WO2015067715A2 - Gip-glp-1 dual agonist compounds and methods - Google Patents

Gip-glp-1 dual agonist compounds and methods Download PDF

Info

Publication number
WO2015067715A2
WO2015067715A2 PCT/EP2014/073970 EP2014073970W WO2015067715A2 WO 2015067715 A2 WO2015067715 A2 WO 2015067715A2 EP 2014073970 W EP2014073970 W EP 2014073970W WO 2015067715 A2 WO2015067715 A2 WO 2015067715A2
Authority
WO
WIPO (PCT)
Prior art keywords
peg3
aib
carboxy
isoglu
nonadecanoyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2014/073970
Other languages
French (fr)
Other versions
WO2015067715A3 (en
Inventor
Anne Pernille Tofteng SHELTON
Pia Nørregaard
Jacob Ulrik FOG
Carsten Boye Knudsen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zealand Pharma AS
Original Assignee
Zealand Pharma AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR112016009889-7A priority Critical patent/BR112016009889B1/en
Priority to EP14802336.9A priority patent/EP3065767B1/en
Priority to EA201690660A priority patent/EA035466B9/en
Priority to US15/034,778 priority patent/US10093713B2/en
Priority to CA2929459A priority patent/CA2929459C/en
Priority to MX2016005556A priority patent/MX2016005556A/en
Priority to CN201480060723.9A priority patent/CN105849122B/en
Priority to KR1020167014987A priority patent/KR102310389B1/en
Application filed by Zealand Pharma AS filed Critical Zealand Pharma AS
Priority to JP2016527453A priority patent/JP6682432B2/en
Priority to AU2014345569A priority patent/AU2014345569B2/en
Publication of WO2015067715A2 publication Critical patent/WO2015067715A2/en
Publication of WO2015067715A3 publication Critical patent/WO2015067715A3/en
Anticipated expiration legal-status Critical
Priority to US16/112,926 priority patent/US11008375B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/645Secretins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the invention relates to compounds having agonist activity at both the GIP and GLP- receptors, and to their use in the treatment of metabolic disorders.
  • CVD cardiovascular diseases
  • obstructive sleep apnea obstructive sleep apnea
  • stroke peripheral artery disease
  • microvascular complications CAD
  • osteoarthritis CAD
  • CVD cardiovascular diseases
  • Many have additional cardiovascular risk factors including high/aberrant LDL and triglycerides and low HDL.
  • Cardiovascular diseases account for about 50% of the mortality in people with diabetes, and the morbidity and mortality rates relating to obesity and diabetes underscore the medical need for efficacious treatment options.
  • Incretins are gastrointestinal hormones that regulate blood glucose by enhancing glucose- stimulated insulin secretion (Drucker, DJ and Nauck, MA, Lancet 368: 1696-705 (2006)). To date there are two known incretins: glucagon-like peptide-1 (GLP-1 ), and glucose-dependent insulinotropic polypeptide (GIP).
  • GLP-1 glucagon-like peptide-1
  • GIP glucose-dependent insulinotropic polypeptide
  • the incretin GLP-1 is derived from the pre-proglucagon gene.
  • Pre-proglucagon is a 158-amino acid precursor polypeptide that is processed in different tissues to form a number of different proglucagon-derived peptides, including glucagon, GLP-1 , glucagon-like peptide-2 (GLP-2) and oxyntomodulin (OXM).
  • Glucagon is a 29-amino acid peptide that corresponds to amino acids 33 through 61 of pre-proglucagon, while GLP-1 is produced as a 37-amino acid peptide that corresponds to amino acids 72 through 108 of pre-proglucagon.
  • GIP is a 42-amino acid peptide derived by proteolytic processing from a 133-amino acid precursor, pre-pro-GIP. All the peptides are involved in a wide variety of physiological functions, including glucose homeostasis, insulin secretion, gastric emptying, and intestinal growth, as well as the regulation of food intake.
  • GLP-1 receptor agonists protect pancreatic ⁇ -cells by inhibiting apoptosis and enhancing proliferation.
  • Farilla ei a/ showed that GLP-1 has anti-apoptotic effects in human islets (Farilla, L, Endocrinology 144: 5 49-58 (2003)). Such effects have not been reported for GIP until recently.
  • Weidenmaier et al. reported that a DPP-4 resistant GIP analogue had anti- apoptotic effects (Weidenmaier, SD, PLOS One 5(3): e9590 (2010)).
