WO2016041093A1 - Biosensors for monitoring biomolecule localization and trafficking in cells - Google Patents
Biosensors for monitoring biomolecule localization and trafficking in cells Download PDFInfo
- Publication number
- WO2016041093A1 WO2016041093A1 PCT/CA2015/050924 CA2015050924W WO2016041093A1 WO 2016041093 A1 WO2016041093 A1 WO 2016041093A1 CA 2015050924 W CA2015050924 W CA 2015050924W WO 2016041093 A1 WO2016041093 A1 WO 2016041093A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- biosensor
- protein
- targeting moiety
- renilla
- receptor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
- G01N33/5035—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects on sub-cellular localization
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
Definitions
- the present invention generally relates to the assessment/monitoring of the localization, transport and trafficking of biomolecules such as proteins, for example cell surface receptor endocytosis, recycling and intracellular trafficking of receptors and effectors.
- biomolecules such as proteins, for example cell surface receptor endocytosis, recycling and intracellular trafficking of receptors and effectors.
- Protein trafficking is an active process in which proteins are re-located from one region of a cell to another. Membranes and their protein components are constantly being turned over through a mechanism that has multiple components and pathways.
- One of the mechanisms of modulating the activity of cell surface receptors such as G protein-coupled receptors (GPCRs) and the Epidermal Growth Factor receptor (EGFR) is through receptor endocytosis.
- GPCRs G protein-coupled receptors
- EGFR Epidermal Growth Factor receptor
- ligand-induced receptor endocytosis can drive receptors removal from the PM through specialized compartments like clathrin-coated vesicles, which involve the recruitment of the endocytic adaptor ⁇ -arrestin to liganted receptors (Claing, Laporte et al. 2002).
- Internalizing receptors can be directed into divergent lysosomal and recycling pathways, producing essentially opposite effects on the strength and duration of cellular signaling via heterotrimeric G proteins, and can also promote distinct signalling events from intracellular membranes through the signalling scaffolding of ⁇ - arrestins (Hanyaloglu and von Zastrow 2008; Posner and Laporte 2010).
- Therapeutic advantages have been proposed for drugs promoting the intracellular targeting of GPCR/p-arrestin complexes, while for some receptors their recycling to the PM is also essential for adequate maintenance of physiological responses.
- the present invention relates to the following items 1 to 73:
- a biosensor for assessing the trafficking and/or localization of a protein of interest comprising;
- a first component comprising said protein of interest tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc);
- a second component comprising a cellular compartment targeting moiety tagged with a Renilla G F P o r a Renilla Luc;
- said cellular compartment targeting moiety is tagged with said Renilla Luc, and if said first protein is tagged with said Renilla Luc, said cellular compartment targeting moiety is tagged with said Renilla GFP.
- biosensor of item 1 or 2 wherein said protein of interest is a Rho-binding polypeptide, a ⁇ -arrestin polypeptide, a cell surface receptor or a G protein subunit polypeptide.
- biosensor of item 3 wherein said protein of interest is a Rho-binding polypeptide.
- biosensor of item 3 wherein said protein of interest is a cell surface receptor.
- biosensor of item 5 wherein said cell surface receptor is a G protein-coupled receptor (GPCR).
- GPCR G protein-coupled receptor
- said cellular compartment targeting moiety is a plasma membrane (PM) targeting moiety, an endosomal targeting moiety, a Golgi targeting moiety, a lysosomal targeting moiety, a peroxisomal targeting moiety, an autophagosomal targeting moiety, a ribosome targeting moiety, a mitochondria targeting moiety, a cytoskeleton targeting moiety or a nuclear targeting moiety.
- PM plasma membrane
- biosensor of item 9 wherein said PM protein or fragment thereof comprises (a) a palmitoylation, myristoylation, and/or prenylation signal sequence and/or (b) a polybasic sequence.
- biosensor of item 1 1 wherein said PM targeting moiety comprises the amino acid sequence MGCIKSKGKDS (SEQ ID NO:1). 13. The biosensor of item 12, wherein said polybasic sequence and prenylation signal sequence are from human KRAS splice variant b.
- biosensor of item 20 wherein said PM targeting moiety comprises the amino acid sequence SPKKGLLQRLFKRQHQNNSKS (SEQ ID NO:8).
- said PM targeting moiety comprises a palmitoylation and/or myristoylation signal sequence from the human Src family kinase Lyn, and is fused to the N-terminal end of said Renilla Luc or said Renilla GFP or (ii) said PM targeting moiety comprises (a) a polybasic sequence and prenylation signal sequence from human KRAS splice variant b or HRAS; (b) a palmitoylation sequence from HRAS and prenylation signal sequence from Rail ; (c) Caveolinl a or a fragment thereof; or (d) a polybasic sequence from human GRK5, and is fused to the C-terminal end of said Renilla Luc or said Renilla GFP.
- a vector comprising the nucleic acid of item 39.
- a method for determining whether an agent modulates the trafficking of a protein of interest in a cell comprising: measuring the BRET signal in the biosensor of any one of items 1 to 38 in the presence and absence of said agent;
- a method for determining whether an agent induces the internalization of a cell surface receptor of interest in a cell comprising: measuring the BRET signal in the biosensor of any one of items 8 to 22 in the presence and absence of said agent;
- a lower BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent induces the internalization of a cell surface receptor of interest.
- a method for assessing the recycling of an internalized receptor of interest at the cell surface comprising:
- a method for determining whether an agent induces the trafficking of a cell surface receptor of interest at an endosomal compartment comprising: measuring the BRET signal in the biosensor of any one of items 23 to 31 in the presence and absence of said agent; wherein a higher BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent induces the trafficking of said cell surface receptor of interest in said endosomal compartment.
- a method for determining whether an agent acts as a pharmacological chaperone for a receptor of interest comprising: measuring the BRET signal in the biosensor of any one of items 8 to 22 in the presence and absence of said agent; wherein a higher BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent acts as a pharmacological chaperone for said receptor of interest.
- a method for determining whether an agent acts as a pharmacological chaperone for a receptor of interest comprising:
- a biosensor comprising: said receptor of interest tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); and an endoplasmic reticulum (ER) targeting moiety tagged with a Renilla GFP or a Renilla Luc; wherein if said receptor is tagged with said Renilla GFP, said ER targeting moiety is tagged with said Renilla Luc, and if said receptor is tagged with said Renilla Luc, said ER targeting moiety is tagged with said Renilla GFP; and
- GPCR melanocortin-4 receptor (MC4R) or a vasopressin 2 receptor (V2R).
- M4R melanocortin-4 receptor
- V2R vasopressin 2 receptor
- a method for determining whether an agent induces the recruitment of a ⁇ -arrestin to the plasma membrane comprising:
- a biosensor comprising a cell or membrane preparation comprising: said ⁇ - arrestin tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); a plasma membrane (PM) targeting moiety tagged with a Renilla GFP or a Renilla Luc; and a GPCR; wherein if said ⁇ -arrestin is tagged with said Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said ⁇ -arrestin is tagged with said Renilla Luc, said PM targeting moiety is tagged with said Renilla GFP; and
- a method for assessing a modulation in the amount of a biomolecule at a cellular compartment between a first and a second condition comprising:
- a biosensor comprising: a first component comprising a Renilla green fluorescent protein ⁇ Renilla GFP) tagged with a protein marker that binds to said biomolecule; and a second component comprising a Renilla luciferase protein ⁇ Renilla Luc) tagged with said protein marker; measuring the BRET acceptor signal in said first and second conditions;
- a difference in the BRET signal between said first and second conditions is indicative of a modulation in the amount of said biomolecule at said cellular compartment between said first and second conditions.
- DAG diacylglycerol
- Figures 1A to 1F show the generation of Bioluminescence Resonance Energy Transfer (BRET)-based GPCR endocytosis sensor.
- Figures 1A to 1C Three configurations of BRET-based sensors for assessing/monitoring GPCR endocytosis.
- BRET Bioluminescence Resonance Energy Transfer
- Figures 1A to 1C Three configurations of BRET-based sensors for assessing/monitoring GPCR endocytosis.
- To monitor the receptor ( Figure 1 A) and B- arrestin (Figure 1C) amounts at the plasma membrane, anchor rGFP at the plasma membrane by tagging an acylation moiety of lyn-kinase ( GCI SKGKDS) in N-terminus of rGFP.
- GCI SKGKDS acylation moiety of lyn-kinase
- Figures 1B, 1C To examine targeting of either receptor (Figure 1B) or ⁇ -arrestin (Figure 1C) to the endosomes, FYVE domain of endofin (amino acids 739 to 806), which tethers the sensor in the endosomes, fused to the C-terminus of rGFP.
- HEK293SL cells expressing either lyn-rGFP ( Figure 1 D) or rGFP-endofinFYVE ( Figure 1E) were subjected to confocal fluorescent microscopy.
- rGFP- endofinFYVE expressing cells were treated with 500 nM wortmannin for 40 min ( Figure 1 E, right panel). Scale bars, 10 ⁇ .
- Figure 1F Simultaneous visualization of receptor, lyn-rGFP, and FYVE domain upon receptor endocytosis.
- HEK293SL cells were transiently transfected with B2R-CFP, lyn-rGFP, and mCherry-endofinFYVE. Top panel showed basal status and the bottom panel showed a bradykinin induced B2R endocytosis. Scale bars, 10 ⁇ .
- Figure 1G A mCherry-labeled variant of the endofin FYVE sensor also co-localized with Rab5, which populates EE.
- Figures 2A to 2F show the dose and time-dependent AT1 R endocytosis measured by BRET.
- Figure 2A HEK293SL cells were transfected with AT1R-Rlucll along with either lyn- GFP10 ( ⁇ ) or lyn-rGFP ( ⁇ ). Cells were incubated with various concentrations of Angll for 40 min then BRET was measured as described under "materials and methods”.
- Figure 2B HEK293SL cells were transfected with AT1 R-Rlucll along with either GFP10-endofinFYVE or rGFP- endofinFYVE.
- FIG. 2C HEK293SL cells were transfected with AT1 R and parr2-Rlucll along with either GFP10-endofinFYVE or rGFP-endofinFYVE.
- AT1 R-Rlucll along with either lyn-rGFP ( Figure 2D) or rGFP-endofinFYVE ( Figure 2E) transfected cells were incubated in the absence or presence of 100 nM Angll at 37 °C for the indicated times then BRET was measured. The BRET ratio change is expressed as percentage of BRET ratio observed in the control (no Angll treatment) group. Data are represented as the means ⁇ S.E. from 2-6 independent experiments.
- Figure 2F Data in Figures 2D and 2E were normalized to the maximal responses, respectively and plotted together.
- Figures 3A to 3F show the effect of blocking receptor endocytosis and overexpression of p-arrestin2 on Angll-induced BRET changes.
- HEK293SL cells were transfected with AT1 R- Rlucll/lyn-rGFP (Figure 3A), AT1 R-Rlucll/rGFP-endofinFYVE ( Figure 3B), or AT1 R/parr2- Rlucll/rGFP-endofinFYVE ( Figure 3C) along with either pcDNA or dynamin K44A.
- Cells were incubated in the absence (control, ⁇ ; DynK44A, O) or presence of 0.45 M sucrose ( A) for 20 min then stimulated with various concentrations of Angll for 40 min before BRET measurement.
- HEK293SL cells were transfected with AT1 R-RLucll/ lyn-rGFP ( Figure 3D) or AT1 R-Rlucll/ rGFP- endofinFYVE ( Figure 3E) along with either pcDNA or p-arrestin2.
- Figure 3F endocytosis of AT1 R in the presence of the vesicle acidification inhibitors bafilomycin A (Baf) and Chloroquine (CQ). Cells were incubated in various concentrations of Angll for 40 min before BRET measurement. Values shown are the means ⁇ S.E. from at least three independent experiments.
- Figures 4A to 4E show dose-response curves obtained with the endocytosis BRET biosensors with various receptors.
- Figure 4A HEK293SL cells were transfected with lyn-rGFP along with either AT1 R-RLucll, B2R-Rlucll, V2R-RLucll, or p 2 AR-Rlucll.
- Figure 4B HEK293SL cells were transfected with rGFP-endofinFYVE along with either AT1 R-Rlucll, B2R-RLucll, V2R- Rlucll, or p 2 AR-Rlucll.
- FIG. 4A HEK293SL cells were transfected with parr2-Rlucll and rGFP- endofinFYVE along with either AT1 R, B2R, V2R, p 2 AR, or FP receptor constructs. Cells were incubated with various concentrations of respective cognate ligand for 40 min before BRET measurement.
- HEK293SL cells were transfected with EGFR along with RLucll-GRB2 and rGFP-endofinFYVE. Cells were incubated with various concentrations of EGF for 30 min at 37 °C then BRET were measured. Results for Figure 4D are means ⁇ SE of triplicates in a single representative experiment out of two independent experiments.
- Figure 4E Assessment of Z'factors as an indication of robustness of the assays for High-Throughput Screening (HTS).
- HTS High-Throughput Screening
- HEK293 were co-transfected with AT1 R-RLucll/lyn-rGFP, AT1 R-RLucll/rGFP-endofinFYVE or AT1 R/ parr2-Rlucll/ rGFP-endofinFYVE and plated in a 48-well plate and stimulated with 100 nM Angll at 37 °C for 20 min to allow receptor receptor dissaperance from the plasma membrane and the accumulation of both receptor and parrestin2 in endosomes.
- Cell surface receptor endocytosis was evaluated in BRET2.
- BRET values are expressed per well in the presented graphs and Z' factor evaluated over 0.64, 0.73 and 0.79 for the Angll-treated group, respectively, which indicates a robust assay for receptor internalization in endosomes.
- Figures 5A to 5C show the monitoring of receptor recycling after ligand removal by endocytosis BRET assays.
- Figure 5A HEK293SL cells were transfected with AT1 R-RLucll along with lyn-rGFP. Cells were incubated in the absence (control) or presence of 100 nM Angll for 30 min then cells were washed and further incubated in the absence of Angll for 45 min. The BRET ratio change is expressed as percentage of BRET ratio observed in the control (no Angll treatment) group. Data are represented as the means ⁇ S.E. from four independent experiments.
- FIG. 5B HEK293SL cells expressing lyn-rGFP along with either V2R-Rlucll, B2R-Rlucll, AT1 R- Rlucll, or p 2 AR-Rlucll were subjected to the receptor recycling as described in Figure 5A with their cognate ligands, 100 nM AVP for V2R, 100 nM BK for B2R, 100 nM Angll for AT1 R, and 1 ⁇ ISO for P2AR. Receptor recycling is expressed as a percent increase in the BRET ratio 45 min after ligand wash-out. All values are expressed as the means ⁇ ⁇ S.E. from 3-4 independent experiments.
- FIG. 5C HEK293SL cells were transfected with AT1 R-Rlucll along with rGFP- endofinFYVE. Cells were incubated in the absence (control) or presence of 100 nM Angll for 30 min then cells were washed and further incubated in the absence of Angll for 45 min. The BRET ratio change is expressed as percentage of BRET ratio observed in the control (no Angll treatment) group. Data represent as the means ⁇ S.E. from three independent experiments.
- Figures 6A to 6F show the effects of Angll analogs on AT1 R trafficking and sorting.
- Figure 6A HEK293SL cells expressing AT1 R-RLucll/rGFPendofinFYVE were incubated either with 100 nM Angll (squares), 100 nM SI (triangles), or 1 ⁇ DVG (circles) for indicated times then BRET were measured. BRET ratios were normalized to the maximal Angll response (60 min) as a 100% and the basal (no ligand) as a 0%. Data are expressed as the means ⁇ S.E. from at least three independent experiments.
- HEK293SL cells were transfected with AT1 R-Rlucll/lyn-rGFP (Figure 6B), AT1 R-Rlucll/rGFP-endofinFYVE ( Figure 6C) or AT1 R/parr2-Rlucll/rGFP- endofinFYVE ( Figure 6D).
- Cells were incubated with various concentrations of Angll (squares), SI (triangles), or DVG (circles) for 30 min ( Figure 6B) or 40 min ( Figures 6C, 6D) before BRET measurement.
- Data are represented as the means ⁇ S.E. from at least three independent experiments.
- FIGS. 6E and 6F HEK293SL cells were transfected with AT1 R-Rlucll along with either rGFP-rab4 ( Figure 6E) or rGFP-rabl 1 ( Figure 6F). Cells were incubated either with 100 nM Angll (squares), 100 nM SI (triangles), or 1 ⁇ DVG (circles) for indicated times then BRET were measured. The BRET ratio change is expressed as percentage of BRET ratio observed in the control (no ligand treatment) group. Data represent the mean ⁇ S.E. from three independent experiments.
- Figures 7A and B show AT1 R internalization accessed by intact cell [ 125 l]Angll-binding assay.
- Figure 7A HEK293SL cells were transiently transfected either AT1 R alone ( ⁇ ), AT1 R- Rlucll alone ( ⁇ ), or AT1 R-RLucll along with lyn-rGFP ( ⁇ ). The cells were incubated in the absence or presence of 100 nM Angll for 30 min at 37 °C then subjected to intact-cell [ 125 l]Angll-binding assay as describe under "materials and methods".
- FIG. 7B HEK293SL cells expressing AT1 R- Rlucll/Lyn-rGFP along with either pcDNA ( ⁇ ), dynamin K44A ( ⁇ ), or p-arrestin2 ( ⁇ ) were incubated in the absence or presence of 100 nM Angll for 30 min at 37 °C then subjected to an intact-cell [ 125 l]Angll-binding assay as describe below (Example 1 ). Receptor endocytosis was expressed as the percent loss of cell surface receptors. Data are represented as the means ⁇ S.E. of three independent experiments.
- Figure 8 shows the high basal endosomal localization of V2R.
- Figure 9A shows the vesicular localization of rGFP-rab4 and rGFP-rab11 with mCherry- FYVE.
- HEK293SL cells were transfected either rGFP-rab4 (left) or rGFP-rab1 1 (right), then subjected to a confocal microscopy.
- Figures 9B to 9D show the effect of Gaq inhibition on Angll-mediated AT1 R internalization.
- Figure 9B HEK293SL cells were transfected with AT1 R-Rlucll along with Lyn- rGFP. Cells were incubated in the absence (-Ubo) or presence of 100 nM Ubo (+Ubo) for 30 min then stimulated with various concentrations of Angll for 30 min before BRET measurement.
- Figure 9C HEK293SL cells were transfected with AT1 R-Rlucll along with rGFP-FYVE.
- FIG. 9D Cells were transfected with AT1 R-Rlucll along with either rGFP-rab4 or rGFP-rab1 1 . Cells were incubated in the absence (-Ubo) or presence of 100 nM Ubo (+Ubo) for 30 min then stimulated either with 100 nM Angll, 100 nM SI, or 1 ⁇ DVG for 10 min for the rGFP-rab4 and 30 min for the rGFP-rab1 1 then BRET were measured. The BRET ratio change is expressed as percentage of BRET ratio observed in the control (no ligand treatment) group. Data represent the mean ⁇ S.E. from three independent experiments.
- Figures 10A and 10B depict the principle of a BRET-based pharmacological chaperone
- PC pharmalogical chaperone
- Figure 10A The pharmalogical chaperone (PC) assay is based on relocalization of a pharmalogical chaperone-rescued protein that would, otherwise, be retained in a different subcellular compartment. Relocalization detected and measured using BRET, preferentially with rGFP with a plasma-membrane targeting sequence (rGFP-CAAX, Lyn-rGFP or rGFP-PB; for a description, see Figure 11 D). Misfolded receptors and channels such as hERG are retained in intracellular compartments and translocate to the plasma membrane upon pharmalogical chaperone-mediated rescue.
- the receptor is preferentially tagged with Rlucll and the membrane with rGFP; the BRET signal is proportional to the density of the Rlucll-tagged protein at the membrane.
- the misfolded protein could either be a mutant or the WT protein.
