WO2016038455A1 - Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea - Google Patents

Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea Download PDF

Info

Publication number
WO2016038455A1
WO2016038455A1 PCT/IB2015/001922 IB2015001922W WO2016038455A1 WO 2016038455 A1 WO2016038455 A1 WO 2016038455A1 IB 2015001922 W IB2015001922 W IB 2015001922W WO 2016038455 A1 WO2016038455 A1 WO 2016038455A1
Authority
WO
WIPO (PCT)
Prior art keywords
elsiglutide
chemotherapy
cycle
cancer
administration
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2015/001922
Other languages
English (en)
French (fr)
Inventor
Ruben Giorgino
Simona Roncoroni
Selma Calcagnile
Fabio Trento
Riccardo Spezia
Cecilia Moresino
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Helsinn Healthcare SA
Original Assignee
Helsinn Healthcare SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP15795220.1A priority Critical patent/EP3191115A1/en
Priority to MX2017003166A priority patent/MX2017003166A/es
Priority to KR1020177009656A priority patent/KR20170052661A/ko
Priority to SG11201701690WA priority patent/SG11201701690WA/en
Priority to CN201580060760.4A priority patent/CN107073081A/zh
Priority to BR112017004577A priority patent/BR112017004577A2/pt
Priority to AU2015313919A priority patent/AU2015313919A1/en
Priority to CA2959110A priority patent/CA2959110A1/en
Application filed by Helsinn Healthcare SA filed Critical Helsinn Healthcare SA
Priority to EA201790552A priority patent/EA201790552A1/ru
Priority to JP2017513522A priority patent/JP2017532308A/ja
Publication of WO2016038455A1 publication Critical patent/WO2016038455A1/en
Priority to IL250928A priority patent/IL250928A0/en
Priority to PH12017500426A priority patent/PH12017500426A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/12Antidiarrhoeals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P39/00General protective or antinoxious agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00