  • GIP GLP-1 receptor agonist
  • the present invention concerns acylated and truncated GIP analogues which comprise one or more substitutions as compared to wild-type GIP and which may have the property of an altered, preferably increased GLP-1 activity, e.g., as assessed in in vitro efficacy assays and an altered, preferably increased terminal elimination half-life (T1 ⁇ 2), as assessed in in vivo studies in mice.
  • GLP-1 activity e.g., as assessed in in vitro efficacy assays
  • T1 ⁇ 2 terminal elimination half-life
  • GIP-GLP1 dual acting receptor agonists are superior to existing and marketed GLP-1 analogues because the dual agonists offer improved glycemic control, and enhanced body weight loss.
  • the GIP-GLP1 dual agonists disclosed herein may thus be used as therapeutics for metabolic disorders including, but not limited to, type 2 diabetes mellitus, obesity and related disorders.
  • the invention provides a GIP analogue having the general Formula I:
  • R 1 is H, Ci-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
  • X2 is selected from Aib and D-Ala;
  • X10 is selected from Tyr and Leu;
  • X13 is selected from Ala, Tyr and Aib;
  • X15 is selected from Asp and Glu
  • X16 is selected from Glu and Lys
  • X19 is selected from Gin and Ala
  • X20 is selected from Lys and Arg;
  • X21 is selected from Ala and Glu
  • X23 is selected from Val and lie
  • X24 is selected from Asn and Glu
  • X27 is selected from Leu, Glu and Val
  • X28 is selected from Ala, Ser and Arg;
  • X29 is selected from Aib, Ala, and Gin;
  • X30 is selected from Lys, Gly and Y1 , or is absent;
  • Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
  • is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z 1 or -Z 2 -Z 1 ;
  • -Z 1 is a fatty chain having a polar group at one end of the chain and a connection to ⁇ or Z 2 , -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S0 2 -;
  • -Z 2 - (if present) is a spacer of formula: -Y-V-X- n connecting Z 1 to ⁇ ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z 2 ; each X is independently a bond, CO- SO- or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
  • R 2 is -NH2 or -OH
  • the invention also provides a GIP analogue having the general Formula lb:
  • R 1 is H, C1-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
  • X2 is selected from Aib and D-Ala;
  • X10 is selected from Tyr and Leu;
  • X13 is selected from Ala, Tyr and Aib;
  • X15 is selected from Asp and Glu
  • X16 is selected from Glu and Lys
  • X19 is selected from Gin and Ala
  • X20 is selected from Lys and Arg;
  • X21 is selected from Ala and Glu
  • X23 is selected from Val and lie
  • X24 is selected from Asn and Glu
  • X27 is selected from Leu, Glu and Val
  • X28 is selected from Ala, Ser and Arg;
  • X29 is selected from Aib, Ala, Glu and Gin;
  • X30 is selected from Lys, Gly and Y1 , or is absent;
  • Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
  • is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z 1 or -Z 2 -Z 1 ;
  • -Z 1 is a fatty chain having a polar group at one end of the chain and a connection to ⁇ or Z 2 , -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -SO2-;
  • each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z 2 ;
  • each X is independently a bond, CO- SO-, or S0 2 -; with the proviso that when Y is -S, the X to which it is bound is a bond;
  • each V is independently a bivalent organic moiety linking Y and X; and n is 1-10;
  • R 2 is -NHzor -OH
  • the invention further provides a GIP analogue having the general Formula II: R 1 -Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-lle-X13-Leu-X1 S-Glu-M ⁇ -Ala-Ala-Arg ⁇ I -
  • R 1 is H, Ci-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
  • X2 is selected from Aib and D-Ala;
  • X13 s selected from Ala, Tyr;
  • X15 s selected from Asp and Glu
  • X21 s selected from Ala and Glu
  • X24 s selected from Asn and Glu
  • X28 s selected from Ala, Ser;
  • X29 s selected from Ala, Glu and Gin.