- the functionality of the rescued receptor may then be assessed using the agonist-induced sequestration assay depicted in Figure 10B (which essentially corresponds to the BRET-based sensor depicted in Figure 1A).
- Figure 10B principle of a BRET-based agonist-induced sequestration assay.
- a plasma membrane (PM) marker is tagged with a BRET acceptor such as GFP (G) and the PC- rescued receptor of interest ⁇ e.g., a PC-rescued GPCR) is tagged with a BRET donor such as RLuc (R).
- a BRET acceptor such as GFP (G)
- the PC- rescued receptor of interest ⁇ e.g., a PC-rescued GPCR
- RLuc RLuc
- the receptors are retained at the PM and co-localize with the BRET acceptor-tagged PM marker, thus resulting in a strong BRET acceptor signal.
- an agonist in the presence of an agonist (right), the receptors are internalized, thus decreasing the density of the BRET donor-tagged receptor at the PM, which results in a decrease in the BRET acceptor signal.
- This assay can be performed following PC-mediated cell-surface rescue of receptors, in the same well, thus in a homogenous assay that monitor two different aspects of the receptor biology.
- Figures 11 A to D show the constructs used to validate and optimize a sensor to detect pharmalogical chaperone properties.
- Figures 11 A to C the chaperone-rescue assay was developed and tested with wild type (WT) and naturally-occurring substitutions of human GPCRs (Melanocortin receptor 4: hMC4R and the vasopressin receptor 2: hV2R) and a voltage-gated Potassium channel H2 (hERG) tagged with a BRET donor. The receptors were tagged in C- terminal with Rlucll.
- the hERG channel was internally tagged with Rlucll at the equivalent position of residue 379 and, the sequence from residues 373-379 was duplicated on each side of Iinker3 and linker 4 (see Figure 11 C).
- Flexible linkers were used between the receptor/channel and the Rlucll tag. The sequence of the linkers is indicated in Figure 11 A for the MC4R constructs (Linkerl ), in Figure 11 B for the V2R constructs (Linker2) and in Figure 11 C for the hERG constructs (Linker3 & 4).
- FIG 11 D A BRET acceptor (rGFP) was tagged with different plasma- membrane or Golgi apparatus targeting sequences: in N-terminal with the palmitoylation & myristoylation signal sequence from the Lyn kinase (Lyn-), in C-terminal with the polybasic sequence and prenylation signal sequence from KRAS splice variant b (-CAAX), in C-terminal with the polybasic sequence from the human GRK5 (-PB), in C-terminal with the plasma-membrane targetting palmitoylation sequence and prenylation signal sequence from hRas, in C-terminal with the plasma-membrane targetting palmitoylation sequence from hRas and prenylation signal sequence from Rail , in C-terminal with human Caveolinl a (a marker of caveolae); and in N- terminal with the Golgi targetting sequence (residues 1 -73) from human eNOS1 .
- Linkers 5, 6 and 7 were used between the rGFP and the plasma-membrane targeting sequence: lyn, CAAX and PB, respectively.
- Llinker 9 was used between the golgi targetting sequence from eNOS (1 -73) and rGFP.
- Figures 12A and B show the testing of different ratios (titration) of two forms of rGFP targeted to the plasma membrane. Titrations of BRET donor to acceptor and PC-rescue assay were performed on transfected cells (variable amount of rGFP construct + 24ng of receptor construct for 10 wells of a 96-well plate), following a 16h treatment with either a chaperone: (DCPMP (N-((2R)-3(2,4-dichloroPhenyl)-1 -(4-(2-((1 -methoxypropan-2-ylamino)methyl)phenyl) piperazin-1 -yl)-1 -oxopropan-2-yl)propionamide), 10 ⁇ ) or vehicle (DMSO).
- DCPMP N-((2R)-3(2,4-dichloroPhenyl)-1 -(4-(2-((1 -methoxypropan-2-ylamino)methyl)phenyl) piperazin-1
- HEK293 were transfected with hMC4R (R165Q)-Rlucll construct and different quantities of rGFP-CAAX ( Figure 12A); and rGFP-PB construct ( Figure 12B).
- the BRET ratio is reported in function of GFP- construct expression (evaluated in fluorescence) over Rlucll construct expression (evaluated in bioluminescence).
- Figures 13A to C show the cell surface expression and functional PC-mediated rescue of wt and mutant MC4R at different ratios of receptor and rGFP-CAAX.
- HEK293 were co-transfected with an rGFP-CAAX construct (72 ng of plasmid for 10 wells of a 96-well plate) and 3 different quantities (as indicated on the graphs: 6, 12 and 24 ng for 10 wells) of hMC4R wt-Rlucll (Figure 13A); hMC4R (P299H)-Rlucll ( Figure 13B); and hMC4R (R165Q)-Rlucll ( Figure 13C).
- the PC- mediated rescue of cell surface expression and functionality was evaluated in BRET2, on transfected cells, following a 16h-treatment with either a chaperone: (DCPMP, 10 ⁇ ; solid black and grey bars) or vehicle (DMSO; white bars).
- DCPMP a chaperone
- DMSO vehicle
- the grey bars represent data obtained from DCPMP-treated cells, exposed 1 h to an agonist (alpha-MSH) to induce receptor sequestration.
- DCPMP-treatment induces an increase in cell surface expression, as revealed by an increase in BRET signal, compared to non-treated cells (with bars).
- Agonist-treatment induces sequestration as revealed by a decrease in BRET signal (grey bars) as compared to cells treated with DCPMP but not exposed to an agonist (black bars).
- Figure 13D shows polycistronic constructs encoding rGFP-CAAX(Kras) and either a WT or mutant hMC4R were transiently expressed in Hek293 cells.
- This figure shows that similar results for PC rescue of cell surface expression (white bars: DMSO vs. black bars: 10 ⁇ DCPMP) and functionnal rescue can be obtained, as measured by agonist-induced sequestration (+ alpha-MSH; grey bars), from polycistronic and non-polycistronic constructs ( Figures 13A-C).
- Agonist-induced sequestration for cells not pretreated with a chaperonne is presented (hashed-bars).
- Figure 13E shows the PC-mediated rescue of V2R mutants known to be intracellular ⁇ retained, as evidenced by the increase in BRET at the plasma membrane.
- the PC-mediated rescue of cell surface expression was evaluated in BRET1 , on transfected cells, following a 16h- treatment with either a chaperone: (SR121463, 10 ⁇ ; solid black bars) or vehicle (DMSO; white bars).
- Figures 14A and 14B show dose-response curves for 2 PC-mediated functional rescue of WT and mutant (R165Q) MC4R cell surface expression.
- HEK293 were co-transfected with an rGFP-CAAX construct and, the hMC4R wt-Rlucll or hMC4R (R165Q)-Rlucll constructs (72ng of rGFP construct+24ng of receptor construct for 10 wells of a 96-well plate).
- Figures 15A to 15D show the assessment of Z'factor as an indication of robustness of the assay.
- HEK293 were co-transfected with an rGFP-CAAX construct and, the hMC4R wt-Rlucll ( Figures 15A and 15B) or hMC4R (R165Q)-Rlucll ( Figures 15C and 15D) constructs (72ng of rGFP construct + 24ng of receptor construct for 10 wells of a 96-well plate).
- BRET2 Cell surface expression was evaluated in BRET2 in Figures 15A and 15C using coelenterazine 400a, and in BRET1 using coelenterazine H ( Figures 15B and 15D) following a 16h-treatment with 10 ⁇ DCPMP (48 wells) vs. vehicle (DMSO) (48 wells).
- BRET values are expressed per well in the presented graphs and Z' factor evaluated over 0.63 with the hMC4R wt receptor and over 0.82 with the mutant R165Q mutant hMC4R, which indicates a robust assay with both receptors.
- Figures 16A and 16B show the assessment of the impact of DMSO on the BRET-based cell surface expression assay.
- HEK293 were co-transfected with an rGFP-CAAX construct and, the hMC4R wt-Rlucll ( Figure 16A) or hMC4R (R165Q)-Rlucll ( Figure 16B) constructs (72ng of rGFP construct + 24ng of receptor construct for 10 wells of a 96-well plate).
- Figures 17A and 17B show PC-mediated rescue of MC4R and V2R expression in transfected and stable rGFP cell lines.
- HEK293 were co-transfected with an rGFP-CAAX construct (72 ng of plasmid for 10 wells of a 96-well plate) and 3 different quantities (as indicated on the graphs: 6, 12 and 24 ng for 10 wells) of hMC4R (R165Q)-Rlucll ( Figure 17A) or in hV2R (Y128S)- Rlucll ( Figure 17B).
- HEK293 cells selected for stably expressing different levels of rGFP-CAAX were transfected with the same quantity of receptor constructs.
- the PC-mediated rescue of cell surface expression for MC4R was evaluated in BRET2, following a 16h-treatment with 10 ⁇ DCPMP, and for the V2R (Y128S)-Rlucll expressing cells with the SR121463 chaperone (a known antagonist with inverse agonist and pharmalogical chaperone properties; Serradeil-Le Gal C , Cardiovasc Drug Rev. 2001 , 19(3) : 201 -14) at 10 ⁇ or vehicle (DMSO).
- the data is presented for the MC4R and V2R expressing cells as a % of BRET signal observed with cells treated with vehicle (DMSO).
- DMSO vehicle
- the presented data indicates that a better response can be obtained with stable cell lines expressing higher levels of rGFP-CAAX.
- the stable cell line expressing high levels of rGFP-CAAX (Stable:Hi) could be used to establish cell lines co- expressing a receptor-Rlucl l.
- Figures 18A to 18E PC-rescue assay for detecting ligands of hERG channel (a non- GPCR).
- Cell-surface expression and functionnal PC-mediated rescue of wt Figure 18A
- mutant Figure 18B
- hERG at different ratios of hERG to rGFP-CAAX.
- HEK293 cells were co-transfected with an rGFP-CAAX construct (72 ng of plasmid for 10 wells of a 96-well plate) and 3 different quantities (as indicated on the graphs: 6, 12 and 24 ng for 10 wells) of hERG wt-Rlucll ( Figure 18A) and hERG (G601 S)-Rlucll ( Figure 18B).
- the PC-mediated rescue of cell surface expression was evaluated in BRET2, following a 16h-treatment with either a chaperone: (Astemizole, 10 ⁇ ; solid black bars) or vehicle (DMSO; white bars). Astemizole-treatment induces an increase in cell surface expression, as revealed by an increase in BRET signal, compared to vehicle-treated cells.
- FIG 19A shows the configuration of a biosensor for monitoring ⁇ -arrestin recruitment to a GPCR at the plasma membrane.
- a BRET acceptor e.g., rGFP, GFP10
- a PM targeting moiety thus tethering the BRET acceptor at the PM
- a ⁇ -arrestin is tagged with a BRET donor ⁇ e.g., Rlucll.
- a GPCR agonist represented by A
- ⁇ -arr is recruited to the GPCR, thus increasing the concentration of Rlucll-p-arr at the plasma membrane, which in turn results in an increase in energy transfer (BRET) between Rlucl l and the PM-tagged GFP.
- BRET energy transfer
- Figures 19B and 19C show the increase in the BRET ratio for the recruitment of ⁇ - arrestin ! and p-arrestin 2 , respectively, at the class A GPCR $2AR, for different PM-targeting moieties (Lyn, CAAX and PB-GRK5) and BRET acceptors (rGFP and GFP10), following stimulation with increasing doses of the agonist isoproterenol (iso).
- the ⁇ -arrestin-Rlucll translocation sensor with rGFP-CAAX squares offers the best window with both receptors.
- Figures 19D and 19E show the increase in the BRET ratio for the recruitment of ⁇ - arresti ⁇ and p-arrestin 2 , respectively, at the class B GPCR V 2 R, for different PM-targeting moieties (Lyn, CAAX and PB-GRK5) and BRET acceptors (rGFP and GFP10), following stimulation with increasing doses of the agonist AVP.
- PM-targeting moieties Li, CAAX and PB-GRK5
- rGFP and GFP10 BRET acceptors
- Figures 19F shows the recruitment of p-arrestin 2 to P2AR following stimulation with increasing doses of the agonist isoproterenol (iso), as assessed using different PM-targeting moieties (CAAX from Kras, CAAX from Hras, the plasma-membrane targetting palmitoylation sequence from hRas and prenylation signal sequence from Rah (CCIL) and the marker of the caveolae structures Caveolinl a tagged with rGFP.
- the ⁇ -arrestin-Rlucll translocation sensor with rGFP-CAAX squares show an increase of density at the plasma-membrane. In contrast to the response obtained with the rGFP-CAAX markers, a stimulation of P2AR lead to a decrease in density of p-arrestin 2 at the caveolae.
- Figures 19G shows dose-response curves for translocation of parrestin2 at the plasma membrane after AT1 R stimulation.
- HEK293SL cells were transfected with AT1 R and parr2-Rlucll along with either Lyn-rGFP, or rGFP-CAAX or GFP10-CAAX. Cells were incubated with various concentrations of Angll for 6 min at room temperature before BRET measurements. Data are expressed as percent basal BRET. Data are the means ⁇ S.E. of 3 independent experiments.
- Figures 19H-19J show the Z' factors obtained for the parrestin 2 -Rlucll/rGFP-CAAX biosensor and receptors of Figures 19C, 19E and 19G, respectively.
- This assay to monitor receptor-mediated parrestin recruitment, results in Z'factors of at least 0.74 (0.74, 0.80 and 0.838), which would be amenable to screening (including high-throughput screening) applications for both class A and B GPCRs.
- Figures 20A and 20B show the Angll-dose dependent decrease in plasma PIP2 amount as detected by BRET between Rlucll-PH(PLC51 ) and rGFP-PH(PLC51 ) or Lyn-rGFP or rGFP- CAAX.
- HEK293SL cells were transfected with AT1 R and HA-Rlucll-PH(PLC51 ) along with either rGFP-PH(PLC51 ), Lyn-rGFP, or rGFP-CAAX. Cells were incubated with various concentrations of Angll for 1 min at RT then BRET was measured. Results are means ⁇ S.E. of triplicates in a single representative experiment.
- Figure 21 A shows the configuration of a unimolecular biosensor for monitoring ⁇ -arrestin recruitment to a GPCR at the plasma membrane.
- a BRET acceptor ⁇ e.g., rGFP, GFP10
- a PM targeting moiety thus tethering the construct at the PM
- a flexible linker is placed between the BRET acceptor and a BRET donor ⁇ e.g., Rlucll, which is attached to a ⁇ -arrestin.
- ⁇ -arr In the presence of a GPCR agonist (represented by A), ⁇ -arr is recruited to the GPCR, thus increasing the concentration of Rlucll-p-arr at the plasma membrane, which in turn results in an increase in energy transfer (BRET) between Rlucll and the PM-tagged GFP.
- A GPCR agonist
- BRET energy transfer
- Figure 21 B shows the BRET ratio using unimolecular biosensors with flexible linkers of different lengths to assess p-arrestin 2 recruitment to V 2 R following stimulation with AVP.
- Figures 21 C to 21 E show dose-response curves for the recruitment of p-arrestin 2 at different GPCRs (AT1 R, V2R and P2AR) using unimolecular biosensors.
- FIG 22A shows a schematic representation of a unimolecular biosensor for measuring the translocation of the diacylglycerol- (DAG-) binding domain of PKCdelta (C1 b) to the plasma- membrane.
- the biosensor comprises a PM-targeting domain/moiety (Mem), a BRET acceptor (e.g., GFP10), a flexible linker, a BRET donor (e.g., flLucll) and the DAG-binding domain of PKC5, C1 b.
- BRET acceptor e.g., GFP10
- BRET donor e.g., flLucll
- the DAG enrichment causes the C1 b domain to bind to the membrane, bringing the BRET acceptor (e.g., GFP10) and BRET donor (e.g., RLucll) closer to each other, inducing a higher BRET signal.
- BRET acceptor e.g., GFP10
- BRET donor e.g., RLucll
- Figure 22B shows kinetics of DAG sensor activation following AT1 R exposure to angiotensin II.
- AT1 R stably expressing HEK293 cells were transfected with a construct encoding the unimolecular DAG sensor DNA and BRET.
- the BRET level was monitored every 4 s.
- Angll final concentration of 100 nM was added after 16 BRET measurements (64 s).
- Data are mean ⁇ SD of triplicates of a representative experiment.
- Figures 22C to 22E show dose-response curves obtained with the unimolecular DAG sensor representing the level DAG produced at the plasma membrane following activation of the Angiotensin II receptor (AT1 R) with angiotensinll (ANGII) (Figure 22C), Prostaglandin F receptor (FP) with two natural ligands, prostaglandin 2a (PGF2a; solid diamonds) and prostaglandin E2 (PGE2; open circles) (Figure 22D), Urotensin II receptor (GPR14) with urotensin II (UTN) ( Figure 22E).
- AT1 R Angiotensin II receptor
- ANGII angiotensinll
- Figure 22C shows Prostaglandin F receptor (FP) with two natural ligands, prostaglandin 2a (PGF2a; solid diamonds) and prostaglandin E2 (PGE2; open circles)
- Figure 22D Urotensin II receptor (GPR14) with ur
- Figure 22F shows that the BRET response measured with the unimolecular DAG sensor reflects PLC activation and the concomitant production of diacyl glycerol.
- HEK293 cells transiently expressing the unimolecular DAG sensor were exposed to 5uM of m-3m3FBS, a direct activator of PLC ( ⁇ 2, ⁇ 3, ⁇ 1 , ⁇ 2, 51 isoforms), for the indicated time.
- the PLC activation lead to an increase in BRET, reflecting a sustained increase of DAG level at the plasma membrane.
- Figures 22G and 22H show the robustness of the DAG biosensor.
- a Z-factor was determined for the DAG biosensor using HEK293 transiently expressing the urotensin-ll (Figure 23G) or the prostaglandin F receptor (Figure 23H) along with the DAG biosensor.
- the cells were exposed to 100 nM of agonist (Uroll in Figure 23G or PGF2a in Figure 23H) for x min prior to BRET measurements.
- Figure 23A shows a schematic representation of a biosensor for measuring the translocation of the diacylglycerol- (DAG-) binding domain of PKCdelta (C1 b) to the plasma- membrane.
- DAG- diacylglycerol-
- C1 b PKCdelta
- the biosensor comprises a PM-targeting domain/moiety attached to a BRET acceptor ⁇ e.g., rGFP) and a BRET donor ⁇ e.g., flLucll) linked to the DAG-binding domain of PKC5, C1 b.
- a BRET acceptor ⁇ e.g., rGFP
- a BRET donor ⁇ e.g., flLucll
- membrane PIP 2 is hydrolysed into IP 3 and DAG.
- the DAG enrichment causes the C1 b domain to bind to the membrane, bringing the BRET acceptor ⁇ e.g., rGFP) and BRET donor ⁇ e.g., RLucll) closer to each other, inducing a higher BRET signal.
- Figures 23B to 23D show dose-response curves for the recruitment of C1 b at the plasma membrane following activation of the histamine H1 receptor (H1 R) ( Figure 23B), Bradykinin Receptor B2 (BKRB2) ( Figure 23C), dopamine D2 receptor (D2R) ( Figure 23D) and 62AR ( Figure 23E) using the DAG biosensor.
- Gq-coupled receptors (H1 R and BKRB2) activation lead to a better signal than a Gi-coupled receptor (D2R) or a Gs-coupled receptor that essentially do not lead to a detectable response in absence of co-expression of G15, a G protein of the Gq family.
- FIG. 24A shows a schematic representation of a biosensor for measuring G protein translocation and activation.
- the biosensor comprises a PM-targeting domain/moiety ⁇ e.g., CAAX domain) attached to a BRET acceptor ⁇ e.g., rGFP) and a BRET donor ⁇ e.g., RLucll) attached to a protein G subunit, for example Gy (Gpy-sequestration based sensor) or Ga (Ga-sequestration based sensor).
- Gy Gy-sequestration based sensor
- Ga Ga-sequestration based sensor
- a change in BRET could also reflect translocation from (decrease in BRET) or to (an increase in BRET) a subdomain of the membrane or sub-cellular compartment tagged with an rGFP-marker.