Definitions

  • the invention relates to the use of elsiglutide to protect against and prevent gastrointestinal organ-specific toxicities induced by chemotherapeutic agents.
  • this invention relates to the use of elsiglutide to prevent and reduce the occurrence or severity of gastrointestinal mucositis, and its clinical manifestations including chemotherapy-induced diarrhea.
  • Gastrointestinal (GI) damage and dysfunction are well-known side effects of cancer- chemotherapy treatments and can be debilitating and potentially life threatening (Richardson and Dobish, J Oncol Pharm Practice 2007; 13: 181-198; Grem et al., J Clin Oncol 1987; 5(10): 1704; Petrelli et al., J Clin Oncol 1989; 7(10): 1419-1426).
  • Chemotherapy administration is frequently associated with mucositis, diarrhea (chemotherapy-induced diarrhea (CID), bacterial translocation, malabsorption, abdominal cramping, gastrointestinal bleeding and vomiting.
  • CID chemotherapy-induced diarrhea
  • the stem cells of the small intestinal mucosa are particularly susceptible to the cytotoxic effects of chemotherapy due to their rapid rate of proliferation (Keefe et al, Gut 2000; 47: 632- 7). Chemotherapy-induced damage to the small intestinal mucosa is referred to as gastrointestinal mucositis and is characterized by absorptive and barrier impairments of the small intestine.
  • 5- fluorouracil 5- fluorouracil
  • irinotecan 5- fluorouracil
  • methotrexate increase apoptosis leading to villus atrophy and crypt hypoplasia in the small intestine of rodents
  • Chemotherapeutic agents have been shown to increase apoptosis in intestinal crypts at 24 hours after administration and subsequently to decrease villus area, crypt length, mitotic count per crypt, and enterocyte height three days after chemotherapy in humans (Keefe et al, Gut 2000; 47: 632-7). Thus, structural changes within the small intestine can lead directly to intestinal dysfunction and in some cases diarrhea.
  • Gastrointestinal mucositis after cancer chemotherapy is an increasing problem that is essentially untreatable once established, although it gradually remits.
  • Studies conducted with the commonly used cytostatic cancer drugs 5-FU and irinotecan have demonstrated that efficacious doses of these drugs predominantly affects structural integrity and function of the small intestine while the colon is less sensitive and mainly responds with increased mucus formation (Gibson et al, J Gastroenterol Hepatol. September; 18(9): 1095-1100, 2003; Tamaki et al, J Int Med Res. 31(1):6-16, 2003).
  • CID is a dose-related adverse effect engendered by a multi-factorial process, through which the acute cytotoxic damage to the intestinal mucosa (including loss of intestinal epithelium, superficial necrosis and inflammation of the bowel wall) causes an imbalance between absorption and secretion in the small intestine (Stein et al, Ther Adv Med Oncol 2010, 2: 51 -63; Gibson and Stringer, Curr Opin Support Palliat Care 2009, 3: 31 -35; Keefe, Curr Opin Oncol 2007, 19: 323-27).
  • irinotecan-induced early onset diarrhea a dose-dependent adverse reaction occurring within 24 hours after the drug administration, the onset of CID episodes generally occurs a few days following administration, at all dose levels.
  • the median time to late-CK) onset is reported between 6 to 11 days following administration (Stein et al, Ther Adv Med Oncol 2010, 2: 51-63).
  • Non-analgesic opiates such as loperamide are commonly employed because of their ability to promote intestinal fluid re-absorption and to slow down intestinal motility. Loperamide is commonly used as a standard first-line therapy for Grades 1-2 diarrhea.
  • Octreotide a synthetic somatostatin analogue has been shown to reduce the secretion of some intestinal hormones and promote intestinal absorption of fluids and electrolytes.
  • octreotide is often used for second line treatment of loperamide refractory CID or for grades 3-4 diarrhea.
  • Parenteral hydration and electrolyte supplementation and in severe cases, total parenteral nutrition are used as well. See, e.g., Benson et al., J Clin Oncol 2004; 22(14):2918-2926.
  • Other therapeutic options are available and under study, such as probiotics, but are not currently recommended for practice (Benson et al, J Clin Oncol 2004; 22(14):2918-2926; Muehlbauer et al, Clin J Oncol Nurs 2009, 13: 336-41).
  • Glucagon-like-peptide-2 (GLP-2) is a 33-amino-acid peptide released from the post- translational processing of proglucagon in the enteroendocrine L cells of the intestine and in specific regions of the brainstem. It is co-secreted together with glucagon-like peptide 1 (GLP- 1), oxyntomodulin and glicentin, in response to nutrient ingestion. GLP-2 induces significant growth of the small intestinal mucosal epithelium via the stimulation of stem cell proliferation in the crypts and inhibition of apoptosis on the villi (Drucker et al. Proc Natl Acad Sci USA. 1996, 93:791 1-6).
  • GLP-2 also inhibits gastric emptying and gastric acid secretion (Wojdemann et al. J Clin Endocrinol Metab. 1999, 84:2513-7), enhances intestinal barrier function (Benjamin et al. Gut. 2000, 47: 112-9.), stimulates intestinal hexose transport via the upregulation of glucose transporters (Cheeseman, Am J Physiol. 1997, Rl 965-71), and increases intestinal blood flow (Guan et al. Gastroenterology. 2003, 125, 136-47).
  • GLP-2 has raised much interest as to the use of GLP-2 in the treatment of intestinal disease or injury (Sinclair and Drucker, Physiology 2005: 357-65). Furthermore GLP-2 has been shown to prevent or reduce mucosal epithelial damage in a wide number of preclinical models of gut injury, including chemotherapy-induced mucositis, ischemia-reperfusion injury, dextran sulfate- induced colitis and genetic models of inflammatory bowel disease (Sinclair and Drucker, Physiology 2005:357-65).
  • GLP-2 is secreted as a 33 amino acid peptide having the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID NO: 2). It is rapidly cleaved at the Alanine (A) in position 2 of the N-terminus to the inactive human GLP-2 (3-33) by the enzyme dipeptidyl peptidase-4 (DPP IV). This rapid enzymatic degradation of GLP-2(l-33), in addition to renal clearance results in a half-life of about 7 minutes for the peptide (Tavares et al., Am. J. Physiol. Endocrinol. Metab. 278:E134-E139, 2000).
  • GLP-2 analogues which comprise one of more substitutions as compared to wild-type GLP-2.
  • One of the described GLP-2 analogues is ZP1846 (elsiglutide).
  • a comparison of the sequences of GLP-2 and elsiglutide is provided below:
  • elsiglutide HGEGSFSSELSTILDALAARDFIAWLIATKITDKKKKKK (SEQ ID NO: 1)
  • GLP-2 HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID NO: 2).
  • U.S. Patent Nos. 7,745,403 and 7,563,770 propose the use of GLP-2 analogues, including elsiglutide, for preventing or ameliorating side effects of chemotherapy, including chemotherapy- induced diarrhea (CID).
  • GLP-2 analogues appear to act in CJD by inhibiting enterocyte and crypt cell apoptosis and increasing crypt cell proliferation, thus providing new cells to replace the damaged intestinal epithelium following chemotherapy.
  • Clinicaltrials.gov reports the following brief summary of the study: The main objective of this study will be to obtain data on the efficacy of elsiglutide in preventing Chemotherapy Induced Diarrhea (CID) in patients with colorectal cancer receiving 5-FU based chemotherapy (FOLFOX4 or FOLFIRI regimen) in comparison to placebo. The results of the study are not reported in clinicaltrials.gov, but are reported for the first time herein.
  • the present invention is based on the discovery that the occurrence of chemotherapy- induced diarrhea (CID) is prevented or its severity is reduced upon administration of the GLP-2 analog elsiglutide.
  • CID chemotherapy- induced diarrhea
  • the invention is based on the unexpected finding that the administration of elsiglutide provides a protective effect against CID that extends long after the elsiglutide is administered. The effect is especially pronounced for diarrhea of Grade >2 as determined by National Cancer Institute Common Toxicity Criteria for Diarrhea (CTCAE v.4.03).
  • CCAE v.4.03 National Cancer Institute Common Toxicity Criteria for Diarrhea
  • the elsiglutide was administered for only a few days at the beginning of the chemotherapy cycle, the elsiglutide was able to lower the incidence of Grade 2 and less diarrhea events during the entire period of the chemotherapy cycle, including on days 5 through 6 when the occurrence of diarrhea is shown to be the greatest, and levels of citrulline (a marker of intestinal damage) are decreased compared to baseline values.
  • the invention provides a method for preventing or reducing the occurrence of grade 2 or higher diarrhea resulting from an anti-cancer chemotherapy in a subject in need thereof, which method comprises administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide for four consecutive days, preferably commencing at the start of the chemotherapy cycle.