  • X30 s selected from Lys, Gly and Y1 , or is absent;
  • Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
  • is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z or -Z 2 -Z 1 ;
  • -Z is a fatty chain having a polar group at one end of the chain and a connection to ⁇ or Z 2 , -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S0 2 -;
  • each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z 2 ;
  • each X is independently a bond, CO- SO-, or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond;
  • each V is independently a bivalent organic moiety linking Y and X; and n is 1-10;
  • R 2 is -NH 2 or -OH
  • positions 1 to 29 of the GIP analogue have a maximum of 8 changes (within the constraints of Formula I) compared to the sequence:
  • positions 1 to 29 of the GIP analogue may possess all of Ala19, Lys20 and Glu21. They may also possess one or both of Ser28 and Ala29.
  • positions 1 to 29 typically have 4 or fewer changes compared to that sequence.
  • positions 1 to 29 of the GIP analogue have a maximum of 6 changes (within the constraints of Formula I) compared to the sequence
  • Aib2 Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; Aib2, Leu10, Aia13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; Aib2, Tyr10, Tyr13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Arg28, Ala29; Aib2, Leu10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Val27, Ala28 Aib29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Val27,
  • Aib2 Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; D-Ala2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
  • Aib2 Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Leu27, Ala28, Aib29; Aib2, Tyr10, Ala13, Asp15, Glu16, Ala19, Lys20, Glu21 , Ile23, Glu24, Glu27, Ser28, Ala29;
  • Aib2 Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29; Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29.
  • Residues 1-29 of Formula I may have the sequence: Y-Aib-EGTFTSDYSIYLDKTAQRAFVEWLLAQ;
  • Residues 1 -29 of Formula I may have the sequence:
  • the peptide backbone of Formula ! may have the sequence:
  • the peptide backbone of Formula I may have the sequence:
  • the peptide backbone of Formula I may have the sequence:
  • Certain of the Y1 groups when present, may provide increased stability in vivo, e.g. in serum, and so may contribute to the half life of the GIP analogue. Without wishing to be bound by theory, it is believed that these groups may help to stabilize the three dimensional
  • the Y1 sequences Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser- Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro- Ser have homology with a C-terminal portion of the Exendin-4 molecule and appear to contribute to the stability of the molecule without concomitantly providing significant levels of GLP-1 agonist activity.
  • the invention further provides a pharmaceutical composition
  • a pharmaceutical composition comprising a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, in admixture with a carrier, preferably a pharmaceutically acceptable carrier.
  • a carrier preferably a pharmaceutically acceptable carrier.
  • the GIP analogue may.for example, be a pharmaceutically acceptable acid addition salt.
  • the pharmaceutical composition may be formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of said GIP analogue.
  • the invention further provides a therapeutic kit comprising a GIP analogue as descibed herein, and a device comprising a GIP analogue as described herein.
  • the invention further provides a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, for use in a method of medical treatment, e.g. for use in the treatment and/or prevention of a metabolic disorder.
  • the invention further provides the use of a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, in the preparation of a medicament for the treatment and/or prevention of a metabolic disorder.
  • the invention further provides a method of prevention and or/treatment of a metabolic disorder in a subject, comprising administering a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, to the subject.
  • the metabolic disorder may be diabetes or a diabetes related disorder, or obesity or an obesity related disorder.
  • diabetes or a diabetes related disorder, or obesity or an obesity related disorder.
  • the link between obesity and diabetes is well known, so these conditions are not necessarily separate or mutually exclusive.
  • Diabetes related disorders include insulin resistance, glucose intolerance, increased fasting glucose, pre-diabetes, type 1 diabetes, type 2 diabetes, gestational diabetes hypertension, dyslipidemia, and combinations thereof.
  • Diabetes related disorders also include atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease and stroke; or conditions associated with atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, bone related disorders and a proinflammatory state.
  • Bone related disorders include, but are not limited to, osteoporosis and increased risk of bone fracture.
  • the blood fat disorder may be selected from high triglycerides, low HDL cholesterol, high LDL cholesterol, and plaque buildup in artery walls, or a combination thereof.
  • the prothrombotic state may be selected from high fibrinogen levels in the blood and high plasminogen activator inhibitor-1 levels in the blood.
  • the proinflammatory state may be an elevated C-reactive protein level in the blood.
  • Obesity related disorders include obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or may be associated with a condition selected from atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, and a proinflammatory state, or a combination thereof.
  • FIG. 1 Blood glucose levels (A, B) and area under the blood glucose curves (AUC) (C) in an IPGTT in 5-hour fasted diabetic db/db mice. The mice were injected s.c. with vehicle or GIP-GLP-1 dual acting receptor agonists (0.5 and 5 nmol/kg) 22 hours prior to the i.p.