- Figures 24B and 24C show the sequestration of various RLucll-tagged Gy subunit from the plasma membrane (rGFP-CAAX Kras) in response to 61 AR ( Figure 24B) or 62AR ( Figure 24C) stimulation with isoproterenol.
- rGFP-CAAX Kras plasma membrane
- Figure 24B Figure 24B
- Figure 24C Figure 24C
- HEK293 cells were cotransfected with constructs encoding a ⁇ -adrenergic receptor, a WT G61 subunit, an Rlucll-tagged Gy subunit (as indicated) and WT Ga15.
- the combination with Rlucll- Gv1 subunit is giving the best window to establish dose-response curves for those 2 receptors.
- Figure 24D shows a dose-response curve for the agonist-promoted RLucll-tagged Gy1 sequestration from rGFP-CAAX (Kras) following 61 AR (circles) and 62AR (triangles) stimulation with isoproterenol of HEK293 cells transiently transfected with constructs encoding a ⁇ -adrenergic receptor, a WT G61 subunit, an Rlucll-tagged Gy1 subunit and WT Ga15.
- the observed EC 50 are similar to the reported kd of isoproterenol for those receptors.
- Figure 24E shows dose-response curves for the agonist-promoted RLucll-tagged Gs sequestration from rGFP-CAAX Kras (circles), rGFP-CAAX Hras (squares) and rGFP-CAAX CCIL (triangles) following 61 AR stimulation with isoproterenol.
- the potency observed with the 3 PM- markers is spanning from 4.4nM (with rGFP-CAAX Kras) to 847nM (with rGFP-CAAX CCIL), indicating that the pharmacology of different ligands could be distinct in domains monitored with specific markers.
- Figure 24F shows the kinetics of agonist-promoted RLucll-tagged Gs sequestration from rGFP-CAAX Kras (circles), rGFP-CAAX Hras (squares) and rGFP-CAAX CCIL (triangles) following pi AR stimulation with 1 ⁇ isoproterenol for the indicated time.
- the maximal response is mostly reached within 5 min of stimulation as measured with the three PM-markers.
- the differences of EC 50 in Figure 24E are thus not driven by differences in kinetics as the dose-response curves were establish at maximal response.
- Figure 24G shows dose-response curves for the agonist-promoted RLucll-tagged G12 sequestration from rGFP-CAAX CCIL (triangles), rGFP-CAAX Hras (squares) and Golgi-rGFP (Golgi targetting domain of eNOS1 ; diamonds) following pi AR stimulation with isoproterenol.
- the basal BRET indicates that G12 colocalized with the Golgi marker.
- most of the agonist- induced translocation of G12 is observed using the PM-markers and only minimally from Golgi.
- Figure 24H shows dose-response curves for the agonist-promoted fLucll-tagged Gq translocation to rGFP-CAAX Kras (circles), rGFP-CAAX Hras (squares), rGFP-CAAX CCIL (triangles) and Golgi-rGFP (Golgi targetting domain of eNOS1 ; diamonds) following the thromboxane A2 receptor isoforme a (TpaR) stimulation with a prototypical agonist: U46619.
- the dose response curves were obtained from HEK293 cells transiently transfected with constructs encoding: TpaR, Gaq pos1 18Rlucll (Rlucll inserted after residue 1 18 of Gaq), WT Gy5 and Gpi , pretreated or not for 20min with Ubo-Qic, a specific Gq inhibitor.
- the basal BRET indicates that Gq is mostly colocalized with rGFP-CAAX Kras (solid circles) and pretreatment with Ubo-Qic (open circles) further increase the density of Gq with this marker, blunting the window of response to U46619.
- the dose-response curves obtained with the other markers show an increase of density of Gq (an increase in BRET; solid squares, solid triangles and solid diamonds for rGFP-CAAX Hras, rGFP-CAAX CCIL and Golgi, respectively) only with cells not exposed to a Gq blocker. No response is observed with these markers with cells pretreated with the Gq inhibitor (open squares, open triangles and open diamonds for rGFP-CAAX Hras, rGFP-CAAX CCIL and Golgi, resepectively).
- FIG. 25A shows a schematic representation of a biosensor for measuring Rho activation by the translocation of the Rho binding domain of Protein kinase N1 (PKN) to the plasma-membrane.
- the biosensor comprises a PM-targeting domain/moiety attached to a BRET acceptor (e.g., rGFP) and a BRET donor (e.g., fLucll) linked to the Rho binding domain of PKN.
- a RhoGEF is recruited to an activated Ga subunit such as of the Gq and G12/13 familly or to the ⁇ released from the activated Ga. This GEF activates a small G protein of the Rho family.
- Rho recruits specific effectors with a domain that interact specifically with an activated Rho; PKN is one of those effectors.
- PKN1 Rho-binding domain CRIB
- a sensor to monitor Rho activation was created by subcloning of PKN1 Rho-binding domain (CRIB) in an expression vector containing a BRET donor, Rlucll, and by monitoring its translocation to the plasma membrane where the activated Rho is located. The translocation is bringing the BRET acceptor ⁇ e.g., rGFP) and BRET donor ⁇ e.g., RLucll) closer to each other, inducing a higher BRET signal.
- BRET acceptor ⁇ e.g., rGFP
- BRET donor e.g., RLucll
- Figure 25B shows dose-response curves for the agonist-promoted PKN-fiLucll translocation to plasma membrane markers: rGFP-CAAX Kras (circles), rGFP-CAAX Hras (inverted triangles) and rGFP-CAAX (CCIL; triangles) following TpaR stimulation with an agonist (U46619).
- the dose response curves were obtained from HEK293 cells transiently transfected with constructs encoding: TPaR, PKN-fiLucll, and a plasma membrane rGFP-marker.
- TPaR is a prototypical Gq/12/13-coupled receptor known to activate RhoA.
- Figure 25C shows kinetics of Rho sensor activation following AT1 R exposure to angiotensin II.
- HEK293SL cells were transfected with constructs encoding AT1 R along with PKN- crib-Rlucll and rGFP-CAAX. Cells were first incubated in the absence or presence of 100 nM Ubo- Qic (a specific Gq inhibitor also known as FR900359) for 30 min before BRET measurements at every 2 sec. Tyrode (non-stimulated) or Angll (Stimulated; final concentration of 100 nM) were injected after 30s. Data are the average of duplicate reading at different time points of a representative experiment.
- Ubo- Qic a specific Gq inhibitor also known as FR900359
- Figure 25D to 25F shows the impact of Gq inhibition on Rho activation by different Angll ligands.
- HEK293SL cells were transfected with constructs encoding AT1 R along with PKN-CRIB- RLucll and rGFP-CAAX. Cells were incubated in the absence (solid line) or presence (dotted line) of 100 nM Ubo-Qic (Gq inhibitor) for 30 min, then stimulated with various concentrations of Angll or analogs for 4 min before BRET measurements. Data were normalized to the Emax of Angll. Data represent as the means +/-S.E. from 3-4 independent experiments.
- Gq-activating ligands such as Angll, hAnglll, SVdF, SBpa, hSarmesin, and SI showed a reduced efficacy and a rightward-shifted potency in the presence of ubo ( Figures 25D and E). Blocking of Gq did not affect DVG, Saralasin, and TRV-mediated Rho activation since these ligands do not activate Gq. SI I showed only changing EC 50 by ubo treatment, suggesting that SI I weakly activates Gq/1 1 .
- Figure 25G shows the impact of Gq inhibition on Rho activation by AT1 R and Acetylcholine receptors.
- HEK293SL Cells were transfected with constructs encoding AT1 R along with PKN-CRIB-Rlucll and rGFP-CAAX. Cells were incubated in the absence (control) or presence of 100 nM Ubo before being stimulated either with 100 nM Angll or 100 ⁇ carbachol (CCh) for 70s before BRET measurements. Results show that Ubo partially blocked Angll-mediated BRET increase and completely blocked CCh-mediated responses; suggesting that Gq plays a role in Rho activation by Angll and CCh. Data are mean +/- SD of triplicates from a representative experiment.
- FIG. 25H shows the Effects on a Rho inhibitor of the Rho sensor activation.
- HEK293SL expressing AT1 R, PKN-crib-Rlucll and rGFP-CAAX were incubated with 3 ⁇ g/ml of C3 toxin (Rho inhibitor, Cytoskeleton, Inc.) in Tyrode for ⁇ 4 hr at 37 °C then stimulated with 100 nM Angll for 70 s at RT.
- C3 toxin completely abolished agonist-mediated BRET increases, validating the sensor for monitoring Rho activity.
- FIG. 25I shows that PKN translocation to the plasma membrane is dependent on Rho activation.
- HEK293 cells transiently expressing TPaR and the PKN sensor (PKN-Rlucll + CAAX- rGFP) were pretreated or not, overnight, with of a Rho inhibitor (CT04; Cytoskeleton, Inc) and exposed to 100nM of U46619 (TPaR agonist), ' i vgM of Rho activator I I (CN03; Cytoskeleton, Inc) or vehicle.
- CT04 Cytoskeleton, Inc
- the Rho inhibitor abolished the TPaR-mediated response while the Rho activatitor is inducing a response, validating this sensor for monitoring Rho activity.
- Figures 26A and 26B show the BRET transfer obtained between Rlucll and different BRET acceptors for unimolecular fusion constructs.
- the BRET signal obtained using rGFP was more than 10-fold higher than that obtained with typical BRET1 (Venus) and BRET2 (GFP2) acceptors.
- Figure 26A shows the difference of energy transfer when Rlucll is paired with Venus, GFP2, and rGFP.
- Figure 26B shows the BRET ratio calculated from Venus-, GFP2- and rGFP- fused-constructs.
- Figure 26C shows that the rGFP-enhanced BRET signal can be used to monitor BRET in microscopy, even for a density-BRET based assay such as the recruitment of beta-arrestin to the plasma membrane.
- the assay used in this experiment is similar to that presented in Figure 19C as measured using a plate reader.
- HEK293 cells were transiently transfected with constructs encoding the P2AR, the parrestin2-Rlucll and the plasma membrane marker: rGFP-CAAX(Kras). Isoproterenol stimulation induced the increase of BRET signal level only at the plasma membrane, indicating that an increase in BRET signal is a reflection of parrestin recruitment to the plasma membrane.
- Figure 27 A shows the results of a screening of modulators of AT1 R endocytosis.
- HEK293 cells were dispensed to 384-well white tissue culture treated plate (Greiner) and grown for an additional 24h.
- Compounds are added using a 384 magnetic pintool (V&P scientific) at a final concentration of 15 ⁇ or 5 ⁇ g/ml depending on the compound sub-library.
- V&P scientific 384 magnetic pintool
- GFP fluorescence was red using an EnvisionTM (Perkin-Elmer®) and coelenterazine 400a was added at a final concentration of 5 ⁇ using a multidrop 384 (Thermo- Scientific®). Cells were incubated at room temperature before reading the BRET signal (RLuc at 480 nm and rGFP at 530 nm). For the antagonist mode, compounds were incubated for 30 min at 37 °C. Angiotensin II was added at 10 nM (EC 80 ) and incubated for an additional 30 minutes at 37 °C. The rest of the assay was performed as the agonist mode.
- I DBS ActivityBase
- % agonist or % inhibition based on the angiotensin II activation Shown are respectively 30 and 42 compounds that act as potentiators (increased the signal over 100%) and inhibitors (blocked more than 50% the signal) for AT1 R targeting to endosomes.
- Figure 27B shows the effects of compound #21 in the screening on B2R and parrestin2 endocytosis to endosomes
- Figure 27C shows the effects of compound #10 and #29 identified in the screening on B2R endocytosis to endosomes.
- HEK293SL cells were seeded in 35 mm glass-bottom dishes at a density of 100,000 cells/dish. Cells were transfected with B2R-YFP + mCherry-FYVE ( Figure 27B left and middle and 27C) or B2R + Parrestin2-YFP (Figure 27C).
- the present inventors have developed BRET-based biosensors that permit to assess/monitor the intracellular localization and trafficking ⁇ e.g., receptor internalization, recycling, exocytosis) of proteins, such as receptors and other proteins.
- BRET-based biosensors that permit to assess/monitor the intracellular localization and trafficking ⁇ e.g., receptor internalization, recycling, exocytosis) of proteins, such as receptors and other proteins.
- GPCRs and an ion channel as models, the present inventors have developed sensitive means, based on the renilla's BRET pair RLucll-rGFP, for real-time monitoring and pharmacological profiling of receptor and ⁇ -arrestin internalization and their trafficking into different cellular compartments, as well as for the identification of trafficking regulators.
- the dynamic range of the signal is very narrow using the Rluc/Venus pair (BRET ratios of 0.04-0.08), similar to the one obtained with the version of the biosensors using the RLucll/GFP10 pair (see Examples 3 and 12, Figures 2A to 2C and 19A to 19E).
- This very shallow dynamic range greatly limits the analysis of subtle changes in receptor and effector trafficking and renders the assay inefficiently sensitive for high-throughput screening (HTS).
- the sensitive biosensors described herein may be useful for: • Real-time monitoring of cell surface receptor internalization and recycling (i.e.
- receptors returning to the plasma membrane after internalization They allow vetting removal of different receptors ⁇ e.g., GPCRs, RTKs) from the plasma membrane, and conversely, after inducing endocytosis, monitoring recycling of receptors through the regain of BRET signal at the PM following ligand removal. They also allow the study of regulation, the pharmacology and pathway-specificity of endocytosis of receptor trafficking.
- Pharmacological profiling of receptor e.g., GPCR
- ⁇ -arrestin trafficking They allow assessing the propensity of ligands to regulate the trafficking of receptor/p-arrestin complexes into distinct cellular compartments, and monitor the effects of drugs on both the initial internalization of receptor and the cycling of receptors ⁇ e.g., GPCRs) at the PM.
- the chaperone assay is independent on receptor signalling and is mostly a binding assay to detect ligands that stabilize or influence the conformation of a specific target (receptor). It is thus an interesting assay for screening orthosteric and allosteric ligands, in a signalling unbiased way.
- This binding assay could be further used to identify an "off-target" effect of an agent, i.e. to determine whether an agent identified against a particular target also cross- reacts with one or more additional targets (which could be assessed by determining whether the agent "rescues" these one or more additional targets using the biosensor described herein.
- the different cellular compartment markers remain in their selective compartments ⁇ e.g. plasma membrane (PM) or endosomes (ENDs)), and because only the receptor (or other tagged proteins such as parrestin, G protein subunits, effectors, etc.) moves from one compartment to the other upon modulation by a ligand ⁇ e.g., agonist stimulation, antagonist inhibition or pharmacological chaperones), it allows the tracking of trafficking proteins from the PM to ENDs, which may be revealed by a decrease (for the PM-rGFP/receptor-Rlucll assay) and/or an increase (for the END-rGFP/receptor-Rlucll assay) BRET signals, respectively.
- a ligand e.g., agonist stimulation, antagonist inhibition or pharmacological chaperones
- the receptor recycling can be monitored with ligand wash-off after its endocytosis.
- This assay is not limited to assessing endocytosis/recycling of receptors, but is also amenable to identification and characterisation of pharmacological chaperones (see Examples 7 to 1 1 ), and to also assess/monitor exocytosis and protein translocation processes. Therefore any type of protein movement (trafficking) between different intracellular compartments can be accessed quantitatively with high sensitivity using the biosensors described herein.
- biosensors can also be applied not only to protein ⁇ e.g., receptor, intracellular proteins) trafficking but also to monitoring any type of local concentration or density changes of proteins and other biomolecules in the cells. It can be done in two ways: First, if the rGFP or the Rlucll are tagged with specific intracellular organelle or cellular compartment markers, it may be possible to follow the protein of interest in different intracellular localization upon any specific condition. Second, the biosensors of the invention can be applied to monitoring local concentration or density of proteins, as well as the local density of lipids or other biomolecules ⁇ e.g., second messengers).
- the RLucll-rGFP pair was applied to detect membrane PI(4,5)P 2 generation using PLC51 -PH domain (Example 13, Figures 20A and B).
- PLC51 -PH-Rlucll and PLC51 -PH-rGFP (or rGFP fused to a PM targeting moiety such as Lyn or CAAX) are localized in the PM where PI(4,5)P 2 is located, so their local concentration is high enough to generate a BRET.
- PLC phospholipase C
- PLC51 -PH domain tagged Rlucl l and rGFP diffuse into the cytosol reducing the local concentration of rGFP and Rlucll , hence reducing the BRET signal.
- DAG-binding domain of PKCdelta C1 b may be used to measure PIP 2 hydrolysation into IP 3 and DAG ( Figures 22A and 23A).
- DAG enrichment causes the C1 b domain to bind to the membrane, bringing the BRET acceptor ⁇ e.g., rGFP, linked to a PM targeting moiety) and BRET donor ⁇ e.g., RLucll, linked to C1 b) closer to each other, inducing a higher BRET signal.
- BRET acceptor e.g., rGFP
- BRET donor e.g., RLucll
- the present invention provides biosensor for assessing the localization and/or trafficking of a protein/polypeptide of interest comprising: a first component comprising the protein/polypeptide of interest tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); a second component comprising a cellular compartment targeting moiety tagged with a Renilla GFP or a Renilla Luc; wherein if said protein/polypeptide of interest is tagged with said Renilla GFP, said cellular compartment targeting moiety is tagged with said Renilla Luc, and if said protein/polypeptide of interest is tagged with said Renilla Luc, said cellular compartment targeting moiety is tagged with said Renilla GFP.
- protein/polypeptide of interest refers to any protein/polypeptide (native, mutated, soluble or membrane-bound) or fragments/portions thereof, whose localization, translocation and/or recruitment to one or more cellular compartments is to be assessed.
- the protein of interest may be, for example, a receptor, a protein recruited to, or sequested away from, the plasma membrane upon receptor stimulation, a protein translocating to the nucleus, etc.
- the protein of interest is a receptor (i.e., a protein found attached to or embedded within the plasma membrane).
- the receptor is internalized upon ligand ⁇ e.g., agonist) binding.
- the receptor is a G-protein coupled receptor (GPCR).
- GPCR refers to full length native GPCR molecules as well as mutant GPCR molecules.
- a list of GPCRs is given in Foord et a/ (2005) Pharmacol Rev. 57, 279-288, which is incorporated herein by reference, and an updated list of GPCRs is available in the IUPHAR-DB database (Harmar AJ, et al. (2009) IUPHAR-DB: the IUPHAR database of G protein-coupled receptors and ion channels. Nucl. Acids Res. 37 (Database issue): D680-D685; Sharman JL, et al., (2013) IUPHAR-DB: updated database content and new features.
- the receptor is an ion channel, for example a voltage-gated ion channel ⁇ e.g., a sodium, calcium, potassium channel).
- a voltage-gated ion channel e.g., a sodium, calcium, potassium channel.
- a list of ion channels is available in the IUPHAR-DB database (see references above).
- the protein/polypeptide of interest is an adaptor protein ⁇ e.g., a signal transducing adaptor protein) a variant/fragment thereof.
- Adaptor proteins are proteins that are accessory to main proteins in a signal transduction pathway, and contain a variety of protein- binding modules ⁇ e.g., SH2 and/or SH3 domains) that link protein-binding partners together and facilitate the creation of larger signaling complexes. These proteins usually lack any intrinsic enzymatic activity themselves, but instead mediate specific protein-protein interactions that drive the formation of protein complexes. Examples of adaptor proteins include MyD88, Grb2 and SHC1 .
- the protein of interest is a ⁇ -arrestin, a ⁇ -arrestin variant, or an active portion/fragment thereof, for example ⁇ -arrestin-l (RefSeq: NP 004032.2 for isoform 1 ; NP_064647.1 for isoform 2) or ⁇ -3 ⁇ 8 ⁇ -2 (RefSeq: NP_004304.1 for isoform 1 ; NP_945355.1 for isoform 2; NP_001244257.1 for isoform 3; NP_001244258.1 for isoform 4; NP_001244259.1 for isoform 5; and NP_001244260.1 for isoform 6).