  • the invention provides a method for treating gastrointestinal mucositis, or otherwise preventing or reducing gastrointestinal (GI) damage and/or dysfunction associated with an anti-cancer chemotherapy in a subject in need thereof, which method comprises administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide for a plurality of consecutive days, preferably commencing at the start of the chemotherapy cycle and ending prior to the conclusion of the chemotherapy cycle.
  • GI gastrointestinal
  • Another embodiment relates to the use of elsiglutide to prevent or reducing the occurrence of or severity of gastrointestinal mucositis (including CID) in cancer patients receiving antibody therapy for their cancer, with or without treatment with a small cytotoxic agent.
  • This embodiment is particularly useful in preventing or reducing the occurrence of grade 2 or higher CID.
  • the invention provides a method for preventing or reducing gastrointestinal mucositis in a cancer patient receiving antibody therapy, including grade 2 or higher CID, by administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide for four consecutive days, preferably commencing at the start of the antibody cycle.
  • Still another embodiment relates to the use of elsiglutide to prevent GI damage as detected by means of certain citrulline levels during chemotherapy.
  • the invention provides a method for preventing GI damage by maintaining citrulline levels in a subject receiving chemotherapy, comprising administering to said subject a therapeutically effective amount of elsiglutide.
  • Figure 1 shows the proportion of patients with diarrhea of any grade, by day on days 1- 14, with or without elsiglutide administration in study TIDE-11-10.
  • Figure 2 shows the proportion of patients with diarrhea of grade >2, by day on days 1-14, with or without elsiglutide administration in study TIDE-1 1-10.
  • references to elsiglutide include elsiglutide hydrochloride, and other pharmaceutically acceptable salts of elsiglutide.
  • elsiglutide and “ZP1846” are used interchangeably to refer to a GLP-2 peptide analog having amino acid sequence:
  • Salts include pharmaceutically acceptable salts such as, e.g., acid addition salts and basic salts.
  • acid addition salts include hydrochloride salts, citrate salts and acetate salts.
  • basic salts include salts where the cation is selected from alkali metals, such as sodium and potassium, alkaline earth metals, such as calcium, and ammonium ions
  • R and R independently designates optionally substituted Ci-6-alkyl, optionally substituted C2-6-alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • Other examples of pharmaceutically acceptable salts are described in "Remington's Pharmaceutical Sciences", 17th edition. Ed. Alfonso R. Gennaro (Ed.), Mark Publishing Company, Easton, Pa., U.S.A., 1985 and more recent editions, and in the Encyclopaedia of Pharmaceutical Technology.
  • the terms "cancer chemotherapy” and “chemotherapy” are used interchangeably herein to refer to a therapy of cancer by administering an anti-cancer agent.
  • anti-cancer agent and "chemotherapeutic agent” are used herein to refer to any chemical compound which is used to treat cancer.
  • Chemotherapeutic agents are well known in the art (see, e.g., Gilman A. G., et al, The Pharmacological Basis of Therapeutics, 8th Ed., Sec 12: 1202-1263 (1990)).
  • chemotherapeutic agents include, for example, FOLFOX (a chemotherapy regimen for treatment of colorectal cancer, which comprises administration of folinic acid (leucovorin), fluorouracil (5- FU), and oxaliplatin) and FOLFIRI (a chemotherapy regimen for treatment of colorectal cancer, which comprises administration of folinic acid (leucovorin), fluorouracil (5-FU), and irinotecan), as well as administration of targeted monoclonal antibody therapy (e.g., bevacizumab, cetuximab, or panitumumab) alone or in combination with chemotherapeutic agents.
  • FOLFOX a chemotherapy regimen for treatment of colorectal cancer, which comprises administration of folinic acid (leucovorin), fluorouracil (5-FU), and irinotecan
  • FOLFIRI a chemotherapy regimen for treatment of colorectal cancer, which comprises administration of folinic acid (leucovorin), fluorouracil (5-FU
  • chemotherapy cycle is used herein to refer to a period of time between the initial administration of an anti-cancer agent and its repeat administration.
  • the cycle of the FOLFOX4 chemotherapy discussed in the Examples section below includes 14 days, wherein anti-cancer agents are administered only for the first 2 days of the cycle as follows: Day 1 : oxaliplatin 85 mg/m 2 IV infusion and leucovorin 200 mg/m 2 IV infusion both given over 120 minutes at the same time in separate bags, followed by 5-FU 400 mg/m 2 IV bolus given over 2-4 minutes, followed by 5-FU 600 mg/m 2 IV infusion as a 22-hour continuous infusion; Day 2: leucovorin 200 mg/m 2 IV infusion, followed by 5-FU 400 mg/m 2 IV bolus given over 2-4 minutes, followed by 5-FU 600 mg/m 2 IV infusion as a 22-hour continuous infusion.
  • the cycle of the FOLFIRI chemotherapy discussed in the Examples section, below includes 14 days, wherein anti-cancer agents are administered only for the first 2 days of the cycle as follows: irinotecan (180 mg/m 2 IV over 90 minutes) concurrently with folinic acid (400 mg/m 2 [or 2 x 250 mg/m 2 ] IV over 120 minutes), followed by fluorouracil (400-500 mg/m 2 IV bolus) then fluorouracil (2400-3000 mg/m 2 intravenous infusion over 46 hours).
  • Bevacizumab is usually given intravenously every 14 days, although the frequency can be dose dependent (for example 5 mg/kg by intravenous infusion every two weeks or 7.5 mg/kg by intravenous infusion every three weeks).
  • co-administered and “co-administration” broadly refer to administration of two or more components, compounds or compositions (e.g., a chemotherapeutic agent and elsiglutide), wherein said components, compounds or compositions can be administered either simultaneously (in one composition or in two or more separate compositions) or sequentially.
  • the term “about” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within an acceptable standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to ⁇ 20%, preferably up to ⁇ 10%, more preferably up to ⁇ 5%, and more preferably still up to ⁇ 1% of a given value. Where particular values are described in the application and claims, unless otherwise stated, the term “about” is implicit and in this context means within an acceptable error range for the particular value.
  • the terms "prevent,” “prevention,” “treat,” “treatment” and the like are synonymous and mean to reduce the occurrence of a symptom or condition, or to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition.
  • the terms also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease.
  • the term “prevent,” “treat” or “reduce the occurrence of,” may mean that a therapy has been demonstrated in a prospectively designed clinical trial to reduce the incidence or occurrence of a clinical endpoint, symptom or condition such as diarrhea or gastrointestinal mucositis.
  • the term "therapeutically effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof.
  • therapeutically effective when used in connection with elsiglutide, it refers to an amount of elsiglutide or a pharmaceutical composition containing elsiglutide that is effective to prevent side effects or reduce the incidence, occurrence or severity of side effects of cancer chemotherapy such as damage to the gastrointestinal mucosa or diarrhea.
  • a combination of active ingredients e.g., a combination of elsiglutide and another compound effective for ameliorating or preventing side effects of cancer chemotherapy
  • the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually.
  • compositions of the invention refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a subject (e.g., a mammal such as a human).
  • a subject e.g., a mammal such as a human
  • pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
  • the term "subject" refers to any mammal. In a preferred embodiment, the subject is human.
  • the invention provides a method for preventing or reducing the occurrence of grade 2 or higher diarrhea as determined by National Cancer Institute Common Toxicity Criteria for Diarrhea (CTCAE v.4.03) resulting from an anti-cancer chemotherapy cycle in a subject in need thereof, which method comprises administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide, preferably for four consecutive days commencing at the start of the chemotherapy cycle.
  • CCAE v.4.03 National Cancer Institute Common Toxicity Criteria for Diarrhea
  • the invention provides a method for preventing or reducing gastrointestinal (GI) damage and/or dysfunction associated with an anti-cancer chemotherapy cycle in a subject in need thereof, which method comprises administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide for a plurality of consecutive days, preferably commencing at the start of the chemotherapy cycle and ending prior to the conclusion of the chemotherapy cycle.
  • GI gastrointestinal
  • the invention can also be used to prevent and reduce gastrointestinal mucositis induced by antibody chemotherapy, and in this embodiment the invention provides a method for preventing gastrointestinal mucositis in a cancer patient receiving antibody therapy alone or in combination with one or more chemotherapy agents, including grade 2 or higher CID, by administering to the subject a therapeutically effective amount of elsiglutide in an elsiglutide regimen, wherein the elsiglutide regimen preferably comprises daily administration of elsiglutide, preferably for four consecutive days commencing at the start of the antibody cycle.
