OF GENTAMICIN |
| BROWN: "Molecular Biology LabFax", vol. I, II, 1998, ACADEMIC PRESS |
| CARILLO, H.; LIPMAN, D., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073 |
| CONLON, B.P. ET AL.: "Activated ClpP kills persisters and eradicates a chronic biofilm infection", NATURE, vol. 503, 2013, pages 365 - 370, XP055260381, DOI: doi:10.1038/nature12790 |
| CONLON, B.P.: "Staphylococcus aureus chronic and relapsing infections: Evidence of a role for persister cells: An investigation of persister cells, their formation and their role in S. aureus disease", BIOESSAYS : NEWS AND REVIEWS IN MOLECULAR, CELLULAR AND DEVELOPMENTAL BIOLOGY, vol. 36, 2014, pages 991 - 996 |
| DANTES, R. ET AL.: "National burden of invasive methicillin-resistant Staphylococcus aureus infections, United States", JAMA INTERNAL MEDICINE, vol. 173, 2011, pages 1970 - 1978 |
| DEVEREUX, J. ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, no. 1, 1984, pages 387 |
| FAUVART, M.; DE GROOTE, V.N.; MICHIELS, J.: "Role of persister cells in chronic infections: clinical relevance and perspectives on anti-persister therapies", JOURNAL OF MEDICAL MICROBIOLOGY, vol. 60, 2011, pages 699 - 709 |
| FOWLER, V.G., JR. ET AL.: "Persistent bacteremia due to methicillin-resistant Staphylococcus aureus infection is associated with agr dysfunction and low-level in vitro resistance to thrombin-induced platelet microbicidal protein", THE JOURNAL OF INFECTIOUS DISEASES, vol. 190, 2004, pages 1140 - 1149 |
| GARCIA, L.G. ET AL.: "Antibiotic activity against small-colony variants of Staphylococcus aureus: review of in vitro, animal and clinical data", THE JOURNAL OF ANTIMICROBIAL CHEMOTHERAPY, vol. 68, 2013, pages 1455 - 1464 |
| HENTIKOFF; HENTIKOFF, PROC. NATL. ACAD. SCI. USA., vol. 89, 1992, pages 10915 - 10919 |
| KAHL, B.C. ET AL.: "Thymidine-dependent Staphylococcus aureus small-colony variants are associated with extensive alterations in regulator and virulence gene expression profiles", INFECT IMMUN, vol. 73, 2005, pages 4119 - 4126 |
| KAISER, P. ET AL.: "Cecum lymph node dendritic cells harbor slow-growing bacteria phenotypically tolerant to antibiotic treatment", PLOS BIOLOGY, vol. 12, 2014, pages E1001793 |
| LAM, C.; MATHISON, G.E.: "Effect of low intraphagolysosomal pH on antimicrobial activity of antibiotics against ingested staphylococci", JOURNAL OF MEDICAL MICROBIOLOGY, vol. 16, 1983, pages 309 - 316 |
| LEBEAUX, D. ET AL.: "pH-mediated potentiation of aminoglycosides kills bacterial persisters and eradicates in vivo bio films", THE JOURNAL OF INFECTIOUS DISEASES, vol. 210, 2014, pages 1357 - 1366 |
| LECHNER, S.; LEWIS, K.; BERTRAM, R.: "Staphylococcus aureus persisters tolerant to bactericidal antibiotics", JOURNAL OF MOLECULAR MICROBIOLOGY AND BIOTECHNOLOGY, vol. 22, 2012, pages 235 - 244 |
| LIBRATY, D.H.; PATKAR, C; TORRES, B.: "Staphylococcus aureus reactivation osteomyelitis after 75 years", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 366, 2012, pages 481 - 482 |
| NAZ S.A. ET AL.: "Biophysicochemical characterization of Pyocin SA189 produced by Pseudomonas aeruginosa SA189", BRAZILIAN JOURNAL OF MICROBIOLOGY, vol. 46, 2015, pages 1147 - 1154 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| NGUYEN, H.A. ET AL.: "Factors influencing the intracellular activity of fluoroquinolones: a study using levofloxacin in a Staphylococcus aureus THP-1 monocyte model", THE JOURNAL OF ANTIMICROBIAL CHEMOTHERAPY, vol. 57, 2006, pages 883 - 890, XP055276387, DOI: doi:10.1093/jac/dkl079 |
| PARRET, A.H. ET AL.: "Bacteria killing their own kind: novel bacteriocins of Pseudomonas and other y-proteobacteria", TRENDS IN MICROBIOLOGY, vol. 10, 2002, pages 107 - 112 |