  • patient may be used interchangeably and refer to either a human or a non-human animal. These terms include mammals such as humans, primates, livestock animals (e.g., bovines, porcines), companion animals (e.g., canines, felines) and rodents (e.g., mice and rats).
  • livestock animals e.g., bovines, porcines
  • companion animals e.g., canines, felines
  • rodents e.g., mice and rats.
  • solvate in the context of the present invention refers to a complex of defined stoichiometry formed between a solute (in casu, a peptide conjugate or pharmaceutically acceptable salt thereof according to the invention) and a solvent.
  • the solvent in this connection may, for example, be water, ethanol or another pharmaceutically acceptable, typically small-molecular organic species, such as, but not limited to, acetic acid or lactic acid.
  • a solvate is normally referred to as a hydrate.
  • agonist as employed in the context of the invention refers to a substance (ligand) that activates the receptor type in question.
  • GIP-GLP 1 dual receptor agonist as employed in the context of the invention refers to a substance (ligand) that activates both the GIP receptor and the GLP-1 receptor.
  • R groups are possible at the N-terminus, including pyroglutamic acid (pGlu; (S)-(-)-2- pyrrolidone-5-carboxylic acid), Ci- 4 alkyl, acetyl, formyl, benzoyl and trifluoroacetyl.
  • pGlu pyroglutamic acid
  • S S-(-)-2- pyrrolidone-5-carboxylic acid
  • Ci- 4 alkyl acetyl, formyl, benzoyl and trifluoroacetyl.
  • the compounds described herein are GIP-GLP 1 dual receptor agonists. That is to say, they have agonist activity at both the GIP receptor and the GLP-1 receptor.
  • agonist refers to a substance (ligand) that is capable of binding to a particular receptor and activating signaling by that
  • GIP receptor agonist is capable of binding to the GIP receptor (designated GIP-R) and activating signaling by that receptor, e.g. by generation of cAMP or inducing Ca 2+ release.
  • Agonist activity at the GIP receptor may therefore be measured by assessing GIP receptor signalling, which may, for example, be measured via cAMP production or Ca 2+ release.
  • the cDNA sequence encoding the human GIP receptor has GenBank accession no.
  • the compounds have agonist activity at the GLP-1 receptor (GLP-1 -R), i.e. they are capable of binding to the GLP-1 receptor and activating signaling by that receptor, e.g. by generation of cAMP or inducing Ca 2+ release.
  • Agonist activity at the GLP-1 receptor may therefore be measured by assessing GLP-1 receptor signalling, which may, for example, be measured via cAMP production or Ca 2+ release.
  • the GLP-1 receptor may have the sequence of the human glucagon-like peptide 1 receptor (GLP-1 R) having primary accession number P43220.
  • the precursor protein (including signal peptide) has primary accession number NP_002053.3; Gl:166795283 and has sequence:
  • This may be employed in any assays to determine GIP signalling.
  • the compounds of the present invention have at least one GIP and one GLP-1 biological activity, in particular in treatment of metabolic diseases such as diabetes and obesity. This can be assessed, e.g., in in vivo assays, for example as described in the examples, in which the blood glucose level or another biological activity is determined after a test animal has been treated or exposed to a GIP analogue.
  • compounds of the invention may be capable of improving glycaemic control when adminstered to a diabetic subject. Additionally or alternatively, they may be capable of reducing body weight when administered to an overweight or obese subject.
  • the effect may be superior to that obtained with an equivalent quantity (by mass, or molar ratio) of wild type human GIP or GLP-1 in comparable subjects when given according to a comparable dosing regime.
  • Activity in in vitro assays may also be used as a measure of the compounds' activity.
  • EC 5 o values may be used as a numerical measure of agonist potency at a given receptor.
  • An EC50 value is a measure of the concentration of a compound required to achieve half of that compound's maximal activity in a particular assay.
  • a compound having EC50 [GLP-1 R] lower than the EC50 [GLP-1 R] of native GIP in a particular assay may be considered to have higher potency at the GLP-1 R than GIP.
  • the EC50 GLP-1 -R and/or EC50 GIP-R is below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, below 0.005 nM, or below 0.004 nM, e.g.
  • the EC50 value of a compound in a given assay may be assessed relative to the EC50 of human GIP.