  • Still another embodiment relates to the use of elsiglutide to prevent GI damage as detected by means of certain citrulline levels during chemotherapy.
  • the invention provides a method for preventing GI damage by maintaining citrulline levels in a subject receiving chemotherapy, comprising administering to said subject a therapeutically effective amount of elsiglutide.
  • maintaining it is meant that the elsiglutide preferably prevents the citrulline levels of citrulline from dropping 20% or more, 40% or more, 60% or more, or even 80% or more, from the level that citrulline would drop in the absence of such elsiglutide.
  • Elsiglutide and a chemotherapeutic agent(s) are preferably administered concurrently for two or more days, with the elsiglutide administration beginning on the same day that the chemotherapy cycle begins, although it is feasible to administer or at least initiate the elsiglutide administration before the administration of the chemotherapeutic agent(s) begins, or to administer elsiglutide after the administration of the chemotherapeutic agent(s) concludes (i.e., during the days of the chemotherapy cycle when the chemotherapeutic agent(s) is no longer administered).
  • the chemotherapy comprises multiple cycles, such as 2, 3, 4 or more cycles
  • elsiglutide is preferably administered during each of the cycles.
  • elsiglutide can be administered one or more times during the day, but it is preferably only administered once daily.
  • the elsiglutide regimen preferably comprises elsiglutide administration daily for 1 , 2, 3, 4, 5, or six days of the chemotherapy cycle, or anywhere between these time periods (such as 1 -5 days), although 4 days appears to be adequate.
  • the regimen is also preferably initiated at the start of the chemotherapy cycle, although the regimen can also be initiated as many as 1, 2, 3, 4 or 5 days prior to the initiation of the chemotherapy cycle.
  • the regimen is also preferably performed on consecutive days, although dosing for non-consecutive daily periods can also be envisioned.
  • a chemotherapy cycle may comprise administration of chemotherapy for 1 or more, 3 or more, 5 or more, 7 or more, 9 or more, or even 10 or more consecutive days during the cycle, or anywhere between these time periods (such as 1 to up to 5 days).
  • the chemotherapy cycle might last for one week, two weeks, three weeks, four weeks, or even more, or anywhere in between these time periods. It has been found herein that a limited period of elsiglutide administration is effective to prevent or reduce the occurrence or severity of gastrointestinal mucositis or CID throughout a 14 day chemotherapy cycle, including on days 5 through 9 when the incidence of mucositis or CJD is shown to be most pronounced.
  • the methods are used to prevent and reduce the occurrence or severity of more severe cases of CID, grade 2 or higher as determined by the National Cancer Institute Common Toxicity Criteria for Diarrhea (CTCAE v.4.03).
  • elsiglutide can be used to reduce toxicity of a wide range of different chemotherapeutic agents, prodrugs of such chemotherapeutic agents, and chemotherapy regimens. While some chemotherapy agents and regimens are better known for producing CID and damaging the gastrointestinal mucosa, the invention can also be practiced to reduce subclinical occurrences of CID or damage to the gastrointestinal mucosa from practically any chemotherapy agent.
  • Non-limiting examples of such agents include anti-metabolites such as pyrimidine analogs (e.g., 5-fluorouracil [5-FU], floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (e.g., mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (e.g., vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxanes (e.g., paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (e.g., etoposide, teniposide), DNA damaging agents (e.g., actinomycin,
  • Non-limiting examples of gastrointestinal (GI) damage and/or dysfunction associated with anti-cancer chemotherapies include, for example, chemotherapy-induced diarrhea (CID), nausea, vomiting, anorexia, body weight loss, heavy feeling of stomach, constipation, stomatitis, and esophagitis.
  • CID chemotherapy-induced diarrhea
  • nausea vomiting
  • anorexia body weight loss
  • heavy feeling of stomach constipation
  • stomatitis stomatitis
  • esophagitis esophagitis
  • Non-limiting examples of relevant cancers include, e.g., breast cancer, prostate cancer, multiple myeloma, transitional cell carcinoma, lung cancer (e.g., non-small cell lung cancer (NSCLC)), renal cancer, thyroid cancer and other cancers causing hyperparathyroidism, adenocarcinoma, leukemia (e.g., chronic myeloid leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, acute lymphocytic leukemia), lymphoma (e.g., B cell lymphoma, T cell lymphoma, non-Hodgkins lymphoma, Hodgkins lymphoma), head and neck cancer, esophageal cancer, stomach cancer, colon cancer, intestinal cancer, colorectal cancer, rectal cancer, pancreatic cancer, liver cancer, cancer of the bile duct, cancer of the gall
  • elsiglutide doses useful in the methods of the invention will depend on the type of chemotherapy side effects to be treated, the severity and course of these side effects, previous therapy, the patient's clinical history and response to chemotherapy and elsiglutide, as well as the discretion of the attending physician. In one specific embodiment, such doses range from 5 to 80 or from 10 to 40 mg/ day.
  • elsiglutide can be performed by any suitable route.
  • suitable routes of administration include subcutaneous, intravenous (IV), intraperitoneal (IP), and intramuscular.
  • elsiglutide is formulated in a pharmaceutical composition with a pharmaceutically acceptable carrier or excipient. In certain embodiments, elsiglutide is combined in a pharmaceutical composition together with another compound effective for ameliorating or preventing side effects of cancer chemotherapy.
  • the formulations used in the methods of the invention may conveniently be presented in unit dosage form and may be prepared by methods known in the art.
  • the amount of active ingredients that can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated and the particular mode of administration. The amount of active ingredients that can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
  • compositions suitable for parenteral administration may comprise elsiglutide in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use.
  • Study TIDE-11-10 was a phase II proof of concept study that mainly evaluated the efficacy of elsiglutide administered as 24 mg daily s.c. bolus injections for 4 consecutive days in preventing CID in patients with colorectal cancer receiving 5-FU based chemotherapy (FOLFOX4 or FOLFIRI regimen).
  • the secondary objectives of all three studies included the evaluation of the pharmacokinetics of elsiglutide and its major metabolites in humans.
  • Elsiglutide has a short half-life (0.4 h) and is quickly eliminated from blood circulation after single i.v. administration. Data, although limited to 1 subject only, indicate an absolute bioavailability of 0.29%.
  • ZP2242 is the major metabolite and revealed an AUC at least 10 times higher than that of ZP2712. In general, exposure to the metabolite ZP2242 was >25-fold higher than exposure to the parent ZP1846 (elsiglutide) on Day 1. Exposure to the metabolite ZP2712 was >4 fold higher than exposure to the parent ZP1846 (elsiglutide) on Day 1.
  • Safety data in humans are derived from two phase I dose-escalation studies and one phase II study, which included 202 human subjects (36 healthy subjects and 166 colon and colorectal cancer patients receiving 5-FU-based chemotherapy), 117 of whom received active treatment.
  • the maximum tolerated dose (MTD; defined in this study as the dose level immediately prior to the dose level at which further dose escalation was halted due to the study 'Stopping Rules') was 9.6 mg i.v. and 3 mg s.c, as an AE that met the study stopping rules was observed in the 19.2 mg i.v. group (moderate positional lightheadedness) and in the 6 mg s.c. group (moderate systolic hypotension).
  • TEAE treatment-emergent adverse event
  • the formulation used in clinical trials is a lyophilized sterile powder for s.c. administration after reconstitution with sterile water for injection.
  • the efficacy results obtained in study TIDE-11-10 indicate that elsiglutide had a preventive effect on the occurrence of grade > 2 diarrhea (see Figures 1 and 2).
  • This study also included an evaluation of the levels of citrulline, an amino acid mainly produced by enterocytes, a decrease of which is indicative of an intestinal mucosal damage following chemotherapy.
  • the main objective of TIDE- 11-10 proof of concept study was to obtain data on the efficacy of elsiglutide in preventing CID in patients with colorectal cancer receiving 5-FU based chemotherapy (FOLFOX4 or FOLFIRI regimen) in comparison to placebo.
  • PK pharmacokinetics