| PROCTOR, R.A. ET AL.: "Small colony variants: a pathogenic form of bacteria that facilitates persistent and recurrent infections", NAT REV MICROBIOL, vol. 4, 2006, pages 295 - 305, XP055227306, DOI: doi:10.1038/nrmicro1384 |
| PROCTOR, R.A.; VAN LANGEVELDE, P.; KRISTJANSSON, M.; MASLOW, J.N.; ARBEIT, R.D.: "Persistent and relapsing infections associated with small-colony variants of Staphylococcus aureus", CLINICAL INFECTIOUS DISEASES : AN OFFICIAL PUBLICATION OF THE INFECTIOUS DISEASES SOCIETY OF AMERICA, vol. 20, 1995, pages 95 - 102 |
| SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual,", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SCHROEDER, A.; KLAND, R.; PESCHEL, A.; EIFF, C.; AEPFELBACHER, M.: "Live cell imaging of phagosome maturation in Staphylococcus aureus infected human endothelial cells: small colony variants are able to survive in lysosomes", MEDICAL MICROBIOLOGY AND IMMUNOLOGY, vol. 195, 2006, pages 185 - 194, XP019443415, DOI: doi:10.1007/s00430-006-0015-0 |
| SINGH, R.; RAY, P.; DAS, A.; SHARMA, M.: "Role of persisters and small-colony variants in antibiotic resistance of planktonic and biofilm-associated Staphylococcus aureus: an in vitro study", JOURNAL OF MEDICAL MICROBIOLOGY, vol. 58, 2009, pages 1067 - 1073 |
| TUCHSCHERR, L. ET AL.: "Staphylococcus aureus phenotype switching: an effective bacterial strategy to escape host immune response and establish a chronic infection", EMBO MOLECULAR MEDICINE, vol. 3, 2011, pages 129 - 141 |
| TUCHSCHERR, L. ET AL.: "Staphylococcus aureus small-colony variants are adapted phenotypes for intracellular persistence", THE JOURNAL OF INFECTIOUS DISEASES, vol. 202, 2010, pages 1031 - 1040 |
| VESGA, O. ET AL.: "Staphylococcus aureus small colony variants are induced by the endothelial cell intracellular milieu", J INFECT DIS, vol. 173, 1996, pages 739 - 742, XP055276710 |
| VON HEINE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS |
| WELSH, K.J. ET AL.: "Predictors of relapse of methicillin-resistant Staphylococcus aureus bacteremia after treatment with vancomycin", JOURNAL OF CLINICAL MICROBIOLOGY, vol. 49, 2011, pages 3669 - 3672 |
Cited By (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2021282524C1 (en) * | 2016-11-18 | 2023-11-30 | Lysando Ag | New Antimicrobial Agents Against Staphylococcus Aureus |
| AU2017360064B2 (en) * | 2016-11-18 | 2021-09-09 | Lysando Ag | New antimicrobial agents against staphylococcus aureus |
| WO2018091707A1 (en) * | 2016-11-18 | 2018-05-24 | Lysando Ag | New antimicrobial agents against staphylococcus aureus |
| AU2017360064C1 (en) * | 2016-11-18 | 2022-04-07 | Lysando Ag | New antimicrobial agents against staphylococcus aureus |
| US11427812B2 (en) | 2016-11-18 | 2022-08-30 | Lysando Ag | Antimicrobial agents against Staphylococcus aureus |
| AU2021282524B2 (en) * | 2016-11-18 | 2023-06-01 | Lysando Ag | New Antimicrobial Agents Against Staphylococcus Aureus |
| WO2019068875A1 (en) | 2017-10-06 | 2019-04-11 | Micreos Human Health B.V. | TREATMENT OF A HEALTH CONDITION ASSOCIATED WITH INFECTION BY ONCOGENIC BACTERIA |
| EP4219703A2 (en) | 2017-10-06 | 2023-08-02 | Micreos Human Health B.V. | Treatment of a condition associated with infection with an oncogenic bacterium |
| WO2019084343A1 (en) * | 2017-10-25 | 2019-05-02 | The Administrators Of The Tulane Educational Fund | PEPTIDE COMPOSITIONS AND METHODS OF USE THEREOF |
| US11266743B2 (en) | 2017-10-25 | 2022-03-08 | The Administrators Of The Tulane Educational Fund | Peptide compositions and methods of use thereof |
| US11149068B2 (en) | 2018-01-05 | 2021-10-19 | The Administrator Of The Tulane Educational Fund | Pore-forming peptides and uses thereof |