- ⁇ -arrestin-l RefSeq: NP 004032.2 for isoform 1 ; NP_064647.1 for isoform 2
- RefSeq NP_004304.1 for isoform 1 ; NP_945355.1 for isoform 2; NP_00
- the protein of interest is a G protein subunit, a G protein subunit variant, or an active portion/fragment thereof, e.g., a Ga, Gy or ⁇ subunit or an active fragment thereof.
- the present invention provides a biosensor for assessing G protein and/or GPCR activation, said biosensor comprising: a first component comprising a G protein subunit or an active fragment thereof tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); a second component comprising a PM targeting moiety tagged with a Renilla GFP or a Renilla Luc; wherein if said G protein subunit is tagged with said Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said G protein subunit is tagged with said Renilla Luc, said PM targeting moiety is tagged with said Renilla GFP.
- the present invention provides a biosensor for assessing whether a GPCR ligand modulates the activity of a G protein subunit, said biosensor comprising: a first component comprising said G protein subunit or an active fragment thereof tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); a second component comprising a PM targeting moiety tagged with a Renilla GFP or a Renilla Luc; wherein if said G protein subunit is tagged with said Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said G protein subunit is tagged with said Renilla Luc, said PM targeting moiety is tagged with said Renilla GFP.
- said G protein subunit or active fragment thereof is tagged with said Renilla Luc
- said PM targeting moiety is tagged with said Renilla GFP.
- the G protein subunit is a Gy subunit, e.g., Gy1 , Gy2, Gy3, Gy4, G 5, Gy6, Gy7, Gy8, G , Gy10, Gy1 1 , Gy12 or Gy13.
- the G protein subunit is a Ga subunit, e.g., Gq, Gs, Gi1 , Gi2, Gi3, Gt-cone, Gt-rod, Gt-gus, Gz, GoA, GoB, Golf, G1 1 , G12, G13, G14, or G15/G16.
- the G protein subunit is a Gp, e.g., ⁇ 1 , Gp2, Gp3, Gp4 or Gp5 (GP5-S or GP5-L).
- the protein of interest is a protein that binds to DAG, or an active portion/fragment thereof, e.g., a phorbol esters/diacylglycerol binding domain (DAG-binding domain).
- DAG-binding domain a phorbol esters/diacylglycerol binding domain
- the DAG-binding domain is from PKC5 (C1 b).
- C1 domain Other proteins that comprise a DAG-binding domain (commonly referered to as C1 domain) include, for example AKAP13; ARAF; ARHGAP29; ARHGEF2; BRAF; CDC42BPA; CDC42BPB; CDC42BPG; CHN1 ; CHN2; CIT; DGKA; DGKB; DGKD; DGKE; DGKG; DGKH; DGKI; DGKK; DGKQ; DGKZ; GMIP; HMHA1 ; KSR1 ; KSR2; MY09A; MY09B; PDZD8; PRKCA; PRKCB1 ; PRKCD; PRKCE; PRKCG; PRKCH; PRKCI; PRKCN; PRKCQ; PRKCZ; PRKD1 ; PRKD2; PRKD3; RACGAP1 ; RAF1 ; RASGRP; RASGRP1 ; RASGRP2; RASGRP3
- the protein of interest is PLC51 or or an active portion/fragment thereof capable of binding to PI(4,5)P 2 , e.g., the pleckstrin homology (PH) domain of PLC51 .
- PI(4,5)P 2 e.g., the pleckstrin homology (PH) domain of PLC51 .
- the protein of interest is a protein that binds to a small GTPase
- Small GTPases are a family of about 50 enzymes with a molecular mass of 21 kDa distantly related to the a subunit of G proteins, and which are involved in cell-growth regulation (Ras subfamily), membrane vesicle traffic and uncoating (Rab and ARF subfamilies), nuclear protein import (Ran subfamily) and organization of the cytoskeleton (Rho and Rac subfamilies).
- the protein of interest is a protein that binds to one or more members of of the Ras superfamily of small GTPases, e.g., Ras, Rho, Ran, Rab and Arf families of GTPases.
- the localization/translocation of such small GTPases may be assessed using a polypeptide comprising a Ras-binding domain (RBD), for example the RBD of RAF1 or a variant thereof that comprisies an A85K substitution (which has a higher affinity for Ras).
- RBD Ras-binding domain
- Other proteins that comprise a RBD include ARAF, BRAF, RGS12, RGS14, TIAM1 and PI3K.
- the protein of interest may thus comprises the entire/native sequence of a protein that binds to a small GTPase, or a variant of fragment thereof that maintains the ability to bind to a small GTPase.
- the protein of interest is a protein that binds to one or more members of the Rho superfamily of small GTPases, Rho (A, B & C), Rac (rad , 2, 3 or RhoG) or Cdc42 (Cdc42, RhoQ or RhoJ).
- the protein of interest is a protein that binds to a Rho protein (RhoA, RhoB and/or RhoC, preferably RhoA), or an active fragment thereof, for example a Cdc42/Rac interactive binding (CRIB) domain.
- the CRIB domain (EMBL- EBI/lnterpro accession No.
- IPR000095 is a conserved region within the N-terminal portion of the GTPase binding domain (GBD, also called p21 binding domain, PBD) that is present in many putative downstream effectors of small GTPases ⁇ e.g., Cdc42p- and/or Rho-like small GTPases), and comprises about 15-16 amino acids.
- GCD GTPase binding domain
- PBD p21 binding domain
- Proteins that comprise a CRIB domain include mammalian activated Cdc42-associated kinases (ACKs), mammalian p21 -activated kinases (PAK1 to PAK4), Rhotekin (RTKN), mammalian Wiskott-Aldrich Syndrome Proteins (WASPs), kinases of the protein kinase C superfamily, such as serine/threonine protein kinase N (PKN, also known as protein kinase C-related kinase, PRK).
- ACKs activated Cdc42-associated kinases
- PAK1 to PAK4 mammalian p21 -activated kinases
- RTKN Rhotekin
- WASPs mammalian Wiskott-Aldrich Syndrome Proteins
- kinases of the protein kinase C superfamily such as serine/threonine protein kinase N (PKN, also known as protein
- the protein of interest comprises the CRIB domain of human PKN1 (Uniprot reference: Q16512-1 ) or PKN2 (Uniprot reference: Q16513), preferably PKN1 .
- the CRIB domain of human PKN1 comprises the sequence VQSEPRSWSLLEQLG (SEQ ID NO:40), which corresponds to residues 6-20 of native human PKN1 (Uniprot reference: Q16512-1 ).
- the present invention provides a biosensor for assessing the activation of a small GTPase ⁇ e.g., Rho), said biosensor comprising: a first component comprising a polypeptide comprising a domain that binds to said small GTPase ⁇ e.g., a CRIB domain) tagged with a Renilla green fluorescent protein ⁇ Renilla GFP) or a Renilla luciferase protein ⁇ Renilla Luc); a second component comprising a PM or endosomal targeting moiety tagged with a Renilla GFP or a Renilla Luc; wherein if said polypeptide comprising a domain that binds to said small GTPase ⁇ e.g.
- a CRIB domain is tagged with said Renilla GFP
- said PM or endosomal targeting moiety is tagged with said Renilla Luc
- said polypeptide comprising a domain that binds to said small GTPase ⁇ e.g., a CRIB domain) is tagged with said Renilla Luc
- said PM or endosomal targeting moiety is tagged with said Renilla GFP.
- the small GTPase is a Rho protein ⁇ e.g. , RhoA).
- the domain that binds to the small GTPase is a CRIB domain, such as the CRIB domain of human PKN1 .
- the second component comprises a PM targeting moiety.
- Renilla luciferase refers to an oxidative enzyme used in bioluminescence and that is derived from an organism of the genus Renilla, such as Renilla reniformis or Renilla mulleri. It includes the native luciferase from a Renilla organism, or variants thereof, for example the native form (in terms of amino acid sequence) of Renilla reniformis luciferase (Rluc) or variants thereof such as Rlucll or Rluc8.
- Renilla luciferase refers to an oxidative enzyme used in bioluminescence and that is derived from an organism of the genus Renilla, such as Renilla reniformis or Renilla mulleri. It includes the native luciferase from a Renilla organism, or variants thereof, for example the native form (in terms of amino acid sequence) of Renilla reniformis luciferase (Rluc) or variants thereof such as Rlucll or
- RlucN refers to a mutant form of Renilla reniformis luciferase that comprises the following amino acid substitutions: A55T, C124A and M185V relative to a native Renilla luciferase.
- the Rlucll comprises the sequence depicted in Example 1 (SEQ ID NO:10).
- Rluc8 refers to a mutant form of Renilla reniformis luciferase that comprises the following amino acid substitutions: A55T, C124A, S130A, K136R, A143M, M185V, M253L, and S287L relative to a native Renilla luciferase.
- the amino acid sequence of native Renilla mulleri luciferase is disclosed in GenBank accession No. AAG54094.1 .
- Renilla GFP refers to a green fluorescent protein that is derived from organisms of the genus Renilla, such as Renilla reniformis or Renilla mulleri. It includes the native GFP from a Renilla organism, or variants thereof.
- the Renilla GFP is a Renilla reniformis GFP (referred to herein as "rGFP"), in a further embodiment, the native form (in terms of amino acid sequence) of Renilla reniformis GFP.
- the rGFP comprises the sequence depicted in Example 1 (SEQ ID NO:1 1 ).
- the amino acid sequence of native Renilla mulleri GFP is disclosed in GenBank accession No.
- the nucleic acid sequence of the Renilla luciferase and/or Renilla GFP may be codon-optimized for expression in human cells (i.e. "humanized”, see, e.g., WO 2002057451 for a humanized version of Renilla mulleri GFP).
- RET Resonance energy transfer
- Bioluminescence Resonance Energy Transfer is based on the non-radiative transfer of energy between a donor bioluminophore (bioluminescent enzyme such as renilla luciferase) and an acceptor fluorophore ⁇ e.g., renilla GFP).
- a donor bioluminophore bioluminescent enzyme such as renilla luciferase
- an acceptor fluorophore ⁇ e.g., renilla GFP
- cellular compartment targeting moiety refers to a biomolecule, preferably a polypeptide or peptide, which, when attached to the Renilla GFP or Renilla Luc (as a fusion protein, for example), targets them to a particular compartment, organelle or localization within the cell, such as for example the plasma membrane (or a particular subdomain of the plasma membrane, such as lipid rafts), the endosomes ⁇ e.g.
- markers are typically proteins (or suitable fragments thereof) that are normally found at high levels in the targeted particular compartment.
- Peptides that target proteins to specific compartment, organelle or localization within the cell include endoplasmic reticulum (ER) signal peptide or ER-retrieval sequence, nuclear localization signal (NLS) peptide, and mitochondrial localization signal (MLS) peptide, for example.
- the cellular compartment targeting moiety is a plasma membrane (PM) targeting moiety.
- PM plasma membrane
- Any moiety capable of recruiting the Renilla GFP or Renilla Luc to the PM may be used in the biosensors.
- the Renilla GFP or Renilla Luc may thus be fused to any protein found at the plasma membrane ⁇ e.g., receptors or any other protein found at the PM), or fragments thereof.
- An example of such proteins is Caveolin-1 , which the main component of the caveolae (a type of lipid raft that correspond to small (50-100 nm) invaginations of the plasma membrane) found in many cell types.
- Caveolin-1 a comprising residues 2-178
- Caveolin-1 ⁇ corresponding to the 32-178 sequence
- Other examples of such moiety include peptides/polypeptides comprising a signal sequence for protein lipidation/fatty acid acylation, such as myristoylation, palmitoylation and prenylation, as well as polybasic domains.
- proteins are known to be myristoylated, palmitoylated and/or prenylated ⁇ e.g., protein kinases and phosphatases such as Yes, Fyn, Lyn, Lck, Hck, Fgr, G a proteins, nitric oxide synthase, ADP-ribosylation factors (ARFs), calcium binding proteins and membrane or cytoskeleton-associated structural proteins such as MARCKS (see, e.g., Wright et al., J Chem Biol.
- the myristoylation, palmitoylation and prenylation signal sequences from any of these proteins may be used in the biosensor.
- the myristoylation and/or palmitoylation sequence is from the Lyn kinase.
- the PM membrane targeting moiety comprises a CAAX motif (C is cysteine residue, AA are two aliphatic residues, and X represents any amino acid.
- CAAX motifs are found in "CAAX proteins” that are defined as a group of proteins with a specific amino acid sequence at C-terminal that directs their post translational modification.
- CAAX proteins encompass a wide variety of molecules that include nuclear lamins (intermediate filaments) such as prelamin A, lamin B1 and lamin B2, Ras and a multitude of GTP-binding proteins (G proteins) such as Ras, Rho, Rac, and Cdc42, several protein kinases and phosphatases, etc.
- CAAX box is derived from a human RAS family protein, for example HRAS, NRAS, Ral-A, KRAS4A or KRAS4b.
- HVR hypervariable region
- HRAS KLNPPDESGP GCMSCKCVLS (SEQ ID NO:33); NRAS: KLNSSDDGTQGCMG/-PCW ; (SEQ ID NO:34); KRAS4A: KISKEEKTPGCW7 C//M; (SEQ ID NO:35); KRAS4b: KMSKDG KKKKKKSKTKCVIM: (SEQ ID NO:36); Ral-A/Ral1 : KNGKKKRKSLAKRIRERCCIL (SEQ ID NO:37).
- the PM targeting moiety comprises the sequence GKKKKKKSKTKCVIM (SEQ ID NO:7) from KRAS4b.
- the PM targeting moiety comprises the plasma-membrane targetting palmitoylation sequence from hRas and prenylation signal sequence from Ral-A/Ral1 (sequence: CMSCKCCIL, SEQ ID NO:43).
- proteins also contain a non-lipid, polybasic domain that targets the PM such as Ras small GTPases, phosphatase PTEN, nonreceptor tyrosine kinase Src, actin regulators WASP and MARCKS, and G protein-coupled receptor kinases (GRKs) such as GRK5.
- the polybasic domain is from GRK5, and comprises the sequence SPKKGLLQRLFKRQHQNNSKS (SEQ ID NO:8).
- the present invention provides a biosensor comprising: a cell or membrane preparation comprising: (i) a first component comprising a ⁇ -arrestin tagged with a Renilla GFP or a Renilla Luc; (ii) a second component comprising a plasma membrane (PM) targeting moiety tagged with a Renilla GFP or a Renilla Luc; and a GPCR; wherein if said ⁇ - arrestin is tagged with said Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said ⁇ -arrestin is tagged with said Renilla Luc, said PM targeting moiety is tagged with said Renilla GFP.
- Such biosensor may be useful to monitor/measure the recruitment of a ⁇ -arrestin to a GPCR located at the plasma membrane.
- the cellular compartment targeting moiety is an endosomal targeting moiety.
- endosomal targeting moieties/markers include the Rab family of proteins (RAB4, RAB5, RAB7, RAB9 and RAB1 1), mannose 6-phosphate receptor (M6PR), caveolin-1 and -2, transferrin and its receptor, clathrin, as well as proteins comprising a FYVE domain such as early endosome autoantigen 1 (EEA1 ), Rabenosyn-5, Smad anchor for receptor activation (SARA), Vps27p and Endofin.
- markers are more specific to early endosomes ⁇ e.g., RAB4, Transferrin and its receptor, and proteins comprising a FYVE domain), others are more specific to late endosomes ⁇ e.g., RAB7, RAB9, and M6PR) and others are more specific to recycling endosomes ⁇ e.g., RAB1 1 , RAB4).
- these proteins or suitable fragments thereof may be fused to Renilla Luc or Renilla GFP to link/target them to an endosomal localization.
- the endosomal targeting moiety comprises a FYVE domain.
- the FYVE domain is defined by the three conserved elements: the N-terminal WxxD, the central RR/KHHCR, and the C-terminal RVC motifs.
- the endosomal targeting moiety comprises the FYVE domain of Endofin, for example about residues 739 to 806 human Endofin.
- the cellular compartment targeting moiety is a lysosomal targeting moiety, such as for example LAMP1 and LAMP2.
- these proteins or suitable fragments thereof may be fused to Renilla Luc or Renilla GFP to link/target them to a lysosomal localization.
- the cellular compartment targeting moiety is a peroxisomal targeting moiety, such as for example PMP70, PXMP2 and Catalase.
- these proteins or suitable fragments thereof may be fused to Renilla Luc or Renilla GFP to link/target them to a peroxisomal localization.
- the cellular compartment targeting moiety is an autophagosomal targeting moiety, such as for example ATG (AuTophaGy related) family proteins (ATG4, ATG5, ATG16, ATG 12, see Lamb et al, Nature Reviews Molecular Cell Biology 14, 759-774 (2013)), LC3A/B and SQSTM1/p62.
- ATG Autophagosomal targeting moiety
- the cellular compartment targeting moiety is a ribosome targeting moiety.
- endosomal targeting moieties/markers include the Ribosomal Proteins (L7a, S3 and S6). Thus, these proteins or suitable fragments thereof may be fused to Renilla Luc or Renilla GFP to link/target them to a ribosomal localization.
- the cellular compartment targeting moiety is an endoplasmic reticulum (ER) targeting moiety.
- ER targeting moieties/markers include ERp72, ERp29, Protein disulphide isomerase (PDI), HSP70 family proteins such as GRP78 (HSPA5), GRP94 (HSP90B1 ) and GRP58 (PDIA3), Calnexin and Calreticulin.
- PDI Protein disulphide isomerase
- HSP70 family proteins such as GRP78 (HSPA5), GRP94 (HSP90B1 ) and GRP58 (PDIA3)
- Calnexin and Calreticulin may be fused to Renilla Luc or Renilla GFP to link/target them to an ER localization.
- the cellular compartment targeting moiety is a Golgi targeting moiety.
- Golgi targeting moieties/markers include eNOS ⁇ e.g., the N- terminal portion thereof, J. Liu et al., Biochemistry, 35 (1996), pp. 13277-13281 ), GM130, Golgin- 97, the 58K protein, Trans-Golgi network membrane protein 2 (TGOLN2), TGN46, TGN38, Mannosidase 2, Syntaxin 6, GM130 (GOLGA2), Golgin-160, Membrin (GS27), GS28, Coatomer proteins, Rbetl and RCAS1 .
- these proteins or suitable fragments thereof may be fused to Renilla Luc or Renilla GFP to link/target them to a Golgi apparatus localization.
- the Golgi targeting moiety the N-terminal portion of a human eNOS protein, for example residues 1 to 73 of human eNOS1 (SEQ ID NO: 42).
- the cellular compartment targeting moiety is a mitochondria targeting moiety.
- mitochondria targeting moieties/markers include AIF, COX IV, Cytochrome C, hexokinase I, SOD1 , SDHA, Pyruvate dehydrogenase, VDAC, TOMM22, UCP1 , UCP2, UCP3, PHB1 Galpha12 (or the N-terminal portion thereof; Andreeva et al., FASEB J. 2008 Aug;22(8):2821 -31 .
- a protein of the Bcl-family member or a fragment thereof for example a fragment of Bcl-XL (RKGQERFNRWFLTGMTVAGVVLLGSLFSRK, SEQ ID NO:87, Mossalam et al., Mol Pharm. 2012 May 7; 9(5): 1449-1458).
- these proteins or suitable fragments thereof may be fused to Renilla Luc or rGFP to link/target them to a mitochondrial localization.
- the nuclear targeting moiety may also comprise a mitochondrial targeting signal, which is a 10-70 amino acid long peptide that directs newly synthesized proteins to the mitochondria.
- Mitochondrial targeting signals can contain additional signals that subsequently target the protein to different regions of the mitochondria, such as the mitochondrial matrix.
- the cellular compartment targeting moiety is a nuclear targeting moiety.