  • Diagnosis and Main Criteria for Inclusion Female and male patients of at least 18 years of age with confirmed diagnosis of colorectal cancer and an Eastern Cooperative Oncology Group (ECOG) performance status ⁇ 2, chemotherapy-naive, and scheduled to FOLFOX4 or FOLFIRI chemotherapy regimen.
  • ECOG Eastern Cooperative Oncology Group
  • Time to occurrence of diarrhea defined as the first day in which a grade >1 diarrhea was assessed (from Day 1 to day 14);
  • TIDE- 13 -22 Randomized, double blind, parallel group, placebo-controlled, dose finding study in colorectal cancer patients receiving 5-FU based chemotherapy to assess the efficacy of different doses of s.c. elsiglutide in the prevention of Chemotherapy induced diarrhea (CID)
  • this study also includes an additional patient population that is scheduled to receive FOLFOX or FOLFIRI together with monoclonal antibodies such as bevacizumab, cetuximab, panitumumab, or others, in order to gather preliminary results in this patient population.
  • the present study aims at further investigating the efficacy of elsiglutide and identifying the most appropriate s.c. dosage.
  • the dosages for the present study are 10 mg/day, 20 mg/day, and 40 mg/day each administered s.c. on 4 consecutive days.
  • elsiglutide prevents 5- Fluorouracil (5-FU)-induced small intestinal atrophy and diarrhea, attenuates body weight loss and decreases mortality in rats.
  • Elsiglutide also decreases the severity of irinotecan-induced diarrhea, including late-onset diarrhea, decreases body weight loss and lethality and enhances animal recovery.
  • elsiglutide has an intestinotrophic effect and histopathological observations show that it drastically reduces irinotecan induced severe intestinal damage.
  • the dose of 400 nmol/kg corresponds to 1.7 mg/kg which in term of HED (human equivalent dose) results in approximately 20 mg (see guidance "Estimating the Maximum Safe Starting Dose in Initial Clinical Trials for Therapeutics in Adult Healthy Volunteers", FDA July 2005).
  • PK/pharmacodynamic (PD) data in different animal species indicate that a dose of 20 mg/day could be considered the lowest efficacious dose.
  • the phase I and II studies described above (TIDE-09-04 and TIDE-1 1-10) have shown that the tolerability of the product is better than originally expected based on study 06-013. In study TIDE-09-04 a dose of 93 mg/day on 4 consecutive days was reached with no dose limiting toxicity.
  • the present study aims at further investigating the efficacy of elsiglutide and identifying the most appropriate s.c. dosage.
  • the dosages are 10 mg/day, 20 mg/day, and 40 mg/day each administered s.c. on 4 consecutive days.
  • a placebo treatment is included in this study as a control group in which the incidence of CJD can be assessed.
  • the plasma level of citrulline is also evaluated in order to establish its potential role as a biomarker of mucosal repair. Reduced citrulline levels are suggestive of intestinal failure (Crenn et al, Clin Nutr. 2008; 27(3):328-339) and have also been observed to be related with intestinal mucosal damage following chemotherapy (Herbers et al., Ann Oncol. 2010; 21(8): 1706-1711).
  • the primary objective of the present study is to compare the efficacy of 3 s.c. doses of elsiglutide vs placebo and vs each other in the prevention of CJD in colorectal cancer patients treated with 5-FU based chemotherapy (FOLFOX or FOLFIRI) with no addition of a monoclonal antibody.
  • the study includes 480 patients receiving 5-FU-based chemotherapy (FOLFOX or FOLFIRI) ("Target population”), and an additional group of up to 120 patients receiving the 5 FU-based chemotherapy in combination with a monoclonal antibody ("Additional population").
  • FOLFOX or FOLFIRI 5-FU-based chemotherapy
  • Additional population an additional group of up to 120 patients receiving the 5 FU-based chemotherapy in combination with a monoclonal antibody
  • Patients preferably exhibit efficacy on the basis of one or more of the primary or secondary efficacy endpoints, as described below.
  • the efficacy assessment is based both on data recorded by the patient and on the clinical assessment of the Investigator.
  • Patients are asked to record on a daily basis in a e-Diary information related to her/his bowel movements (including time, number and consistency of stools (following the Bristol Stool Form Scale as described in Lewis and Heaton, Scand J Gastroenterol. 1997; 32 (9):920-924), urgency and fecal incontinence), limitations in activity of daily living (ADL), use of rescue medications due to diarrhea and abdominal discomfort.
  • patients are requested to report daily the occurrence of diarrhea.
  • the patient e-Diary is to be filled in daily from Day 1 to Day 14 of Cycles 1, 2 and 3.
  • the occurrence of events of diarrhea over the 14-day period following each chemotherapy is assessed by the investigator based on the information collected in the patient's eDiary; severity of each event of diarrhea is graded by the Investigator according to NCI- CTCAE v.4.03 scale. The maximum grade assigned to any of the individual events is identified. A maximum Grade >2 diarrhea is considered for the primary endpoint.
  • Plasma levels of citrulline are measured in all patients to evaluate its potential mucosa- protective effect. For this purpose, blood samples are taken at Screening, Day 2 of Cycle 1 (before study drug administration), Day 5 and Day 15 of the first 2 chemotherapy cycles, i.e. when the study drug is administered, and at Follow-up.
  • AEs adverse events
  • ECGs 12-lead electrocardiograms
  • the PK of elsiglutide and its active metabolites ZP2242 and ZP2712 is assessed in all patients randomized to each of the study treatments and consenting to participate in PK sampling.
  • the individual's dense plasma concentration-time data is evaluated and the standard PK parameters are estimated.
  • the dose-proportionality is also investigated in the tested dose range between 10 and 40 mg.
  • the influence of possible demographic and therapeutic covariates on the PK parameters and their variability is investigated by both a two-stage population PK approach and non-linear mixed effect modeling. The possible relationship between exposure to elsiglutide and its metabolites and efficacy measures is explored.
  • Patient's health related quality of life is measured by using the EQ-5D-3L questionnaire.
  • the following endpoints are considered for the Target population. They are also considered for the Additional population as relevant based on the number of patients available.
  • Grade 5 and any Grade i.e. > 1 diarrhea by cycle (Cycle 1, 2 and 3); Proportion of patients experiencing an overall Grade > 2 diarrhea by cycle (Cycle 1, Cycle 2 and Cycle 3);
  • Severity of diarrhea is classified by the Investigator according to the NCI-CTCAE, Version 4.03 (June 2010) as described in 2 below:
  • a Semi-colon indicates 'or' within the description of a grade
  • EQ-5D-3L Patient's health related quality of life is measured using the EQ-5D-3L questionnaire developed by the EuroQol Group. Patients complete the questionnaire EQ-5D-3L at Screening, Day 5 and Day 15 of Cycles 1, 2 and 3 (Follow-Up). The questionnaire is part of the e-Diary.
  • the EQ-5D 3L has been designed as an international, standardized, generic instrument that describes health status in 5 dimensions. It generates 3 types of data for each patient:
  • the main objective of this evaluation is to assess whether or not elsiglutide at different dosages vs. placebo is associated with a positive impact in patients' HRQL from baseline.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Endocrinology (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/IB2015/001922 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea Ceased WO2016038455A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
AU2015313919A AU2015313919A1 (en) 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea
KR1020177009656A KR20170052661A (ko) 2014-09-10 2015-09-02 화학요법-유발 설사를 포함한 위장 점막염을 치료하기 위한 엘시글루티드의 용도
SG11201701690WA SG11201701690WA (en) 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea
CN201580060760.4A CN107073081A (zh) 2014-09-10 2015-09-02 Elsiglutide治疗胃肠道黏膜炎包括化疗诱发的腹泻的应用
BR112017004577A BR112017004577A2 (pt) 2014-09-10 2015-09-02 método para prevenir ou reduzir a ocorrência ou gravidade da diarreia e métodos de prevenção ou redução do dano gastrointestinal
CA2959110A CA2959110A1 (en) 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea
EA201790552A EA201790552A1 (ru) 2014-09-10 2015-09-02 Применение элсиглутида для лечения мукозита желудочно-кишечного тракта, включая индуцированную химиотерапией диарею
EP15795220.1A EP3191115A1 (en) 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea
MX2017003166A MX2017003166A (es) 2014-09-10 2015-09-02 Uso de elsiglutida para tratar mucositis gastrointestinal que incluye diarrea inducida por quimioterapia.
JP2017513522A JP2017532308A (ja) 2014-09-10 2015-09-02 化学療法誘発性下痢を含む消化管粘膜炎を治療するためのエルシグルチドの使用
IL250928A IL250928A0 (en) 2014-09-10 2017-03-05 Use of eliglutide to treat gastrointestinal mucosal inflammation including chemotherapy-induced diarrhea
PH12017500426A PH12017500426A1 (en) 2014-09-10 2017-03-07 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462048520P 2014-09-10 2014-09-10
US62/048,520 2014-09-10