| WO2021185948A1 (en) | 2020-03-19 | 2021-09-23 | Micreos Human Health B.V. | A stabilized protein of interest |
| WO2024133850A1 (en) * | 2022-12-23 | 2024-06-27 | Micreos Pharmaceuticals Ag | A chimeric endolysin polypeptide |
| US12091691B2 (en) | 2022-12-23 | 2024-09-17 | Micreos Pharmaceuticals Ag | Chimeric endolysin polypeptide |
| WO2024200687A1 (en) * | 2023-03-29 | 2024-10-03 | Universiteit Gent | Chimeric endolysins with activity against streptococci and staphylococci |
| WO2024241070A1 (en) | 2023-05-22 | 2024-11-28 | L'oreal | Cosmetic composition comprising an endolysin and a polyvinyl alcohol |
| FR3148909A1 (fr) | 2023-05-22 | 2024-11-29 | L'oreal | Composition cosmetique comprenant une endolysine et un polyalcool vinylique |
| WO2024246325A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and an aromatic alcohol |
| FR3149205A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine et un agent de charge organique |
| WO2024246305A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and an oil |
| WO2024246335A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and a compound of formula (i) |
| WO2024246336A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and a nonionic surfactant comprising a carbohydrate residue |
| FR3149203A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition anhydre comprenant une endolysine et de l’hydroxypropylmethylcellulose et/ou du pullulane |
| FR3149209A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et un alcool aromatique |
| FR3149206A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique aqueuse comprenant une endolysine et du tréhalose |
| FR3149204A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine et un tensioactif non ionique comprenant un résidu carbohydrate |
| FR3149208A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique, notamment aqueuse, comprenant une endolysine et un pullulane |
| FR3149207A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine et un composé de formule (I) |
| WO2024246349A1 (en) | 2023-06-02 | 2024-12-05 | L'oreal | Cosmetic composition comprising an endolysin and an organic filler |
| FR3149202A1 (fr) | 2023-06-02 | 2024-12-06 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et une huile. |
| WO2025045893A1 (en) | 2023-08-28 | 2025-03-06 | L'oreal | Cosmetic composition comprising an endolysin and hydrophobic silica aerogel particles |
| WO2025045889A1 (en) | 2023-08-28 | 2025-03-06 | L'oreal | Cosmetic composition comprising an endolysin derived from a staphylococcus aureus phage and a polyhydroxyalkane |
| FR3152396A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et un polyhydroxyalcane |
| FR3152393A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine dérivée d’un phage de Staphylococcus aureus et une charge minérale |
| FR3152395A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine dérivée de phage de Staphylococcus aureus et la 4-hydroxyacetophenone |
| FR3152394A1 (fr) | 2023-08-28 | 2025-03-07 | L'oreal | Composition cosmétique comprenant une endolysine et des particules d’aérogel de silice hydrophobe |
| WO2025093666A1 (en) | 2023-11-01 | 2025-05-08 | University Of Copenhagen | Treatment of lymphoma |
| WO2026052743A1 (en) | 2024-09-04 | 2026-03-12 | Micreos Human Health B.V. | Reduction of trans-epidermal water loss by a polypeptide with antibacterial properties |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20170132201A (ko) | 2017-12-01 |
| AU2016231141B2 (en) | 2022-03-03 |
| KR102683284B1 (ko) | 2024-07-10 |
| CA2979873A1 (en) | 2016-09-15 |
| US20180271952A1 (en) | 2018-09-27 |
| CN107580503A (zh) | 2018-01-12 |
| EP3268023B1 (en) | 2021-08-18 |
| IL254457A0 (en) | 2017-11-30 |
| JP2018509415A (ja) | 2018-04-05 |