- nuclear targeting moieties/markers include Lamin A/C, Nucleoporins (NUP), ASHL2, ESET, Histones, LSD1 , DNA repair enzymes such as PARP, and P84/THOC1 .
- NUP nuclear localization signal or sequence
- the nuclear targeting moiety may also comprises a nuclear localization signal or sequence (NLS), which is an amino acid sequence that tags a protein for import into the cell nucleus by nuclear transport.
- this signal consists of one or more short sequences of positively charged lysines or arginines exposed on the protein surface.
- the best characterized transport signal is the classical NLS (cNLS) for nuclear protein import, which consists of either one (monopartite) or two (bipartite) stretches of basic amino acids.
- Monopartite cNLSs are exemplified by the SV40 large T antigen NLS ( 126 PKKKRRV 132 ) (SEQ ID NO:38) and bipartite cNLSs are exemplified by the nucleoplasms NLS ( 155 KRPAATKKAGQAKKKK 170 ) (SEQ ID NO:39).
- the cellular compartment targeting moiety is a nuclear export sequence (NES).
- NES is a short amino acid sequence (typically 4 hydrophobic residues) in a protein that targets it for export from the cell nucleus to the cytoplasm through the nuclear pore complex using nuclear transport.
- the sequence of such NES may be for example LxxxLxxLxL, where "L” is a hydrophobic residue (often leucine) and "x" is any other amino acid.
- proteins that are translocated from cytosol to nucleus such as ERK or MDM2
- a decrease in the BRET signal is detected using an NES moiety.
- the cellular compartment targeting moiety is a cytoskeleton targeting moiety, for example actin or a fragment thereof, or a protein comprising an actin-binding domain (ABD), such as the N-terminal F-actin binding domain of lnositol-1 ,4,5-trisphosphate-3-kinase-A (ITPKA) (Johnson and Schell, Mol. Biol. Cell December 15, 2009 vol. 20 no. 24 5166-5180).
- the cytoskeleton targeting moiety is a peptide comprising the sequence MGVADLIKKFESISKEE (SEQ ID NO: 88) ("Lifeact", Riedl et al., Nat Methods.
- the present invention provides a biosensor for assessing a modulation (increase or decrease) in the amount of a biomolecule at a cellular compartment between a first and a second condition, said biosensor comprising: a first component comprising a Renilla green fluorescent protein ⁇ Renilla GFP) tagged with a protein marker that binds to said biomolecule; and a second component comprising a Renilla luciferase protein ⁇ Renilla Luc) tagged with said protein marker.
- the present invention provides a biosensor for assessing a modulation (increase or decrease) in the amount of a biomolecule at a cellular compartment between a first and a second condition, said biosensor comprising: a first component comprising a protein marker that binds to said biomolecule tagged with a Renilla GFP or Renilla Luc; and a second component comprising a cellular compartment targeting moiety tagged with a Renilla GFP or Renilla Luc; wherein if said protein marker is tagged with Renilla GFP, said cellular compartment targeting moiety is tagged with Renilla Luc and vice-versa.
- Such biosensors may be used in a method for assessing a modulation in the amount of a biomolecule at a cellular compartment between a first and a second condition, e.g., in the presence and absence of an agent. If the agent increase the amount of biomolecule at the cellular compartment ⁇ e.g., PM) the BRET signal will be increased in the presence of the agent and vice- versa.
- the protein marker may be any protein or fragment thereof that binds to said biomolecule, and thus whose concentration or density at said cellular compartment is dependent on the concentration or density of said biomolecule ⁇ e.g., a second messenger, including cyclic nucleotides such as cAMP and cGMP, IP 3 , DAG, PIP 3 , Ca2 + ions) at said cellular compartment.
- a second messenger including cyclic nucleotides such as cAMP and cGMP, IP 3 , DAG, PIP 3 , Ca2 + ions
- PLC51 localization at the PM is dependent on the presence of PIP 2 and/or PIP 3 .
- PLC51 diffuse into the cytosol reducing its concentration/density at the PM.
- the concentration/density of PLC51 (or a fragment thereof that binds to PIP 2 and/or PI P 3 , such as its PH domain) at the PM which may be measured by BRET using Renilla Luc- and Renilla GFP-tagged PLC51 (or a fragment thereof, e.g., SEQ ID NO:25), or with a Renilla Luc or GFP-tagged PLC51 and a Renilla Luc or GFP-tagged PM- targeting moiety, may be used as an indicator of the concentration or density of the biomolecule at the PM.
- the PH domain and Phox homology domain (PX domain) of certain proteins interact with PIP 3 , thus a protein marker comprising a PH or PX domain selective for PIP 3 binding, could be used to as an indicator of the concentration or density of PIP 3 at the PM.
- a protein marker comprising a PH or PX domain selective for PIP 3 binding
- C1 domain also known as phorbol esters/diacylglycerol binding domain, which is found for example in the N-terminal portion of protein kinase.
- PLCyl can bind to different phospholipids including PIP 3 .
- the C1 domain binds to diacylglycerol (DAG), and thus a protein marker comprising a C1 domain could be used to as an indicator of the concentration or density of DAG at the PM.
- DAG diacylglycerol
- any protein or protein domain capable of binding to a biomolecule such as a second messenger and whose concentration or density at said cellular compartment is dependent on the concentration or density of said biomolecule could be used in such biosensor.
- biomolecule refers to any molecule that may be produced by or present in a cell, for example a protein, a peptide, an amino acid, a nucleic acid (DNA or RNA), a lipid or fatty acid, a phospholipid, a sugar (polysaccharide), or any other compound such as ATP, AMP, ADP, histamine, etc.
- the biomolecule is a second messenger (i.e.
- the biomolecule is a hydrophobic molecule ⁇ e.g., a phospholipid) found at the PM, such as diacylglycerol and phosphatidylinositols.
- the variant as used herein refers to a protein/polypeptide having has an identity or similarity of at least 60% with a reference ⁇ e.g., native) sequence and retains a desired activity thereof, for example the capacity to bind to a target protein and/or to translocation to a cellular compartment.
- the variant has a similarity or identity of at least 65, 70, 75, 80, 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98 or 99% with a reference ⁇ e.g., native) sequence and retains a desired activity thereof.
- Similarity and “identity” refers to sequence similarity/identity between two polypeptide molecules.
- the similarity or identity can be determined by comparing each position in the aligned sequences.
- a degree of similarity or identity between amino acid sequences is a function of the number of matching or identical amino acids at positions shared by the sequences.
- Optimal alignment of sequences for comparisons of similarity or identity may be conducted using a variety of algorithms, such as the local homology algorithm of Smith and Waterman, 1981 , Adv. Appl. Math 2: 482, the homology alignment algorithm of Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443, the search for similarity method of Pearson and Lipman, 1988, Proc. Natl. Acad. Sci.
- the Renilla Luc or Renilla GFP may be fused N-terminal, within or C-terminal relative to the cellular compartment targeting moiety.
- the cellular compartment targeting moiety is a PM targeting moiety, and it is fused to the N-terminal end of said Renilla Luc or said Renilla GFP.
- the cellular compartment targeting moiety is an endosomal targeting moiety, and it is fused to the C-terminal end of said Renilla Luc or said Renilla GFP.
- the Renilla Luc or Renilla GFP may be fused N-terminal, within (see, e.g., Ga subunit with internal Rlucll diescribed in the examples), or C-terminal relative to the protein of interest.
- the Renilla Luc or Renilla GFP is fused to the N-terminal end of the protein of interest.
- the Renilla Luc or Renilla GFP is fused to the C-terminal end of the protein of interest.
- the protein of interest is tagged with a Renilla Luc and the cellular compartment marker is tagged with a Renilla GFP.
- Renilla Luc or Renilla GFP may be covalently linked to the protein of interest or the cellular compartment targeting moiety either directly ⁇ e.g., through a peptide bond) or "indirectly" via a suitable linker moiety, e.g., a linker of one or more amino acids ⁇ e.g., a polyglycine linker) or another type of chemical linker ⁇ e.g., a carbohydrate linker, a lipid linker, a fatty acid linker, a polyether linker, PEG, etc.
- a suitable linker moiety e.g., a linker of one or more amino acids ⁇ e.g., a polyglycine linker
- another type of chemical linker e.g., a carbohydrate linker, a lipid linker, a fatty acid linker, a polyether linker, PEG, etc.
- one or more additional domain(s) may be inserted before (N-terminal), between or after (C-terminal) the components defined above.
- the Renilla Luc and/or Renilla GFP are covalently linked through a peptide bond to the protein of interest and/or the cellular compartment targeting moiety.
- a peptide linker is present between Renilla Luc or Renilla GFP and the protein of interest or the cellular compartment targeting moiety.
- the linker comprises about 4 to about 50 amino acids, about 4 to about 40, 30 or 20 amino acids, or about 5 to about 15 amino acids, e.g., 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids.
- the linker is one of the linker described in Example 1 below and/or Figures 11 A-11 D).
- the first and second components are linked together to provide a unimolecular biosensor.
- the first and second components are covalently attached by a linker, preferably a flexible polypeptide linker.
- the flexible polypeptide linker has a length corresponding to the length of a random amino acid sequence of about 50 to about 500- 1000 amino acids, for example corresponding to the length of a random amino acid sequence of about 100 to about 400-500 amino acids, preferably about 200-400 amino acids, for example about 300.
- the flexible linker comprises a random amino acid sequence of about 50 to about 500-1000 amino acids, for example a random amino acid sequence of about 100 to about 400-500 amino acids, preferably a random amino acid sequence of about 200-400 amino acids, for example about 300 amino acids.
- Methods for designing flexible amino acid linkers, and more specifically linkers with minimal globularity and maximal disorder, are known in the art. This may be achieved, for example, using the Globplot 2.3 program.
- the sequence may be further optimized to eliminate putative aggregation hotspots, localization domains, and/or interaction and phosphorylation motifs. Such a unimolecular biosensor allows the assessment of BRET in intact cells as well as in membrane preparations.
- the present invention provides a nucleic acid encoding the above- defined first and/or second component(s).
- the nucleic acid is present in a vector/plasmid, in a further embodiment an expression vector/plasmid.
- Such vectors comprise a nucleic acid sequence capable of encoding the above-defined first and/or second component(s) operably linked to one or more transcriptional regulatory sequence(s), such as promoters, enhancers and/or other regulatory sequences.
- the nucleic acid encodes the first and second components (polycistronic construct).
- vector refers to a nucleic acid molecule, which is capable of transporting another nucleic acid to which it has been linked.
- One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
- Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked.
- Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors”.
- a recombinant expression vector of the present invention can be constructed by standard techniques known to one of ordinary skill in the art and found, for example, in Sambrook et al. (1989) in Molecular Cloning: A Laboratory Manual.
- the vectors of the present invention may also contain other sequence elements to facilitate vector propagation and selection in bacteria and host cells.
- the vectors of the present invention may comprise a sequence of nucleotides for one or more restriction endonuclease sites. Coding sequences such as for selectable markers and reporter genes are well known to persons skilled in the art.
- a recombinant expression vector comprising a nucleic acid sequence of the present invention may be introduced into a cell (a host cell), which may include a living cell capable of expressing the protein coding region from the defined recombinant expression vector.
- the living cell may include both a cultured cell and a cell within a living organism.
- the invention also provides host cells containing the recombinant expression vectors of the invention.
- the terms "cell”, “host cell” and “recombinant host cell” are used interchangeably herein. Such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- Vector DNA can be introduced into cells via conventional transformation or transfection techniques.
- transformation and “transfection” refer to techniques for introducing foreign nucleic acid into a host cell, including calcium phosphate or calcium chloride co- precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection and viral -mediated transfection. Suitable methods for transforming or transfecting host cells can for example be found in Sambrook et al. ⁇ Molecular Cloning: A Laboratory Manual, 2 nd Edition, Cold Spring Harbor Laboratory press (1989)), and other laboratory manuals.
- Transcriptional regulatory sequence/element is a generic term that refers to DNA sequences, such as initiation and termination signals, enhancers, and promoters, splicing signals, polyadenylation signals which induce or control transcription of protein coding sequences with which they are operably linked.
- a first nucleic acid sequence is "operably-linked” with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably-linked to a coding sequence if the promoter affects the transcription or expression of the coding sequences.
- operably-linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in reading frame.
- enhancers generally function when separated from the promoters by several kilobases and intronic sequences may be of variable lengths, some polynucleotide elements may be operably-linked but not contiguous.
- the present invention provides a kit comprising a first nucleic acid encoding the first component and a second nucleic acid encoding the second component.
- the present invention provides a cell comprising or expressing the above-defined first and/or second component(s).
- the cell has been transfected or transformed with a nucleic acid encoding the above-defined first and/or second component(s).
- the invention further provides a recombinant expression system, vectors and cells, such as those described above, for the expression of the first and/or second component(s) of the invention, using for example culture media and reagents well known in the art.
- the cell may be any cell capable of expressing the first and second component(s) defined above. Suitable host cells and methods for expression of proteins are well known in the art. Any cell capable of expressing the component(s) defined above may be used.
- eukaryotic host cells such as mammalian cells may be used ⁇ e.g., rodent cells such as mouse, rat and hamster cell lines, human cells/cell lines).
- the above-mentioned cell is a human cell line, for example an embryonic kidney cell line (e.g., HEK293 or HEK293T cells).
- the above-mentioned biosensor comprises a cell comprising or expressing the first and second components. In another embodiment, the above-mentioned biosensor comprises a membrane preparation comprising the first and second components.
- the present invention provides a method for comparing the trafficking of a protein of interest in a cell under a first and a second condition, said method comprising: measuring the BRET signal in the biosensor defined herein under said first condition; and measuring the BRET signal in the biosensor defined herein under said second condition; wherein a difference in said BRET signal between said first and second conditions is indicative of a difference in the trafficking of said protein of interest under said first and second conditions.
- the first condition is no activation and the second condition is activation ⁇ e.g., using an agonist) or vice-versa.
- the first condition is no inhibition and the second condition is inhibition ⁇ e.g., using an antagonist) or vice-versa.
- the present invention provides a method for determining whether an agent modulates (increases or decreases) the density or concentration of a protein of interest at a cellular compartment, said method comprising: measuring the BRET signal in the biosensor defined herein in the presence and absence of said agent; wherein a difference in said BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent modulates (increases or decreases) the density or concentration of said protein of interest at the cellular compartment.
- An increase in the BRET signal being indicative that the agent increases the density or concentration of said protein of interest at the cellular compartment
- a decrease in the BRET signal being indicative that the agent decreases the density or concentration of said protein of interest at the cellular compartment.
- the BRET signal may be measured, for example, by determining the intensity of the Renilla GFP signal (light intensity), and/or by calculating the ratio of the signal or light intensity emitted by the Renilla GFP over the signal or light intensity emitted by the Renilla Luc (BRET ratio).
- the BRET signal may be measured using a microplate reader or microscope with a suitable filter set for detecting the Renilla luciferase (donor) and/or rGFP (acceptor) light emissions.
- a biosensor comprising a mitochondrial targeting moiety tagged with Renilla GFP or Renilla Luc may be used.
- An increase in the BRET signal in the presence of the agent or under the given condition is indicative of the "recruitment" of the protein of interest to the mitochondria (i.e., an increase in the concentration/density of the protein of interest at the mitochondria).
- a decrease in the BRET signal in the presence of the agent or under the given condition is indicative of a decrease in the concentration/density of the protein of interest at the mitochondria.
- suitable cellular compartment targeting moieties a similar approach may be used to study the trafficking of proteins to different cellular compartments.
- the method comprises determining whether an agent or condition induces (i.e. increases) the trafficking of a cell surface receptor of interest in an endosomal compartment (i.e., increases the concentration/density of the protein of interest in the endosomes),
- an agent or condition induces (i.e. increases) the trafficking of a cell surface receptor of interest in an endosomal compartment (i.e., increases the concentration/density of the protein of interest in the endosomes)
- the present invention provides a method for comparing the trafficking of a cell surface receptor of interest at an endosomal compartment, said method comprising: measuring the BRET signal in the biosensor comprising an endosomal targeting moiety as defined herein under said first condition; and measuring the BRET signal in the biosensor comprising an endosomal targeting moiety as defined herein under said second condition; wherein a difference in the BRET signal between said first and second conditions is indicative of a difference in the trafficking of said protein of interest at said endosomal compartment under said first
- the present invention provides a method for determining whether an agent induces (i.e. increases) the trafficking of a cell surface receptor of interest in a cell at an endosomal compartment, said method comprising: measuring the BRET signal in the biosensor comprising an endosomal targeting moiety, preferably an endosomal targeting moiety comprising a FYVE domain (e.g., the FYVE domain of Endofin) as defined herein in the presence and absence of said agent; wherein a higher BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent induces (i.e. increases) the trafficking of a cell surface receptor of interest in a cell in said endosomal compartment (i.e. increase the concentration/density of the protein of interest in the endosomes).
- biosensors each comprising a different endosomal targeting moiety ⁇ e.g., a first biosensor comprising a targeting moiety for the early endosomes and a second biosensor comprising a targeting moiety for the late endosomes).
- the present invention provides a method for comparing the internalization of a cell surface receptor of interest in a cell under a first and a second condition, said method comprising: measuring the BRET signal in the biosensor comprising a PM targeting moiety as defined herein under said first condition; and measuring the BRET signal in the biosensor comprising a PM targeting moiety as defined herein under said second condition; wherein a difference in said BRET signal between said first and second conditions is indicative of a difference in the internalization of said cell surface receptor of interest under said first and second conditions.
- the present invention provides a method for determining whether an agent induces the internalization and/or sequestration of a cell surface receptor of interest in a cell, said method comprising: measuring the BRET signal in the biosensor comprising a PM targeting moiety as defined herein in the presence and absence of said agent; wherein a lower BRET signal in the presence of said agent relative to the absence thereof is indicative that said agent induces the internalization and/or sequestration of the cell surface receptor of interest.
- biosensors described herein further permit to determine whether internalized receptors are recycled back at the cell surface, and if so to assess the kinetics of receptor recycling.
- the present invention provides a method for monitoring the recycling of an internalized receptor of interest at the cell surface, said method comprising: (a) contacting the biosensor comprising a PM targeting moiety as defined herein in the presence of a ligand that induces the internalization of said receptor; (b) measuring a first BRET signal in the biosensor; (c) washing said biosensor to remove said ligand; (d) measuring a second BRET signal in the biosensor after said washing ; and (e) determining the recycling of an internalized receptor of interest at the cell surface by comparing said first and second signals, wherein a higher second BRET signal relative to said first BRET signal is indicative of recycling of the internalized receptor of interest at the cell surface.
- the present invention provides a method for monitoring the recycling of an internalized receptor of interest at the cell surface, said method comprising: (a) contacting a first and a second biosensor comprising a PM targeting moiety as defined herein in the presence of a ligand that induces the internalization of said receptor; (b) measuring a BRET signal in the first biosensor after said contacting; (c) washing said second biosensor to remove said ligand; (d) measuring a BRET signal in the second biosensor after said washing; and (e) determining the recycling of an internalized receptor of interest at the cell surface by comparing the BRET signal in the first and second biosensors, wherein a higher BRET signal in said second biosensor relative to said first biosensor is indicative of recycling of the internalized receptor of interest at the cell surface.
- the method further comprises repeating steps (d) and (e) at different times after washing to study the kinetics of recycling of the internalized receptor of interest.
- the present invention provides a method for monitoring a modulation of G protein and/or GPCR activity between a first condition and a second condition, said method comprising: measuring the BRET signal in the biosensor for monitoring G protein and/or GPCR modulation as defined herein under said first condition; and measuring the BRET signal in the biosensor for monitoring G protein and/or GPCR modulation as defined herein under said second condition; wherein a difference in the BRET signal between said first and second conditions is indicative of a modulation of G protein and/or GPCR activity between said first and second conditions.
- the first condition is absence of a test compound ⁇ e.g., putative inhibitor or agonist
- the second condition is presence of a test compound, or vice-versa.
- a lower BRET signal in the presence of the test compound is indicative that the test compound is an agonist.