  • the ratio of the EC50 value of the test compound to the EC50 value of wild type human GIP (ECso[test compound] / EC5o[GIP]) at the human GIP receptor may be less than 10, less than 5, less than 1 , less than 0.1 , less than 0.05 or less than 0.01.
  • the ratio of the EC50 value of the test compound to the EC50 value of wild type human GIP (ECso[test compound] / EC 5 o[GIP]) at the GLP-1 receptor may be less than 10, less than 5, less than 1 , less than 0.1 , less than 0.05 or less than 0.01. It may also be desirable to compare the ratio of EC50 values at the two receptors for the test compound and for human GIP.
  • the test compound has an EC 5 o[GIP] / EC 5 o[GLP-1] which is greater than the equivalent ratio for GIP in the same assays. Lipophilic group
  • the compound of the invention comprises a residue ⁇ , i.e. a residue selected from Lys, Arg, Orn and Cys in which the side chain is conjugated to a substituent -Z 2 -Z 1 - as decribed in more detail below.
  • the substituent binds plasma proteins (e.g. albumin) in the blood stream, thus shielding the compounds of the invention from enzymatic degradation and renal clearance and thereby enhancing the half-life of the compounds. It may also modulate the potency of the compound, e.g. with respect to the GIP receptor and/or the GLP-1 receptor.
  • the substituent is conjugated to the functional group at the distal end of the side chain from the alpha-carbon.
  • the normal ability of the Lys, Arg, Orn or Cys side chain to participate in interactions mediated by that functional group may therefore be reduced or completely eliminated by the presence of the substituent.
  • the overall properties of the compound may be relatively insensitive to changes in the actual amino acid present as residue ⁇ . Consequently, it is believed that any of the residues Lys, Arg, Orn and Cys may be present at any position where ⁇ is permitted.
  • it may be advantageous that the amino acid component of ⁇ is Lys.
  • is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z 1 or -Z 2 -Z 1 ;
  • -Z 1 is a fatty chain having a polar group at one end of the chain and a connection to ⁇ or Z 2 , -X-, at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S02-;
  • each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z 2 ;
  • each X is independently a bond, CO-, SO-, or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond;
  • each V is independently a bivalent organic moiety linking Y and X; and n is 1-10;
  • Z 1 is a fatty chain having a connection to ⁇ or to Z 2 , referred to herein as -X- and, at the end of the chain distal from the connection to Z 2 , a polar group.
  • -X- may be, for example, a bond, acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-), the connection being located at the co- position with respect to the polar group, that is, at the end of the chain distal from the polar group.
  • -X- is acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-).
  • -X- is acyl (-CO-).
  • the polar group is an acidic or weakly acid group, for example a carboxylic acid or a carboxylic acid bioisostere, a phosphonate, or a sulfonate.
  • the polar group may have a Ka of between -2 and 12 in water, more preferably between 1 and 7, more preferably between 3 and 6.
  • Certain preferred polar groups have a pKa of between 4 and 5.
  • the polar group preferably comprises a carboxylic acid or carboxylic acid bioisostere.
  • Suitable carboxylic acid bioisosteres are known in the art.
  • the bioisostere has a proton having a pKa similar to the corresponding carboxylic acid.
  • suitable bioisoteres may include, not by way of limitation, tetrazole, acylsulfomides,
  • the polar group may be a group of formula A-B-, wherein A is a carboxylic acid (-COOH) or a carboxylic acid bioisostere, a phosphonic acid (-P(0)(OH)2), or a sulfonic acid (-SO2OH) group, and B is a bond or linker between A and the fatty chain.
  • the polar group is -COOH, that is, A is -COOH and B is a bond.
  • B is a linker, it may be a cycloalkylene, heterocycloalkylene, Cearylene, or
  • B When B is phenylene it may, for example, be selected from 1 ,2-phenylene, 1 ,3-phenylene, 1 ,4-phenylene, preferably 1 ,4-phenylene (so that A-B- is a 4-benzoic acid substituent or 4-benzoic acid bioisostere).
  • B When B is phenylene-O- it may, for example, be selected from 1 ,2-phenylene-O-, 1 ,3-phenylene-O- 1 ,4-phenylene-O- preferably 1 ,4-phenylene-O.