| BR112017019413A2 (pt) | 2018-05-02 |
| AU2016231141A1 (en) | 2017-09-28 |
| IL254457B (en) | 2020-03-31 |
| SG11201707345VA (en) | 2017-10-30 |
| HK1249033A1 (en) | 2018-10-26 |
| WO2016142445A3 (en) | 2016-11-10 |
| CN107580503B (zh) | 2021-07-09 |
| EP3268023A2 (en) | 2018-01-17 |
| US11690899B2 (en) | 2023-07-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11690899B2 (en) | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection | |
| Kim et al. | Antimicrobial activity of LysSS, a novel phage endolysin, against Acinetobacter baumannii and Pseudomonas aeruginosa | |
| Boparai et al. | Mini review on antimicrobial peptides, sources, mechanism and recent applications | |
| Wang et al. | A phage lysin fused to a cell-penetrating peptide kills intracellular methicillin-resistant Staphylococcus aureus in keratinocytes and has potential as a treatment for skin infections in mice | |
| DK2938352T3 (en) | CYLIC CATIONIC PEPTIDES WITH ANTIBMICROBIAL ACTIVITY | |
| JP2018527933A (ja) | 新規なエンドリシンポリペプチド | |
| JP2015522533A (ja) | 抗菌活性を有するポリペプチドミックス | |
| TW201239095A (en) | Antimicrobial agents | |
| US11857606B2 (en) | Therapeutic bacteriocins | |
| JP2021525072A (ja) | 新規抗微生物タンパク質 | |
| Pepperney et al. | Antibacterial peptides: opportunities for the prevention and treatment of dental caries | |
| CN115397994A (zh) | 新型多肽、融合多肽和包含其的抗革兰氏阴性菌的抗生素 | |
| KR20210014674A (ko) | 신규 항균성 융합 단백질 | |
| Tanhaeian et al. | Expression in eukaryotic cells and purification of synthetic gene encoding enterocin P: a bacteriocin with broad antimicrobial spectrum | |
| US20250288652A1 (en) | Bacteriophage lysine, chimera thereof and application thereof | |
| E Shepherd et al. | Targeting quorum sensing and competence stimulation for antimicrobial chemotherapy | |
| KR20230028132A (ko) | 신규한 폴리펩타이드 및 이를 포함하는 그람음성균에 대한 항생제 | |
| CA2979873C (en) | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection | |
| AU2004212179A1 (en) | Antimicrobial agents from Streptococcus mitis and Streptococcus oralis | |
| HK1249033B (en) | Combination of bactericidal agent with a lysosomotropic alkalinising agent for the treatment of a bacterial infection | |
| Dullius et al. | Are peptides a solution for the treatment of hyperactivated JAK3 pathways? A. Dullius et al. | |
| BR112017019413B1 (pt) | Uso de um agente que aumenta o ph intracelular de uma célula hospedeira e/ou de um compartimento intracelular de uma célula hospedeira e de um agente bactericida para o tratamento de uma infecção bacteriana | |
| CN115927255B (zh) | 多肽和抗含有该多肽的革兰氏阴性菌的抗生素 | |
| US20080026999A1 (en) | Two-component bacillus lantibiotic and methods for producing and using the same | |
| Jindal | Hybrid Peptides Derived from Natural Antimicrobial Peptides, Indolicidin and Ranalexin, Exhibit Potent Antimicrobial Activities Against Streptococcus Pneumoniae in Vitro and in Vivo |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16709389 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2979873 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201707345V Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2017547980 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15557296 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 254457 Country of ref document: IL |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016709389 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017019413 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2016231141 Country of ref document: AU Date of ref document: 20160310 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177028879 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017019413 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170911 |