- the present invention provides a method for determining whether a GPCR ligand modulates the activity of a G protein subunit of interest, said method comprising: measuring the BRET signal in the biosensor for monitoring G protein and/or GPCR modulation as defined herein in the presence or absence of said GPCR ligand; wherein a difference in the BRET signal in the presence vs. absence of said GPCR ligand is indicative that said GPCR ligand modulates the activity of the G protein subunit of interest.
- the present invention provides a method for monitoring a modulation of the activity of a small GTPase between a first condition and a second condition, said method comprising: measuring the BRET signal in the biosensor for assessing the activation of a small GTPase as defined herein under said first condition; and measuring the BRET signal in the biosensor for for assessing the activation of a small GTPase as defined herein under said second condition; wherein a difference in the BRET signal between said first and second conditions is indicative of a modulation of the activity of a small GTPase between said first and second conditions.
- the first condition is absence of a test compound ⁇ e.g., putative inhibitor or agonist
- the second condition is presence of a test compound, or vice-versa.
- a higher BRET signal in the presence of the test compound is indicative that the test compound is an agonist (recruitment of the small GTPase at the PM or endosomes).
- the present invention provides a method for determining whether a test agent modulates the activity of a small GTPase ⁇ e.g., a Rho protein), said method comprising: measuring the BRET signal in the biosensor for assessing the activation of a small GTPase as defined herein in the presence or absence of said test agent; wherein a difference in the BRET signal in the presence vs. absence of said test agent is indicative that said test agent modulates the activity of said small GTPase.
- a test agent modulates the activity of a small GTPase ⁇ e.g., a Rho protein
- PC pharmacological chaperone
- a pharmacological chaperone for a protein is a molecule that binds to the protein, resulting in proper folding, trafficking, non-aggregation, and/or activity of the protein, and/or to modulate the folding of the protein (inducing a folding of the protein that is different than the folding in the absence of the chaperone).
- small molecule inhibitors of enzymes associated with lysosomal storage disorders can both rescue folding and activity of the mutant enzyme, and enhance folding and activity of the wild-type enzyme (see U.S. Patent Nos. 6,274,597; 6,583,158; 6,589,964; 6,599,919; and 6,916,829).
- administration of small molecule derivatives of glucose and galactose which were specific competitive inhibitors of mutant enzymes associated with LSDs, effectively increased in vitro and in vivo stability of the mutant enzymes and enhanced the mutant enzyme activity.
- the original theory behind this strategy is as follows: since the mutant enzyme protein folds improperly in the ER (Ishii et al., Biochem.
- the ASSCs enhance ER secretion and activity of recombinant wild-type enzymes.
- An ASSC facilitates folding of overexpressed wild-type enzyme, which is otherwise retarded in the ER quality control system because overexpression and over production of the enzyme exceeds the capacity of the ER and leads to protein aggregation and degradation.
- a compound that induces a stable molecular conformation of an enzyme during folding serves as a "chaperone" to stabilize the enzyme in a proper conformation for exit from the ER.
- a compound that induces a stable molecular conformation of an enzyme during folding serves as a "chaperone" to stabilize the enzyme in a proper conformation for exit from the ER.
- a compound that induces a stable molecular conformation of an enzyme during folding serves as a "chaperone" to stabilize the enzyme in a proper conformation for exit from the ER.
- one such compound unexpectedly turned out to be a competitive inhibitor of the enzyme.
- biosensors described herein may be useful to identify chaperones that rescue the expression and/or proper maturation of proteins, and in turn which may be useful for the treatment of diseases associated with defects in the expression and/or proper maturation of one or more proteins, as described above.
- the present invention provides a method for determining whether an agent acts as a pharmacological chaperone for a receptor of interest, said method comprising: providing a biosensor comprising: a cell comprising: said receptor of interest tagged with a Renilla GFP or a Renilla Luc, preferably a Renilla Luc; and a plasma membrane (PM) targeting moiety tagged with Renilla GFP or a Renilla Luc, preferably a Renilla GFP; wherein if said receptor is tagged with said a Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said receptor is tagged with said Renilla Luc, said PM targeting moiety is tagged with said a Renilla GFP; and
- the present invention provides a method for determining whether an agent acts as a pharmacological chaperone for a protein of interest, said method comprising: providing a biosensor comprising: a cell comprising: said protein of interest tagged with a Renilla GFP or a Renilla Luc; and an endoplasmic reticulum (ER) targeting moiety tagged with a rGFP or a Renilla Luc; wherein if said protein is tagged with said Renilla GFP, said ER targeting moiety is tagged with said Renilla Luc, and if said protein is tagged with said Renilla Luc, said ER targeting moiety is tagged with said Renilla GFP; and
- the above-mentioned method may be performed using a native protein/receptor, or a mutated receptor, as shown in the experiments described herein.
- the experiments described herein further shows that the biosensors are suitable to measure rescue of a GPCR as well as of a non-GPCR receptor (a voltage-dependent potassium channel), providing evidence that they may be used to monitor the rescue of any protein or receptor.
- the protein is a native GPCR or a mutated GPCR.
- the GPCR is a native melanocortin-4 receptor (MC4R) or a mutated MC4R.
- the mutated MC4R contains one or more mutations that result in reduced or improper intracellular folding of the MC4R polypeptide.
- Exemplary mutations are as follows: P78L, R165Q, R165W, I125K, C271 Y, A175T, 1316L, 1316S, 1317T, N97D, G98R, N62S, C271 R, S58C, N62S, N97D, Y157S, I102S, L106P, L250Q, Y287X, P299H, S58C, CTCT at codon 21 1 , and TGAT insertion at codon 244.
- the GPCR is a native V2R or a mutated V2R.
- the mutated V2R comprises a Y128S or W164S substitution.
- the protein is an ion channel, a native ion channel or a mutated ion channel, in a further embodiment a voltage-gated potassium channel, such as hERG.
- the above method for determining whether an agent acts as a pharmacological chaperone further comprises determining whether the rescued protein/receptor is functional, e.g., using a ligand.
- the present invention provides a method for determining whether an agent induces the recruitment of a ⁇ -arrestin at the plasma membrane (PM), said method comprising: providing a biosensor comprising a cell or membrane preparation comprising: said ⁇ - arrestin tagged with a Renilla GFP or a Renilla Luc), preferably a Renilla Luc; a plasma membrane (PM) targeting moiety tagged with a Renilla GFP or a Renilla Luc, preferably a Renilla GFP; and a GPCR; wherein if said ⁇ -arrestin is tagged with said Renilla GFP, said PM targeting moiety is tagged with said Renilla Luc, and if said ⁇ -arrestin is tagged with said Renilla Luc, said PM targeting moiety is tagged with said Renilla GFP; and
- the above-mentioned methods comprise contacting the biosensor with a substrate for a
- Renilla Luc such as a luciferin
- luciferins include D-luciferin, imidazopyrazinone-based compounds such as coelenterazine (coelenterazine 400A (DeepBlueCTM), coelenterazine H and analogues of e-Coelenterazine such as Prolume PurpleTM from NanolightTM), ViviRenTM (from Promega), Latia luciferin ((£)-2-methyl-4-(2,6,6-trimethyl-1 -cyclohex-1 -yl)-1 -buten-1 -ol formate), bacterial luciferin, Dinoflagellate luciferin, etc.
- the substrate is coelenterazine 400A, coelenterazine H or Prolume PurpleTM.
- agent is used to refer to any molecule, for example, protein, oligopeptide, small organic molecule, polysaccharide, polynucleotide, and the like, to be tested for bioactivity.
- agents can be obtained from any number of sources including libraries of synthetic or natural compounds. For example, numerous means are available for random and directed synthesis of a wide variety of organic compounds and biomolecules, including expression of randomized oligonucleotides.
- libraries of natural compounds in the form of bacterial, fungal, plant and animal extracts are available or readily produced.
- natural or synthetically produced libraries and compounds are readily modified through conventional chemical, physical and biochemical means.
- Positive controls and negative controls may be used in the methods/assays. Control and test samples may be performed multiple times to obtain statistically significant results.
- the above-mentioned methods are high-throughput methods (high- throughput screening, HTS).
- HTS high-throughput screening
- HTS high-throughput screening
- Such HTS methods are typically performed in microtiter plates having several wells, for example 384, 1536, or 3456 wells.
- HTS it is important that the readout signal be detected with high sensitivity, accuracy and reproducibility.
- Angiotensin II (Angll; [Asp-Arg-Val-Tyr-lle-His-Pro-Phe], SEQ ID NO:), poly- ornithine, poly-D-lysine, isoproterenol, arginine-vasopressin (AVP), bradykinin, were from Sigma®.
- Prostaglandin F2a (PGF2a), Prostaglandin E2 and u46619 were from Cayman Chemical® (Ann Arbor, Ml).
- Dulbecco's modified Eagles medium DMEM
- fetal bovine serum OPT I -MEM®
- other cell culture reagents were purchased from Invitrogen®.
- Coelenterazine 400a, Coelenterazine H and Prolume Purplel were purchased from either Goldbio®, Biotium or Nanolight® Technology.
- Phusion DNA polymerase was from Thermo Scientific®. Restriction enzymes and T4 DNA ligase were obtained from NEB®.
- the coding sequence of the first 1 1 residues (MGCIKSKGKDS, SEQ ID NO: 1 ) of the human Lyn-kinase and the full coding region of GFP10 were synthesized at GeneScript® (Piscataway, NJ) and subcloned into pcDNA 3.1/zeo (-) using infusion (Clontech®, CA).
- the lyn-rGFP was generated by replacing the coding sequence of GFP10 in the lyn-GFP10 construct by the humanized rGFP, which was generated by PCR amplification.
- Streptagll-fused GFP10 was synthesized at GenScript® and subcloned into pcDNA3.1/zeo(-) (STII-GFP10).
- the FYVE domain of the human endofin (amino acids 739-806), was synthesized at Bio Basic® Inc. (Ontario, Canada) and subcloned into the STII- GFP10 construct in-frame (GFP10-endofinFYVE).
- rGFP-endofinFYVE was generated by inserting the FYVE domain of GFP10-endofinFYVE into a vector containing humanized rGFP in pcDNA3.1 (+) in-frame.
- rGFP-rab4 and rGFP-rab1 1 were generated by replacing the FYVE domain in rGFP-endofinFYVE with PCR amplified rab4 and rab1 1 coding sequences, respectively.
- the human AT1 R coding sequences containing a signal peptide and Flag sequence were PCR amplified and subcloned into in frame in pcDNA3.1/hygro(+) also containing the Rlucll via Nhel and Hindi 11 sites. Plasmids encoding human parr2-Rlucll has been previously described (Quoyer, Janz et al. 2013). Rlucll-tagged receptors were obtained by PCR using published constructs of MC4R- Venus constructs (P.
- Rene et al. J Pharmacol Exp Ther. 2010 Dec;335(3):520-32) and hV2R wt (Morello, J. P., et al., J Clin Invest, 2000. 105(7): p. 887-95).
- Rlucll-tagged receptors were obtained by PCR using plasmids encoding hERG, a generous gift from D. Deblois (Universite de Montreal, Montreal, Canada).
- Renilla reniformis GFP (rGFP) constructs were obtained by PCR from the synthetized coding sequence (from GenScript, USA).
- PH domain tagged Rlucll and rGFP PH domain of PLC51 was PCR amplified using PLC51 image clone (IMAGE:5769665) as a template. The PCR product was used to replace endofinFYVE domain in GFP10-endofinFYVE by subcloning into Xbal and Hindlll sites.
- the PH domain of GFP10-PH(PLC5) was inserted either into a vector containing humanized rGFP in pcDNA3.1 (+) or a vector containing HA-Rlucll in pcDNA3.1 (+) in-frame (rGFP-PH(PLC51 ) and HA-RLucll- PH(PLC51 ), respectively).
- hMC4R-Rlucll Plasmids encoding the fusion protein hMC4Rwt-Rlucll, hMC4R (R165Q)-Rlucll and hMC4R-(P299H)-Rlucll were obtained by PCR amplification of MC4R from MC4R-venus constructs and, subcloned in frame at the N-terminus to the humanized Renilla luciferase II (hfilucll) sequence (a variant of the hfiluc previously reported (Leduc, Breton et al. 2009)) into pcDNA3.1 Rlucll vector (linker sequence: VGGGGSKLPAT, SEQ ID NO:2).
- hV2R-Rlucll The V2R substitution Y128S was created using the site-directed mutagenesis with the Quick ChangeTM mutation kit (Agilent Technologies, Santa-Clara, USA). Plasmids encoding the fusion protein hV2R wt-Rlucll and hV2R (Y128S)-Rlucll were obtained by PCR amplification of V2R coding sequence, subcloned in frame at the N-terminus to the hfflucll sequence into pcDNA3.1 Rlucll vector (linker sequence: GGSGLKLPAT, SEQ ID NO:3).
- hERG-Rlucll Plasmids encoding the fusion protein hERG wt-Rlucll and hERG (G601S)-Rlucll were obtained by PCR amplification of 3 fragments encoding: residues 1 -379 of hERG, 373-1 159 of hERG and the Rlucll, and subcloned by Gibson Assembly (New England Biolabs) pcDNA3.1 (+) vector (linker at the N- terminal of Rlucll: NAAIRSGG, SEQ ID NO:4 and at the C-terminal of Rlucll: GGNAAIRS, SEQ ID NO:5).
- rGFP-CAAX Plasmid encoding the fusion protein rGFP-CAAX was obtained by PCR amplification of rGFP coding sequence with a reverse primer encoding a linker (sequence: GSAGTMASNNTASG, SEQ ID NO:6) and the plasma-membrane targeting polybasic sequence and prenylation signal sequence from KRAS splice variant b: -GKKKKKKSKTKCVIM (named: CAAX, SEQ ID NO:7).
- the CAAX plasma-membrane targeting sequence is in frame at the C- terminus of the rGFP coding sequence.
- the PCR fragment is sub-cloned into pcDNA3.1 (+) vector.
- rGFP-PB Plasmids encoding the fusion protein rGFP-PB was obtained by replacing the CAAX motif of rGFP-CAAX by the GRK5-plasma membrane targeting domain (PB; sequence: SPKKGLLQRLFKRQHQNNSKS, SEQ ID NO:8) using PCR amplification and Gibson assembly.
- the complete vector pCDNA 3.1 (+) rGFP-CAAX is amplified by PCR using oligos encoding PB.
- the PCR reaction product is digested with Dpnl, purified and recircularized in a Gibson assembly reaction.
- Rlucll-GRB2 The coding sequence of human GRB2 variantl was PCR- amplified and subcloned at the C-terminus of Rlucll in the vector pCDNA3.1 (+) Rlucll with a small flexible linker (sequence: GSAGT, SEQ ID NO:9) between GRB2 and Rlucll. All the PCR were done by using the Phusion® DNA polymerase. All constructs were verified by DNA sequencing prior to use. Cell culture and Transient Transfection.
- HEK293 Human embryonic kidney 293 (HEK293) cells were maintained in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum, 100 unit/ml penicillin/streptomycin at 37 °C in a humidified atmosphere with 5% C0 2 .
- HEK293SL cells were cultured in DMEM supplemented with 5% fetal bovine serum and 20 ⁇ g/ml gentamycin. Cells were grown at 37 °C in 5% C0 2 and 90% humidity.
- DMEM Dulbecco's Modified Eagle's Medium
- HEK293SL cells were transfected using a calcium phosphate method (Fessart, Simaan et al. 2005). Cells were seeded at a density of -7.5x10 5 per 100 mm dishes a day before transfection and transfection was carried out as described previously (Fessart, Simaan et al. 2005). After 18 h of transfection, the medium was replaced, and the cells were divided for subsequent experiments. All assays were performed 48 h after transfection.
- PEI Poly(ethylenimine)
- HEK293 cells from a 6-well plate were washed with Phosphate Buffered Saline (PBS) and transfected with 1 .2 ug of rGFP-CAAX encoding construct/well using poly-ethylenimine 25-kDa linear (PEI) as a transfecting agent (at a ratio of 3 to 1 , PEI/DNA) (Hamdan, Rochdi et al. 2007).
- PBS Phosphate Buffered Saline
- PEI poly-ethylenimine 25-kDa linear
- the rGFP-CAAX construct also encodes for the hygromycin resistance, and transfected cells were seeded in T75 dishes and selection (hygromycin at 100 ⁇ g/ml) was maintained for 4 weeks and hygromycin-resistant cells were FACS-sorted against GFP fluorescence, in populations expressing different levels of rGFP-CAAX.
- Measurements were performed by using Synergy2 (BioTek®) microplate reader with a filter set of 410 ⁇ 80 nm and 515 ⁇ 30 nm for detecting the Rlucll Renilla luciferase (donor) and GFP10 or rGFP (acceptor) light emissions, respectively.
- the BRET signal was determined by calculating the ratio of the light intensity emitted by the GFP10 or rGFP over the light intensity emitted by the Rlucll. All the BRET measurements were performed in triplicate at 37 °C.
- Transfected cells seeded in 96-well plates were treated with a pharmalogical chaperone (for MC4R: DCPMP(N-((2R)-3(2,4-dichloroPhenyl)-1 -(4-(2-((1 - methoxypropan-2-ylamino)methyl)phenyl) piperazin-1 -yl)-1 -oxopropan-2-yl)propionamide) or Compound 1 ; for V2R: SR121463; for hERG: Astemizole, Cisapride, Quinidine, Ditiazem, Amiodarone and Acetaminophen) or vehicle for 16h-18h, as indicated in each figure, prior to the BRET assay performed 2-day post-transfection.
- a pharmalogical chaperone for MC4R: DCPMP(N-((2R)-3(2,4-dichloroPhenyl)-1 -(4-(2-((1 - me
- BRET values were then collected using a Mithras LB940 Multimode Microplate Reader, equipped with the following filters for BRET2: 400nm ⁇ 70nm (energy donor) and 515nm ⁇ 20nm (energy acceptor) and for BRET1 : 480nm ⁇ 20nm (energy donor) and 530nm ⁇ 20nm (energy acceptor). BRET values were determined by calculating the ratio of the light emitted by the acceptor over the light emitted by the Rlucll.
- a transfection mix of 200ng of p2AR, 20 ng ⁇ - arrestin2-Rlucll, 800 ng rGFP-CAAX, complemented to 2 ⁇ g with ssDNA and PEI at a ratio of PEI :DNA of 3:1 is added to 3 ml of Hek293SL (350,000 cells/ml).
- Cells were seeded on poly-D- lysine pretreated plates.
- 48 h post-transfection cells were washed and preincubated in Tyrode + 1 mM CaCI 2 at 37°C for 60 min then treated with the indicated doses of Isoproterenol for 2min at 37°C.
- Coel-400a was then added at a final concentration of 2.5 ⁇ and incubated for an additional 6 min.
- BRET was measured at 37°C, using a Tristar Microplate Reader (Berthold Technologies).
- HEK293 cells were transfected with PEI, as decribed previously with 3ng of parrestin2-Rlucll ( Figures 19C & 19E) + 4.8ng of rGFP-CAAX (Kras) + 10ng V2R ( Figure 191) or 40 ng p2AR ( Figures 19H) per well of a 96-well plate.
- HEk293SL cells were transfected with AT1 R (600 ng) and parrestin2-Rlucll (90 ng) along with either Lyn-rGFP (480 ng), rGFP-CAAX (480 ng), or GFP10-CAAX (480 ng) in 100 mm dishes. Next day, the cells were replated onto 96-well plates. 48h post-transfection, the cells were stimulated various concentrations of Angll for 6 min before BRET measurements. Coelenterazine 400a (final concentration of 5 ⁇ ) was added after 2 min of Angll stimulation. BRET was measured at room temperature, using a Synergy2 (BioTek ® ) microplate reader. Z'-factor values were calculated as described by Zhang et al. (Zhang, Chung et al. 1999).