Publications (1)

Publication Number Publication Date
WO2016038455A1 true WO2016038455A1 (en) 2016-03-17

Family

ID=54548212

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2015/001922 Ceased WO2016038455A1 (en) 2014-09-10 2015-09-02 Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea

Country Status (18)

Country Link
US (1) US20160067311A1 (enExample)
EP (1) EP3191115A1 (enExample)
JP (1) JP2017532308A (enExample)
KR (1) KR20170052661A (enExample)
CN (1) CN107073081A (enExample)
AR (1) AR103119A1 (enExample)
AU (1) AU2015313919A1 (enExample)
BR (1) BR112017004577A2 (enExample)
CA (1) CA2959110A1 (enExample)
CL (1) CL2017000563A1 (enExample)
EA (1) EA201790552A1 (enExample)
IL (1) IL250928A0 (enExample)
MA (1) MA40623A (enExample)
MX (1) MX2017003166A (enExample)
PH (1) PH12017500426A1 (enExample)
SG (1) SG11201701690WA (enExample)
TW (1) TW201613634A (enExample)
WO (1) WO2016038455A1 (enExample)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017046357A1 (en) * 2015-09-17 2017-03-23 Helsinn Healthcare Sa Therapeutic uses of elsiglutide
WO2018229252A1 (en) * 2017-06-16 2018-12-20 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
RU2785662C2 (ru) * 2017-06-16 2022-12-12 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11389424B2 (en) 2017-03-09 2022-07-19 Napo Pharmaceuticals, Inc. Methods and compositions for treating chemotherapy-induced diarrhea
BR112022025741A2 (pt) * 2020-06-19 2023-01-03 Napo Pharmaceuticals Inc Usos de composições compreendendo crofelemer para tratamento de diarreia induzida por quimioterapia (cid)
CN115054683B (zh) * 2022-05-19 2023-06-09 唐颢 胰高血糖素样肽-2在制备缓解阿霉素心脏毒性药物中的用途