- Coelenterazine 400a (coel-400a) (Biotium) was added at a final concentration of 2.5 ⁇ and, incubated for an additional 5 min. BRET ratios were measured at 37°C, using Mithras LB940 Multimode Microplate Reader (Berthold Technologies).
- 1 x transfection 400 ng sphATI R, 200 ng of P2AR unimolecular sensor with a 200 residues-long linker, complemented to 4 ⁇ g with ssDNA and PEI at a ratio of PEhDNA of 3:1 , was added to 7ml ml of HEK293SL. Cells were seeded on poly-D-lysine pretreated plates.
- HEK293SL cells stably expressing hAtl AR (-50 fmol/mg) were cultured in DMEM supplemented with 10% FBS and 20 ⁇ / ⁇ gentamycin and seeded at a density of 75,000 cells/100mm dishes and were transiently transfected the next day with 150ng of construct encoding for the DAG unimolecular sensor, using calcium phosphate method as described previously. 48h post-transfection, cells were washed and Coel-400a was added to a final concentration of 5 ⁇ and incubated 3min.
- HEK293 cells were transfected using PEI, as already described, with 100ng of Rlucll-C1 b, 500ng of rGFP- CAAX (Kras) and 100ng of either human histamine type 1 (H1 R, Gq-coupled receptor, human Bradykinin type 2 (BKRB2, Gq-coupled receptor), human dopamine type 2 (D2R, Gi-coupled receptor used as negative control) receptors and complemented to ⁇ g with ssDNA. 48h post- transfection, cells were washed and incubated for 1 h at RT in Tyrode's buffer.
- Coelenterazine 400a was then added at a final concentration of 2.5 ⁇ and incubated for 6 min. Cells were then treated with the indicated doses of Isoproterenol, for 1 min. BRET was measured at 37°C, using a Tristar Microplate Reader (Berthold Technologies).
- PKN-based RhoA activation assay HEK293SL cells were grown in DMEM supplemented with 6% fetal bovine serum (FBS) and 20 ⁇ g/ml gentamycin, at 37 °C. Cells were seeded at a density of 7.5x10 5 cells per 100 mm dishes and were transiently transfected the next day with constructs encoding AT1 R (3 ⁇ ) along with PKN-crib-Rlucll (90ng) and rGFP-CAAX (480ng) using calcium phosphate method as described previously.
- FBS fetal bovine serum
- rGFP-CAAX 480ng
- Filter set was 410 ⁇ 80nm and 515 ⁇ 30nm for detecting the Rlucll Renilla luciferase (donor) and rGFP (acceptor) light emission.
- a transfection mix of 200ng of TPaR, 20ng PKN-Rlucll, 600ng CAAX-rGFP, complemented to 2 ⁇ g with ssDNA and PEI at a ratio of PEhDNA of 3:1 is added to 3ml of Hek293SL (350 OOOcells/ml). Cells were seeded on poly-D-lysine pretreated plates.
- a transfection mix of 200ng of TPaR, 20ng PKN-Rlucll, 600ng CAAX-rGFP, complemented to 2 ⁇ g with ssDNA and PEI at a ratio of PEhDNA of 3:1 is added to 3ml of Hek293SL (350,000 cells/ml). Cells were seeded on poly-D-lysine pretreated plates. 24h post-transfection, the Rho inhibitor (CT04; Cytoskeleton, Inc) was added when indicated, overnight at final concentration 2 ⁇ g/ml.
- CT04 Cytoskeleton, Inc
- Intact cell [ 125 l]-Angll binding [ 125 l]-Angll binding.
- [ 125 l]-Angll was prepared with the lodogen method, and its specific radioactivity was determined from self-displacement and saturation experiments as previously described (Zimmerman, Beautrait et al. 2012) The density of cell surface receptors was evaluated with binding assays at 4 °C using [ 125 l]-Angll as tracer.
- HEK293SL cells expressing either AT1 R or AT1 R-Rlucll were seeded 1 day after transfection at a density of -120,000 cells per well in poly-ornithine coated 24-well plates.
- DMEM-H pre- warmed DMEM with 20 mM HEPES
- DMEM-H pre- warmed DMEM with 20 mM HEPES
- the plates were quickly washed three times with ice-cold acid (50 mM sodium citrate, pH 4.0) for 5 min each on ice to stop the stimulation and remove both the remaining surface bound and unbound Angll ligand.
- ice-cold acid 50 mM sodium citrate, pH 4.0
- the cells were treated same as above except incubation without radiolabeled Angll, and then after washing, add 2 ml of diluted Protein assay reagent instead of NaOH/SDS. After mixing by pipetting, the samples were transferred to plastic cuvettes and measured absorbance at 595 nm.
- HEK293SL cells were seeded in 35 mm glass-bottom dishes at a density of 100,000 cells/dish.
- Cells were transfected with B2R-CFP, LYN-rGFP and mCherry-endofinFYVE. Forty-eight hours post-transfection, cells were serum starved for 30 min, either left untreated (non treated) or treated with bradykinin (1 ⁇ ) for 15 min. Samples were analyzed on a Zeiss LSM-510 Meta laser scanning microscope using argon (514 nm) and HeNe I (543 nm) lasers, and images (2048x2048 pixels) were collected using a 63x oil immersion lens.
- UV and argon lasers were used with 405 nm and 514 nm excitation, and either BP 420-480 nm or BP 505-550 nm emission filters, respectively.
- a HeNe I laser was used with 543 nm excitation and LP 560 nm emission filter sets.
- HEK293S cells were cultured in DMEM supplemented with 10% FBS, 100 units/ml penicillin and 0.1 mg/ml streptomycin and plated on poly-D-lysine coated glass-bottom 35 mm culture dishes at the density of 1 -2x10 5 cells/dish.
- cells were transfected with Rlucll-fused (BRET donor) and rGFP-fused (BRET acceptor) constructs using X- treme GENE HP reagent (Roche) using 1 ⁇ g DNA and 3 ⁇ reagent per dish according to the manufacturer protocol.
- FIGS 26A and 26B (luminescence spectrum measurement) cells were transfected with 100 g/dish of RLucll N-terminally fused to Venus, GFP2 or rGFP. Cells are detached from the culture surface by adding 1 ml of PBS supplemented with 5 mM EDTA, and re- suspended to PBS. As a luciferase substrate, 1 ⁇ of Prolume purple (Nanolight Technology) was added and the luminescence spectrum was obtained with Synergy Neo plate reader (BioTek) 2min after the addition of the substrate.
- BRET images were obtained using Nikon® Ti-U microscope equipped with 60x objective (Apochromat TIRF, NA 1 .49, Nikon) and imaging camera (PIXIS1024, Princeton instruments) with filter changer (Lambda 10-2, Sutter instrument). Immediately after the addition of coelenterazine, camera shutter was closed and a blank image was acquired for 90sec. Then images were acquired with filters corresponding to BRET donor (410/80nm) and BRET acceptor (480LP or 510/40 nm) wavelength for 90 sec each. Images were captured every 5 min, and blank image values were subtracted from the corresponding pixels of BRET donor and acceptor images in order to remove photon counts deriving from dark current and sampling noises of the camera.
- BRET ratio images were generated using pixel arithmetic functions of MetaMorph software version 7.8 (Molecular Devices) as follows; Pixel hue : BRET level calculated by dividing the counts of acceptor images with donor images, and allocated to default rainbow hue (lowest (typically 0.0) in purple and highest (typically 2.0) in red). Pixel brightness: the value of donor images with auto brightness.
- BRET1 and BRET2 assays were performed on cells cotransfected with rGFP-CAAX construct and either the hMC4R wt-Rlucll or hMC4R (R165Q)- Rlucll construct (as indicated in Figures 15A to 15D), with half of the 96-well plate treated with the pharmacological chaperone (10uM DCPMP) and the second half of the plate treated with the corresponding vehicle (DMSO).
- Z'-factor values were calculated as described by Zhang et al. (Zhang, Chung et al. 1999). A Z'-factor over 0.4 is considered a robust assay.
- rGFP Renilla reniformis green fluorescent protein
- hMC4R WT human wild-type Melanocortin 4 receptor
- hV2R (Y128S): mutant Y128S-hV2R, intracellularly retained and PC-rescuable
- hERG WT human wild type voltage-gated Potassium channel H2
- hERG (G601 S): mutant G601 S-hERG, intracellularly retained and PC-rescuable
- Lyn palmitoylation & myristoylation signal sequence from the Lyn kinase
- CAAX-Kras plasma-membrane targeting polvbasic sequence and prenylation signal sequence from kRas splice variant b
- PB plasma-membrane targeting polvbasic sequence from the human GRK5
- hGRB2 v1 human GRB2 variant 1
- Linkerl Linker sequence between the hMC4R and Rlucll
- VGGGGSKLPAT SEQ ID NO:2
- Linker2 Linker sequence between the hV2R and Rlucll
- Linker3 Linker sequence in N-terminal of Rlucll, following residue 379 of hERG
- Linker4 Linker sequence in N-terminal of Rlucll, preceding residue 373 of hERG
- Linker5 Linker between Lvn's plasma-membrane targeting sequence (Lyn) and rGFP
- Linker6 Linker between rGFP and polvbasic/prenylation sequence from kRAS (CAAX)
- GSAGTMASNNTASG (SEQ ID NO:28)
- Linker7 Linker between rGFP and polybasic sequence from GRK5 (PB):
- Linker9 Linker between Golqi targeting sequence from eNOS (1 -73) and rGFP GSNAT (SEQ ID NO:41 )
- Linkerl O between (i) rGFP and (ii) endofin's FYVE domain, Rab4 or Rab1 1
- Linkerl 1 between spFlaq-AT1 R and Rlucll
- Linkerl 2 between Rlucll and PH domain of PLC51
- GNASGTGSGGSGSGGLEM (SEQ ID NO:31 )
- Linkerl 3 between rGFP and PH domain of PLC51
- Linkerl 4 between HA tag and Rlucll
- hV2R (W164S): mutant W164S-hV2R. intracellularlv retained and PC-rescuable
- CAAX plasma-membrane tarqettinq palmitoylation sequence and prenylation signal sequence from hRas
- CAAX plasma-membrane tarqettinq palmitoylation sequence from hRas and prenylation signal sequence from Rail
- VQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSL GPVELLLRGSSRRLDLLHQQLQE SEQ I D NO:70
- TPA Human Thromboxane A2 receptor isoform a
- H1 R Human histamine type 1 receptor
- BKRB2 human Bradykinin type 2 receptor
- New BRET acceptors based on Renilla reniformis GFP were generated for assessing receptor internalization and their targeting with ⁇ -arrestins to endosomes. These BRET acceptors were engineered for their specific expression either at the plasma membrane or in the endosomes, and for being used with the RET donors: RLucll-tagged GPCRs and ⁇ -arrestins ( Figures 1 A-C).
- the BRET assay disclosed herein is based on changes in the local concentration of the donor relative to the acceptor rather than a specific protein-protein interaction; hence not limited by the requirement for protein interaction and the avidity of one's complex. For its plasma membrane localization, rGFP was first tagged with a lyn domain.
- B2R-CFP Upon agonist stimulation, B2R-CFP separated from the lyn-rGFP, and moved into the endosomes where it colocalized with the mCherry-endofinFYVE (bottom panel). Only the receptor redistributed from one cellular compartment to another upon agonist, as both the plasma membrane and endosomal markers (i.e. lyn-rGFP and GFP-endofinFYVE, respectively) remained in their respective compartments, making this system suitable to dynamically track receptor trafficking using BRET.
- Example 3 Assessing AT1 R internalization and its trafficking to endosomes with ⁇ -arrestin BRET experiments were performed to monitor receptor endocytosis.
- the Rlucll was fused onto the C-terminal domain of the angiotensin type 1 receptor (AT1 R-Rlucll), another GPCR, which traffic with ⁇ -arrestin through the clathrin pathway and is targeted to endosomes (Hein, Whyl et al. 1997; Zhang, Barak et al. 1999; Anborgh, Seachrist et al. 2000; Oakley, Laporte et al. 2000; Gaborik, Szaszak et al. 2001 ).
- AT1 R-Rlucll angiotensin type 1 receptor
- the signal rapidly decreased in a concentration-dependent manner following challenge of live cells with Angll and the removal of receptor from the plasma membrane.
- Expressing lyn-GFP10 generated both a lower basal and Angll-induced BRET ratio changes.
- expressing AT1 R-Rlucll with rGFP-endofinFYVE rather than GFP10-endofinFYVE resulted in a 7.7-fold increase in Angll- mediated BRET changes (ABRET) ( Figure 2B).
- Dynamin K44A (DynK44A), a dominant negative of Dynamin, which is key for clathrin-coated pit invagination, and sucrose have both been used as endocytosis blockers (Zhang, Ferguson et al. 1996).
- Angll-mediated BRET responses at the plasma membrane and in the endosomes were efficiently inhibited by the expression of DynK44A ( Figures 3A and B).
- V2R-Rlucll vasopressin V2 receptor-Rlucll
- AVP-dose dependently decreased the BRET ratio response.
- Angll-stimulated AT1 R AVP promoted the internalization of V2R with an EC 50 in the nM range (1 .1 nM and 7.8 nM, respectively) ( Figure 4A).
- B2R- Rlucll and p2-adrenergic receptor (P2AR)-Rlucll also respectively showed dose-dependent decrease in the BRET ratio by their cognate ligands, bradykinin and isoproterenol. However, we observed differences in the basal BRET ratio between receptors. When receptor trafficking into the endosome was vetted, B2R-Rlucll and p2AR-Rlucll also showed different potencies in agonist- mediated increasing in BRET ratio (Figure 4B). Notably, V2R-Rlucll and rGFPendofinFYVE showed high basal BRET ratio (Figure 4B), as compared to B2R and the other receptors, though we could still detect robust increased in the BRET ratio upon AVP stimulation.
- FIG 4D shows the plasma membrane and endosome BRET sensors may also be used to study the endocytosis and trafficking of other types of receptors (i.e., non-GPCRs), such as the epidermal growth factor receptor (EGFR), a receptor tyrosine kinase (RTK).
- EGFR epidermal growth factor receptor
- RTK receptor tyrosine kinase
- Figure 4E shows that the Z' factor of over 0.73 for the AT1 R-RLucll/rGFP-endofinFYVE biosensors following Angll stimulation, which indicates a robust and HTS compliant assay for receptor internalization in endosomes.
- Example 5 Studying receptor recycling using BRET
- FIGS 26A to 26C show that the changes in BRET signal resulting from parrestin translocation/recruitment to different compartments may be measured by BRET microscopy, and that the use of rGFP as the BRET acceptor results in a stronger BRET signal as compared to other BRET acceptors such as Venus and GFP2.
- BRET-based microscopy imaging opens up the possibility of image-based multiplexing for monitoring the translocation of an Rluc-tagged protein to distinct subcellular compartments in response to diverse stimuli.
- Example 6 Differential sorting of AT1 R by angiotensin analogs
- the ligand-mediated receptor endocytosis was next examined using different AT1 R ligands: Angll, SI, and DVG, which were previously shown to have distinct biased signalling properties (Zimmerman, Beautrait et al. 2012). Their ability to temporally regulate the trafficking of AT1 R-Rlucll to endosomes was first evaluated using rGFP-endofinFYVE. Results revealed that the initial rates of AT1 R trafficking to endosomes were similar upon ligand incubation (e.g. 0-5 min; Figure 6A).
- Rabs coordinate vesicle transport between a number of intracellular compartments and have been used to identify the pathways followed by GPCR trafficking (Seachrist and Ferguson 2003).
- Rab5 is found on both endocytosed and recycling vesicles of the short cycle, while rab4 is on recycling vesicles of short and long cycles, and rabl 1 on recycling vesicles of the long cycle and vesicles directed to lysosomes (Seachrist and Ferguson 2003).
- rGFP-tagged Rab4 (rGFP-rab4) and rab1 1 (rGFP-Rab1 1 ) were generated, since the rGFP-endofinFYVE labelled endosomes are mainly Rab5-positive.
- Both rGFP-rab4 and rGFP-rab1 1 showed good vesicular localizations when expressed in HEK293 cells ( Figure 9A).
- rGFP-rab4 and rGFP-rab1 1 showed good vesicular localizations when expressed in HEK293 cells (Figure 9A).
- SI and DVG stimulation generated a significantly higher BRET signal than Angll (5 and 10 min, Figure 6E).
- Example 7 BRET-based pharmacological chaperone (PC) assay and sequestration assay to assess functional rescue
- an assay was developed based on plasma density of an Rlucll-tagged protein (in Figure 10A, a receptor) as detected in BRET between the Rlucll-tagged protein and an energy acceptor (rGFP) located at the plasma-membrane by a subcellular localization tag.
- Rlucll-tagged protein in Figure 10A, a receptor
- rGFP energy acceptor
- FIG 10A examples of tags used for rGFP localization: the polybasic sequence and prenylation signal sequence from KRAS splice variant b (CAAX), the palmitoylation and myristoylation signal sequence from the Lyn kinase (Lyn) and plasma- membrane targeting polybasic sequence from the human GRK5 (PB).
- FIG. 10A A schematic representation of an assay for evaluation of cell surface expression PC-rescue of otherwise ER-retained proteins tagged with Rlucl l is presented and described in Figure 10A.
- a BRET-based assay to evaluate cell surface expression can also be used to evaluate agonist-induced sequestration of receptors as depicted and described in Figure 10B. Most of GPCRs and other receptors internalize or are sequestered to sub-domains of the plasma-membrane upon agonist stimulation.
- a sequestration assay post PC-rescue of cell surface expression of receptors can be used to evaluate receptor activation, which reflects agonist binding and thus functionality.
- Figure 11 The different constructs used in this study are described in Figure 11 ; Figure 11 A: description of MC4R-Rlucll ; Figure 11 B: description of V2R-Rlucll, Figure 11 C: description of a voltage-gated Potassium channel (hERG) that was used as an example of a non-GPCR.
- Figure 11 D Three different rGFP constructs with distinct plasma-membrane targeting sequences were tested as described in Figure 11 D.
- the rGFP-CAAX and MC4R-Rlucll constructs were used to illustrate the robustness of the assay, resistance to DMSO and functional rescue, as evaluated by using a MC4R agonist (a-MSH) to induce agonist-promoted sequestration.
- a-MSH MC4R agonist
- rGFP- CAAX lipidation
- rGFP-PB polybasic domain
- MC4R For optimization and validation of PC-mediated rescue of the cell surface expression and functionality of MC4R, cells transiently expressing rGFP-CAAX and 3 forms of the hMC4R, the wt receptor (hMC4R wt-Rlucll), a PC rescuable mutant MC4R (hMC4R-R165Q-rlucll) and a mutant MC4R known as resistant to DCPMP-treatment (non PC-rescuable), were tested for cell surface expression following PC treatment and a 1 h-agonist treatment to induce agonist-mediated sequestration. Three different ratios receptor to rGFP-CAAX were tested.
- Polycistronic constructs encoding rGFP-CAAX(Kras) and either a WT or mutant hMC4R was used to show the PC rescue of cell surface expression.
- Polycistronic constructs offer the advantage of a fixed ratio of donor to acceptor and the possibility of using only one construct for viral infection or for establishing stable cell lines.
- Figure 13E shows the PC-mediated rescue of V2R mutants known to be intracellularly retained (Y128S and W164S) by the chaperone SR121463.
- Z'-factors were determined for the PC-mediated rescue of MC4R cell surface expression, to evaluate the robustness of the developed BRET-based assay.
- Z' factors were obtained for both hMC4R wt-Rlucll ( Figures 15A and 15B) and hMC4R (R165Q)-Rlucll ( Figures 15C and 15D).
- Cell surface expression was evaluated in BRET2 in Figures 15A and 15C using coelenterazine 400a, and in BRET1 using coelenterazine H ( Figures 15B and 15D) following a 16h-treatment with 10 ⁇ DCPMP vs. vehicle.
- Example 9 Evaluation of resistance to DMSO.