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006117565A2 (en) * 2005-05-04 2006-11-09 Zealand Pharma A/S Glucagon-like-peptide-2 (glp-2) analogues

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA200709027B (en) * 2005-04-22 2009-01-28 Novacea Inc Treatment, prevention and amelioration of pulmonary disorders associated with chemotherapy or radiotherapy with active vitamin D compounds or mimics thereof
EP2314616A1 (en) * 2009-10-23 2011-04-27 Ferring B.V. Peptidic GLP-2 agonists

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006117565A2 (en) * 2005-05-04 2006-11-09 Zealand Pharma A/S Glucagon-like-peptide-2 (glp-2) analogues
US7563770B2 (en) 2005-05-04 2009-07-21 Zealand Pharma A/S Glucagon-like-peptide-2 (GLP-2) analogues
US7745403B2 (en) 2005-05-04 2010-06-29 Zealand Pharma A/S Methods of treating chemotherapy-induced diarrhea/mucositis using glucagon-like-peptide-2(GLP-2)analogues

Non-Patent Citations (47)

* Cited by examiner, † Cited by third party
Title
"Abstracts of the 20th Anniversary International MASCC/ISOO Symposium", SUPPORTIVE CARE IN CANCER, SPRINGER-VERLAG, DE, vol. 15, no. 6, 30 May 2007 (2007-05-30), pages 651 - 797, XP019543565, ISSN: 1433-7339, DOI: 10.1007/S00520-007-0262-7 *
"Remington's Pharmaceutical Sciences", 1985, MARK PUBLISHING COMPANY
ARBUCKLE ET AL., THE ONCOLOGIST, vol. 5, 2000, pages 250 - 9
ARNOLD ET AL., J SUPPORT ONCOL, vol. 3, 2005, pages 227 - 232
BENJAMIN ET AL., GUT, vol. 47, 2000, pages 112 - 9
BENSON ET AL., J CLIN ONCOL, vol. 22, 2004, pages 2918 - 26
BENSON ET AL., J CLIN ONCOL, vol. 22, no. 14, 2004, pages 2918 - 2926
CHEESEMAN, AM J PHYSIOL., 1997, pages R1965 - 71
CHEN ET AL., CANCER, vol. 116, 2010, pages 1879 - 86
CHERNY, J PAIN SYMPTOM MANAGE, vol. 36, 2008, pages 413 - 23
CIRILLO ET AL., ANNALS OF ONCOLOGY, vol. 20, 2009, pages 1929 - 35
COMMON TERMINOLOGY CRITERIA FOR ADVERSE EVENTS (CTCAE, 28 May 2009 (2009-05-28), Retrieved from the Internet <URL:http://evs.nci.nih. sov/ftp 1/CTCAE/CTCAE 4.03 2010-06-14_QuickReference 8.5xll.pdf>
COMMON TERMINOLOGY CRITERIA FOR ADVERSE EVENTS (CTCAE, 28 May 2009 (2009-05-28), Retrieved from the Internet <URL:http://evs.nci.nih.gov/ftpl/CTCAE/CTCAE_4.03_2010-06-14_QuickReference 8.5xl I.pdf>
CONTI ET AL., J CLIN ONCOL, vol. 14, 1996, pages 709 - 15
CRENN ET AL., CLIN NUTR., vol. 27, no. 3, 2008, pages 328 - 339
DRUCKER ET AL., PROC NATL ACAD SCI USA., vol. 93, 1996, pages 7911 - 6
FLORES ET AL., GASTROINTEST CANCER RES, vol. 5, 2012, pages 119 - 24
GIBSON ET AL., J GASTROENTEROL HEPATOL., vol. 18, no. 9, September 2003 (2003-09-01), pages 1095 - 1100
GIBSON; STRINGER, CURR OPIN SUPPORT PALLIAT CARE, vol. 3, 2009, pages 31 - 35
GILMAN A. G. ET AL.: "The Pharmacological Basis of Therapeutics", vol. 12, 1990, pages: 1202 - 1263
GOLDBERG ET AL., J SUPPORT ONCOL, vol. 3, 2005, pages 227 - 32
GREM ET AL., J CLIN ONCOL, vol. 5, no. 10, 1987, pages 1704
GUAN ET AL., GASTROENTEROLOGY, vol. 125, 2003, pages 136 - 47
HERBERS ET AL., ANN ONCOL, vol. 21, no. 8, 2010, pages 1706 - 1711
KEEFE ET AL., GUT, vol. 47, 2000, pages 632 - 7
KEEFE, CURR OPIN ONCOL, vol. 19, 2007, pages 323 - 27
LEICHMAN ET AL., J CLIN ONCOL, vol. 13, 1995, pages 1303 - 1311
LEWIS; HEATON, SCAND J GASTROENTEROL., vol. 32, no. 9, 1997, pages 920 - 924
LOWELL, MASCC/ISOO INTERNATIONAL SYMPOSIUM ON SUPPORTIVE CANCER CARE, 2012
MAROUN ET AL., CURR ONCOL, vol. 14, 2007, pages 13 - 20
MUEHLBAUER ET AL., CLIN J ONCOL NURS, vol. 13, 2009, pages 336 - 41
OKEN ET AL.: "Toxicity And Response Criteria Of The Eastern Cooperative Oncology Group", AM J CLIN ONCOL, vol. 5, 1982, pages 649 - 655
PETRELLI ET AL., J CLIN ONCOL, vol. 5, no. 10, 1987, pages 1559 - 1565
PETRELLI ET AL., J CLIN ONCOL, vol. 7, no. 10, 1989, pages 1419 - 1426
RAPOPORT ET AL., J CLIN ONCOL, vol. 17, no. 8, 1999, pages 2446 - 2453
RICHARDSON; DOBISH, J ONCOL PHARM PRACTICE, vol. 13, 2007, pages 181 - 198
ROTHENBERG ET AL., CANCER, vol. 85, 1999, pages 786 - 95
RUBENSTEIN ET AL., CANCER, vol. 100, no. 9, 2004, pages 2026 - 2046
SALTZ LB: "Understanding and managing chemotherapy-induced diarrhea", J SUPPORT ONCOL, vol. 1, 2003, pages 35 - 46
SINCLAIR; DRUCKER, PHYSIOLOGY, 2005, pages 357 - 65
SINCLAIR; DRUCKER, PHYSIOLOGY, vol. 2005, pages 357 - 65
STEIN ALEXANDER ET AL: "Chemotherapy-induced diarrhea: pathophysiology, frequency and guideline-based management.", THERAPEUTIC ADVANCES IN MEDICAL ONCOLOGY JAN 2010, vol. 2, no. 1, January 2010 (2010-01-01), pages 51 - 63, XP009188366, ISSN: 1758-8359 *
STEIN ET AL., THER ADV MED ONCOL, vol. 2, 2010, pages 51 - 63
TAMAKI ET AL., J INT MED RES., vol. 31, no. 1, 2003, pages 6 - 16
TAVARES ET AL., AM. J. PHYSIOL. ENDOCRINOL. METAB., vol. 278, 2000, pages E134 - E139
TOURNIGAND ET AL., J CLIN ONCOL., vol. 22, 2004, pages 229 - 237
WOJDEMANN ET AL., J CLIN ENDOCRINOL METAB., vol. 84, 1999, pages 2513 - 7

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017046357A1 (en) * 2015-09-17 2017-03-23 Helsinn Healthcare Sa Therapeutic uses of elsiglutide
WO2018229252A1 (en) * 2017-06-16 2018-12-20 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
CN111032072A (zh) * 2017-06-16 2020-04-17 西兰制药公司 用于施用胰高血糖素样肽2(glp-2)类似物的剂量方案
EP3881861A1 (en) * 2017-06-16 2021-09-22 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
RU2785662C2 (ru) * 2017-06-16 2022-12-12 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)
RU2785662C9 (ru) * 2017-06-16 2023-05-10 Зилэнд Фарма А/С Схемы дозирования для введения аналогов глюкагоноподобного пептида 2 (гпп-2)
EP4424362A3 (en) * 2017-06-16 2024-11-27 Zealand Pharma A/S Dosage regimes for the administration of glucagon-like-peptide-2 (glp-2) analogues
US12297251B1 (en) 2017-06-16 2025-05-13 Zealand Pharma A/S Injection pen for subcutaneous administration of a peptide

Also Published As

Publication number Publication date
CA2959110A1 (en) 2016-03-17
TW201613634A (en) 2016-04-16
CL2017000563A1 (es) 2017-09-29
MA40623A (fr) 2016-03-17
EA201790552A1 (ru) 2017-08-31
US20160067311A1 (en) 2016-03-10
PH12017500426A1 (en) 2017-07-31
EP3191115A1 (en) 2017-07-19
BR112017004577A2 (pt) 2018-01-23
SG11201701690WA (en) 2017-04-27
IL250928A0 (en) 2017-04-30
JP2017532308A (ja) 2017-11-02
KR20170052661A (ko) 2017-05-12
CN107073081A (zh) 2017-08-18
AU2015313919A1 (en) 2017-03-16
MX2017003166A (es) 2017-06-19
AR103119A1 (es) 2017-04-19

Similar Documents

Publication Publication Date Title
US20160067311A1 (en) Use of elsiglutide to treat gastrointestinal mucositis including chemotherapy-induced diarrhea
US20160074390A1 (en) Human dosing of phosphatase inhibitor
US20140314676A1 (en) Methods of treatment with deferiprone
RU2603462C2 (ru) Лечение фармакологически индуцированной гипохлоргидрии
KR20170039096A (ko) 암의 치료에 있어서 에리불린의 용도
EP3113775A1 (en) Use of eribulin and mtor inhibitors as combination therapy for the treatment of cancer
Tanios et al. Emerging therapies for diabetic nephropathy patients: beyond blockade of the renin-angiotensin system
Dobbins et al. GSK256073 acutely regulates NEFA levels via HCA2 agonism but does not achieve durable glycaemic control in type 2 diabetes. A randomised trial
EP3549608A1 (en) Use of combination of vegfr inhibitor and parp inhibitor in preparation of medicament for treating gastric cancer
JP2022548214A (ja) ビルダグリプチンとメトホルミンとの組み合わせ療法
CA3166741A1 (en) Combination therapy for treating cancer
Vasiliki et al. The Pharmacological Profile of Cyclin-dependent Kinase (CDK) 4/6 Inhibitors: Clinical Management of Toxicity and Drug Interactions Related to CDK 4/6 Inhibitor-based Treatment in Advanced/Metastatic Breast Cancer.
US20230181529A1 (en) Panobinostat dosages for multiple myeloma
US20180177849A1 (en) Therapeutic Uses of Elsiglutide
Kim et al. A phase II study of pemetrexed and carboplatin as a salvage therapy for platinum-pretreated patients with non-small cell lung cancer
Xu et al. 177Lu-Dotatate versus high-dose long-acting octreotide for the treatment of patients with advanced, grade 1-2, well-differentiated gastroenteropancreatic neuroendocrine tumours (XT-XTR008-3-01): an open-label, randomised, phase III trial
Xu et al. CPL-01, an investigational long-acting ropivacaine, exhibits extended-release properties after mini-abdominoplasty
US9233103B2 (en) Methods for treating heartburn, gastric bleeding or hemorrhage in patients receiving clopidogrel therapy
EP3649132A1 (en) A peripherally-restricted dual-actingkappa
Park et al. Phase II trial of weekly docetaxel and gemcitabine for previously untreated, advanced non-small cell lung cancer
Koolen et al. Weekly oral docetaxel as solid dispersion (ModraDoc001 capsules) in combination with ritonavir is well tolerated and results in high exposure to docetaxel
Moennikes et al. T1263 Pantoprazole Treatment Reduces Non-GERD Symptoms in Patients Suffering from Erosive GERD, Functional Dyspepsia (FD), and/or Irritable Bowel Syndrome (IBS)
WO2017201226A1 (en) Combination therapies using indazolylbenzamide derivatives for the treatment of cancer
Laberge et al. Evaluation of the Effect of Food or Administration of a Proton Pump Inhibitor on the Single-Dose Plasma Pharmacokinetics of Cabozantinib in Healthy Adult Subjects

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15795220

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2959110

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 250928

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12017500426

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2017513522

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/003166

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015313919

Country of ref document: AU

Date of ref document: 20150902

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017004577

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 201790552

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201703346

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20177009656

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015795220

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015795220

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 112017004577

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170308