- hMC4R wt- Rlucll and hMC4R (R165Q)-Rlucll expressing cells were DCPMP-treated at 10uM or with vehicle (DMSO) in well containing different concentrations of DMSO.
- this assay is resistant to at least 3% DMSO, which is compatible with high throughput screening (HTS) applications and characterization of compounds in dose-response curves.
- Example 10 Generation of stable cell lines.
- Cells stably expressing biosensors are usually preferred for screening purposes.
- PC- mediated rescue of MC4R and V2R expression was then evaluated in cells transiently expressing rGFP-CAAX and in stable rGFP-CAAX cell lines, in order to determine if the level of rGFP-CAAX reached in stable cell lines is compatible with a robust assay for screening applications.
- Example 12 Biosensors to monitor ⁇ -arrestin recruitment to GPCRs.
- ⁇ -arrestin ⁇ -arr recruitment to GPCRs (i.e. to the plasma membrane where GPCRs are localized) using a BRET biosensor that rely on changes in the concentration/density of the donor relative to the acceptor at the plasma membrane.
- a BRET acceptor ⁇ e.g., GFP
- PM targeting moiety thus tethering the BRET acceptor at the PM
- a ⁇ -arrestin is tagged with a BRET donor ⁇ e.g., Rlucll).
- ⁇ -arr In the presence of a GPCR agonist, ⁇ -arr is recruited to the GPCR, thus increasing the concentration of Rlucll-p-arr at the plasma membrane, which in turn results in an increase in energy transfer (BRET) between Rlucll and the PM-tagged GFP.
- BRET energy transfer
- Figures 19B and 19C show the increase in the BRET ratio for ⁇ -arrestin ! ( Figures 19B and 19D) and p-arrestin 2 ( Figures 19C and 19E) with two different GPCRs, a class A receptor that has lower affinity for ⁇ -arrestin: ⁇ 2 ⁇ ( Figures 19B and 19C) and a class B receptor that has higher affinity for ⁇ -arrestin: V 2 R ( Figures 19D and 19E), following stimulation with increasing doses of isoproterenol (iso) and AVP, respectively.
- FIG. 21 A to 21 E show the assessment of ⁇ -arrestin translocation using a unimolecular biosensor, which allows performing the experiments in membrane extracts, for example.
- a flexible polypeptide linker of 300 amino acids provided a better BRET signal relative to shorter polypeptide linkers ( Figure 21 C).
- Example 13 Biosensors to monitor PI(4,5)P 2 amount at the plasma membrane.
- the biosensor was applied to detect membrane PI(4,5)P 2 generation using PLC51 -PH domain.
- PLC51 -PH-Rlucll and PLC51 -PH-rGFP are localized at the PM where PI(4,5)P 2 is located, so their local concentration/density is high enough to generate a detectable BRET signal.
- Example 14 Biosensors to monitor diacylglycerol (DAG) at the plasma membrane
- FIGS 22A and 23A show schematic representations of biosensors for measuring the translocation of the diacylglycerol- (DAG-) binding domain of PKCdelta (C1 b) to the plasma membrane.
- the biosensors comprise a PM-targeting domain/moiety attached to a BRET acceptor (e.g., rGFP, GFP10) and a BRET donor (e.g., flLucll) linked to the DAG-binding domain of PKC5, C1 b.
- BRET acceptor e.g., rGFP, GFP10
- BRET donor e.g., flLucll
- the DAG enrichment at the membrane following PIP 2 causes the C1 b domain to bind to the membrane, bringing the BRET acceptor (e.g., rGFP) and BRET donor (e.g., RLucll) closer to each other, inducing a higher BRET signal.
- the BRET acceptor and BRET donor components are linked together (unimolecular biosensor), which allows performing the experiments in membrane extracts, for example, whereas these components are expressed separely in the biosensor depicted in Figure 23A.
- the results depicted in Figures 22B to 22H and Figures 23B to 23E show that DAG accumulation at the plasma membrane may be monitored using both biosensors.
- FIG 22F shows that direct activation of PLC using N-(3-Trifluoromethylphenyl)-2,4,6-trimethylbenzenesulfonamide (m- 3M3FBS), which induces the hydrolysis of membrane PIP 2 into IP 3 and DAG (thus increasing the amount of DAG at the membrane), led to an increase of the BRET signal detected using the unimolecular biosensor.
- m- 3M3FBS N-(3-Trifluoromethylphenyl)-2,4,6-trimethylbenzenesulfonamide
- the G protein subunits are localized at the plasma membrane.
- an agonist A
- the G protein subunits are released from the plasma membrane.
- a PM-targeting domain/moiety attached to a BRET acceptor e.g., rGFP, GFP10
- a BRET donor linked to a G protein subunit
- Figures 24B and 24C show the changes in BRET ratio following activation of pi AR and P2AR, respectively, with isoproterenol using different RLucll- tagged Gy subunits, which provides evidence that Gy1 and Gy1 1 are mainly involved in signaling of P1 AR, and Gy1 is mainly involved in signaling of P2AR.
- Figures 24D to 24H show that the sequestration/translocation of different G protein subunits to different cellular compartments following agonist stimulation of GPCRs may be monitored using the biosensors.
- a biosensor of Rho activation was designed by monitoring the recruitment of PKN's CRIB domain, which binds the active form of Rho (Rho-GTP) that localizes at the plasma membrane, to the plasma membrane using BRET.
- the BRET pair is the Rlucll-tagged CRIB domain of PKN as a BRET donor and the plasma membrane bound rGFP (rGFP-CAAX) as an acceptor (Figure 25A).
- Figures 25B to 25G show that PKN CRIB domain is translocated to the plasma membrane upon agonist stimulation of GPCRs coupled to Gq/12/13, and that the translocation is decreased in the presence of specific Gq inhibitors.
- Figures 25H to 25J show the effect of Rho modulators on the BRET ratio measured using the Rho biosensor.
- the BRET ratio is increased in the presence of Rho activators, and decreased in the presence of Rho inhibitors, confirming the specificity of the assay.
- Example 17 Identification of regulators of AT1 R by high-throughput screening using a localization/trafficking biosensor
- Figure 27C shows that compounds #10 (Traf 10) and #29 (Traf 29) identified in the screen which enhanced the targeting of B2R-YFP or parr2-YFP to endosomes, as compare to untreated, agonist-stimulated cells.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Toxicology (AREA)
- General Health & Medical Sciences (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Zoology (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15841561.2A EP3194960B1 (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
| PL15841561T PL3194960T3 (pl) | 2014-09-19 | 2015-09-21 | Bioczujniki do monitorowania lokalizacji i migracji biocząsteczek w komórkach |
| NZ730131A NZ730131A (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
| DK15841561.2T DK3194960T3 (da) | 2014-09-19 | 2015-09-21 | Biosensorer til overvågning af lokalisering og transport af biomolekyler i celler |
| ES15841561T ES2774416T3 (es) | 2014-09-19 | 2015-09-21 | Biosensores para monitorear la localización y el tráfico de biomoléculas en las células |
| CA2960902A CA2960902C (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
| US15/512,267 US10584159B2 (en) | 2014-09-19 | 2015-09-21 | Renilla based biosensors for monitoring biomolecule localization and trafficking in cells |
| SG11201702133TA SG11201702133TA (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
| AU2015318567A AU2015318567B2 (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
| CN201580062566.XA CN107533049B (zh) | 2014-09-19 | 2015-09-21 | 用于监测细胞中生物分子的定位和运输的生物传感器 |
| JP2017515812A JP6708633B2 (ja) | 2014-09-19 | 2015-09-21 | 細胞における生体分子の局在化及び輸送をモニタリングするためのバイオセンサー |
| IL251158A IL251158A0 (en) | 2014-09-19 | 2017-03-14 | Biosensors for monitoring the location and movement of biological molecules in cells |
| US16/777,504 US20200157184A1 (en) | 2014-09-19 | 2020-01-30 | Biosensors for monitoring biomolecule localization and trafficking in cells |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462052738P | 2014-09-19 | 2014-09-19 | |
| US62/052,738 | 2014-09-19 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/512,267 A-371-Of-International US10584159B2 (en) | 2014-09-19 | 2015-09-21 | Renilla based biosensors for monitoring biomolecule localization and trafficking in cells |
| US16/777,504 Continuation US20200157184A1 (en) | 2014-09-19 | 2020-01-30 | Biosensors for monitoring biomolecule localization and trafficking in cells |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016041093A1 true WO2016041093A1 (en) | 2016-03-24 |
Family
ID=55532401
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2015/050924 Ceased WO2016041093A1 (en) | 2014-09-19 | 2015-09-21 | Biosensors for monitoring biomolecule localization and trafficking in cells |
Country Status (13)
| Country | Link |
|---|---|
| US (2) | US10584159B2 (https=) |
| EP (1) | EP3194960B1 (https=) |
| JP (1) | JP6708633B2 (https=) |
| CN (1) | CN107533049B (https=) |
| AU (1) | AU2015318567B2 (https=) |
| CA (1) | CA2960902C (https=) |
| DK (1) | DK3194960T3 (https=) |
| ES (1) | ES2774416T3 (https=) |
| IL (1) | IL251158A0 (https=) |
| NZ (1) | NZ730131A (https=) |
| PL (1) | PL3194960T3 (https=) |
| SG (1) | SG11201702133TA (https=) |
| WO (1) | WO2016041093A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111164226A (zh) * | 2017-10-18 | 2020-05-15 | 蒙特利尔大学 | 评估g蛋白活化的系统和方法 |
| WO2021023813A1 (en) | 2019-08-06 | 2021-02-11 | Domain Therapeutics | 5-heteroaryl-pyridin-2-amine confounds as neuropeptide ff receptor antagonists |
| US20210395736A1 (en) * | 2018-10-29 | 2021-12-23 | The Johns Hopkins University | Rasopathy treatment |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3837545A1 (en) * | 2018-08-17 | 2021-06-23 | F. Hoffmann-La Roche AG | In vitro transcytosis assay |
| US12522647B2 (en) | 2019-01-22 | 2026-01-13 | Paul Scherrer Institut | Beta-arrestin mutants |
| CN110981943B (zh) * | 2019-12-02 | 2021-08-03 | 清华大学 | 多肽及其在制备药物中的用途和药物 |
| CA3198508A1 (en) * | 2020-11-19 | 2022-05-27 | Bradley K. MCCONNELL | Monitoring membrane protein trafficking for drug discovery and drug development |
| CN114200128B (zh) * | 2021-11-24 | 2024-09-27 | 中国科学院生物物理研究所 | 二维蛋白纳米阵列作为免疫传感元件载体的制备和应用 |
| CN114767832B (zh) * | 2022-04-21 | 2025-05-16 | 深圳辰扬生物科技有限公司 | 多肽及其用途 |
| CN120647762B (zh) * | 2025-06-16 | 2026-01-23 | 首都医科大学附属北京友谊医院 | 一种抗β1-AR-ECII抗体及其应用 |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7109315B2 (en) * | 2000-03-15 | 2006-09-19 | Bruce J. Bryan | Renilla reniformis fluorescent proteins, nucleic acids encoding the fluorescent proteins and the use thereof in diagnostics, high throughput screening and novelty items |
| US20030157519A1 (en) * | 2001-10-15 | 2003-08-21 | Stratagene | Recombinant renilla reniformis system for bioluminescence resonance energy transfer |
| US7932080B2 (en) * | 2004-05-04 | 2011-04-26 | Valorisation-Recherche, Limited Partnership | Double brilliance beta-arrestin: a biosensor for monitoring the activity of receptors and signalling molecules, and method of using same |
| KR101834574B1 (ko) | 2009-01-29 | 2018-03-05 | 커먼웰쓰 사이언티픽 앤드 인더스트리얼 리서치 오가니제이션 | G 단백질 커플링 수용체 활성화 측정 |
| WO2011067202A1 (en) | 2009-12-02 | 2011-06-09 | Unilever Nv | Improved method for screening a potential modulator compound of a taste receptor |
| WO2011130540A1 (en) | 2010-04-14 | 2011-10-20 | Duke University | Light stimulated protein interaction molecules and methods of use |
-
2015
- 2015-09-21 CN CN201580062566.XA patent/CN107533049B/zh active Active
- 2015-09-21 CA CA2960902A patent/CA2960902C/en active Active
- 2015-09-21 ES ES15841561T patent/ES2774416T3/es active Active
- 2015-09-21 EP EP15841561.2A patent/EP3194960B1/en active Active
- 2015-09-21 WO PCT/CA2015/050924 patent/WO2016041093A1/en not_active Ceased
- 2015-09-21 AU AU2015318567A patent/AU2015318567B2/en active Active
- 2015-09-21 NZ NZ730131A patent/NZ730131A/en unknown
- 2015-09-21 SG SG11201702133TA patent/SG11201702133TA/en unknown
- 2015-09-21 PL PL15841561T patent/PL3194960T3/pl unknown
- 2015-09-21 JP JP2017515812A patent/JP6708633B2/ja active Active
- 2015-09-21 DK DK15841561.2T patent/DK3194960T3/da active
- 2015-09-21 US US15/512,267 patent/US10584159B2/en active Active
-
2017
- 2017-03-14 IL IL251158A patent/IL251158A0/en active IP Right Grant
-
2020
- 2020-01-30 US US16/777,504 patent/US20200157184A1/en not_active Abandoned
Non-Patent Citations (3)
| Title |
|---|
| DACRES, H. ET AL.: "Comparison of enhanced bioluminescence energy transfer donors for protease biosensors''.", ANALYTICAL BIOCHEMISTRY, vol. 424, 28 February 2012 (2012-02-28), pages 206 - 210, XP028406544, ISSN: 0003-2697, Retrieved from the Internet <URL:http://www.sciencedirect.com/science/article/pii/S0003269712001376> [retrieved on 20151121], doi:10.1016/j.ab.2012.02.028 * |
| LAN, T. ET AL.: "Sensitive and High Resolution Localization and Tracking of membrane Proteins in Live Cells with BRET''.", TRAFFIC, vol. 13, no. 11, November 2012 (2012-11-01), pages 1450 - 1456, XP055418746, ISSN: 1398-9219, Retrieved from the Internet <URL:http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3889717> [retrieved on 20151121] * |
| MOLINARI, P. ET AL.: "Functional complementation of high-efficiency resonance energy transfer: a new tool for the study ofprotein binding interactions in living cells''.", BIOCHEMICAL JOURNAL, vol. 409, 2008, pages 251 - 261, XP055418871, ISSN: 0264-6021, Retrieved from the Internet <URL:http://www.biochemj.org/content/409/1/251.long> [retrieved on 20151121] * |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111164226A (zh) * | 2017-10-18 | 2020-05-15 | 蒙特利尔大学 | 评估g蛋白活化的系统和方法 |
| US20200256869A1 (en) * | 2017-10-18 | 2020-08-13 | Université de Montréal | Systems and methods for the assessment of g-protein activation |
| JP2020537531A (ja) * | 2017-10-18 | 2020-12-24 | ユニベルシテ ドゥ モントリオール | Gタンパク質活性化の評価のためのシステムおよび方法 |
| EP3697934A4 (en) * | 2017-10-18 | 2021-06-30 | Université de Montréal | SYSTEMS AND METHODS FOR EVALUATING G-PROTEIN ACTIVATION |
| US20210395736A1 (en) * | 2018-10-29 | 2021-12-23 | The Johns Hopkins University | Rasopathy treatment |
| WO2021023813A1 (en) | 2019-08-06 | 2021-02-11 | Domain Therapeutics | 5-heteroaryl-pyridin-2-amine confounds as neuropeptide ff receptor antagonists |
Also Published As
| Publication number | Publication date |
|---|---|
| IL251158A0 (en) | 2017-04-30 |
| US10584159B2 (en) | 2020-03-10 |
| AU2015318567A1 (en) | 2017-04-06 |
| US20200157184A1 (en) | 2020-05-21 |
| ES2774416T3 (es) | 2020-07-21 |
| EP3194960A4 (en) | 2018-03-07 |
| DK3194960T3 (da) | 2020-02-17 |
| CN107533049A (zh) | 2018-01-02 |
| PL3194960T3 (pl) | 2020-06-01 |
| NZ730131A (en) | 2023-05-26 |
| CA2960902A1 (en) | 2016-03-24 |
| AU2015318567B2 (en) | 2020-11-05 |
| JP6708633B2 (ja) | 2020-06-10 |
| US20170313762A1 (en) | 2017-11-02 |
| EP3194960A1 (en) | 2017-07-26 |
| CN107533049B (zh) | 2020-11-20 |
| JP2017534851A (ja) | 2017-11-24 |
| EP3194960B1 (en) | 2019-12-04 |
| CA2960902C (en) | 2023-10-24 |
| SG11201702133TA (en) | 2017-04-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3194960B1 (en) | Biosensors for monitoring biomolecule localization and trafficking in cells | |
| Drube et al. | GPCR kinase knockout cells reveal the impact of individual GRKs on arrestin binding and GPCR regulation | |
| Avet et al. | Effector membrane translocation biosensors reveal G protein and βarrestin coupling profiles of 100 therapeutically relevant GPCRs | |
| Pal et al. | Smoothened determines β-arrestin–mediated removal of the G protein–coupled receptor Gpr161 from the primary cilium | |
| Sauvageau et al. | CNIH4 interacts with newly synthesized GPCR and controls their export from the endoplasmic reticulum | |
| Thomas et al. | Palmitoylation by DHHC5/8 targets GRIP1 to dendritic endosomes to regulate AMPA-R trafficking | |
| Hamdan et al. | Unraveling G protein-coupled receptor endocytosis pathways using real-time monitoring of agonist-promoted interaction between β-arrestins and AP-2 | |
| Gowrisankaran et al. | Endophilin-A coordinates priming and fusion of neurosecretory vesicles via intersectin | |
| Marley et al. | Dysbindin promotes the post-endocytic sorting of G protein-coupled receptors to lysosomes | |
| WO2006086883A1 (en) | Biosensors for monitoring receptor-mediated g-protein activation | |
| Burghi et al. | Gαs is dispensable for β-arrestin coupling but dictates GRK selectivity and is predominant for gene expression regulation by β2-adrenergic receptor | |
| CA2963579A1 (en) | Biosensor based on g-beta-gamma-interacting proteins to monitor g-protein activation | |
| Fessart et al. | Src-dependent phosphorylation of β2-adaptin dissociates the β-arrestin–AP-2 complex | |
| JP6192638B2 (ja) | β−ガラクトシダーゼレポーターフラグメント相補性を用いるタンパク質輸送のモニタリング | |
| HK1241023B (en) | Biosensors for monitoring biomolecule localization and trafficking in cells | |
| HK1241023A1 (en) | Biosensors for monitoring biomolecule localization and trafficking in cells | |
| Drube et al. | GRK2/3/5/6 knockout: The impact of individual GRKs on arrestin-binding and GPCR regulation | |
| Appleton et al. | Dissociation of β-arrestin-dependent desensitization and signaling using'biased'parathyroid hormone receptor ligands | |
| Gardner et al. | Subcellular localization of GPCR kinases differentially modulate biased signaling at CXCR3 | |
| WO2024044308A2 (en) | Materials and methods for detecting biased signaling of g-protein coupled receptors | |
| Strungs | Elucidation of Mechanisms Modulating the Conformation and Function of β-Arrestins by G Protein-Coupled Receptors | |
| Puri et al. | The OCT2 Transporter Regulates Dopamine D1 Receptor Signaling at the Golgi Apparatus | |
| Willette | Getting Up Close and Personal: What Makes an Endosome Special in GPCR Signaling | |
| US11905324B2 (en) | Fluorescent fusion polypeptide capable of detecting phosphorylation of cellular membrane receptors by GRKs (G-protein receptor kinases) and/or receptor tyrosine kinases (RTKs) | |
| Heydenreich | The inner workings of a GPCR: molecular basis of biased G protein activation and beta-arrestin recruitment |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15841561 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2960902 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 251158 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2017515812 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15512267 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2015318567 Country of ref document: AU Date of ref document: 20150921 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015841561 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015841561 Country of ref document: EP |