  • Each phenylene of B may be optionally substituted with one or more substituents selected from fluoro, methyl, trifluoromethyl, amino, hydroxyl, and Ci-4alkoxy, preferably methoxy. It will be appreciated that substituent identity and position may be selected to subtly alter the pKa of the polar group. Suitable inductively or mesomerically electron-withdrawing or donating groups and their positional effects are known in the art.
  • B may be Cs-eheteroarylene, for example, pyridinylene or thiofuranylene, and may be optionally substituted as described.
  • A-B- may be selected from:
  • A is -COOH.
  • A is a carboxylic acid and B is C6arylene-0-
  • Fatty chain refers to a moiety comprising a chain of carbon atoms, the carbon atoms being predominantly substituted with hydrogen or hydrogen-like atoms, for example, a hydrocarbon chain.
  • Such fatty chains are often referred to as lipophilic, although it will be appreciated that substitution may alter the lipophilic properties of the overall molecule.
  • the fatty chain may by aliphatic. It may be entirely saturated or may include one or more double or triple bonds. Each double bond, if present, may be in the E or Z configuration.
  • the fatty chain may also have one or more cycloalkylene or heterocycloalkylene moieties in its length, and additionally or alternatively may have one or more arylene or heteroarylene moieties in its length.
  • the fatty chain may incorporate a phenylene or piperazinylene moiety in its length as, for example, shown below (wherein— represents the points of attachment within the chain).
  • the fatty chain may be derived from a fatty acid, for example, it may be derived from a medium-chain fatty acid (MCFA) with an aliphatic tail of 6-12 carbon atoms, a long-chain fatty acid (LCFA) with an aliphatic tail of 13-21 carbon atoms, or a very long-chain fatty acid (LCFA) with an aliphatic tail of 22 carbon atoms or more.
  • MCFA medium-chain fatty acid
  • LCFA long-chain fatty acid
  • LCFA very long-chain fatty acid
  • linear saturated fatty acids from which suitable fatty chains may be derived include tridecylic (tridecanoic) acid, myristic (tetradecanoic) acid, pentadecylic (pentadecanoic) acid, palmitic (hexadecanoic) acid, margaric (heptadecanoic) acid, and arachidic (eicosanoic) acid.
  • linear unsaturated fatty acids from which suitable fatty chains may be derived include myristoleic acid, palmitoleic acid, sapienic acid and oleic acid.
  • the fatty chain may be connected to ⁇ or to Z 2 by an amide linkage, a sulfinamide linkage, a sulfonamide linkage, or by an ester linkage, or by an ether, thioether or amine linkage. Accordingly, the fatty chain may have at the ⁇ position, that is, the position distal to the polar group, a bond to Z 2 or an acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-) group.
  • the fatty chain has an acyl (-CO-) group at the position distal to the polar group and is connected to Z 2 by an amide or ester linkage.
  • Z 1 is a group of formula:
  • A-B-Alk-X- where A-B- is the polar group defined above, X is a bond, acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-), and Alk is a fatty chain that may be optionally substituted with one or more substituents.
  • the fatty chain is preferably 16 to 28 carbon atoms in length (e.g. a
  • Ci6-28alkylene more preferably, 16 to 26 carbons in length (e.g. a Ci6-26alkylene), more preferably, 16 to 22 carbons in length (e.g. Ci6-alkylene), and may be saturated or
  • Alk is saturated, that is, preferably Alk is alkylene.
  • Z 1 is an acyl group of formula:
  • Optional substituents on the fatty chain may be independently selected from fluoro, Ci-4alkyl, preferably methyl; trifluoromethyl, hydroxymethyl, amino, hydroxyl, preferably methoxy; oxo, and carboxyl, and may be independently located at any point along the chain.
  • each optional substituent is selected from fluoro, methyl, and hydroxyl. Where more than one substituent is present, substituents may be the same or different.
  • the number of substituents is 0 to 3; more preferably the fatty chain is unsubstituted.
  • Z 1 is an acyl group of formula: A-B-alkylene-(CO)- where A and B are as defined above.
  • Z 1 is:
  • Z 1 are derived from long-chain saturated ⁇ , ⁇ -dicarboxylic acids of formula HOOC-(CH 2 )i2-22-COOH, preferably, long-chain saturated ⁇ , ⁇ -dicarboxylic acids having an even number of carbon atoms in the aliphatic chain .
  • Z 1 may be:
  • the carboxylic acid group may be replaced by a bioisotere as detailed herein.
  • Z 2 is an optional spacer that connects Z 1 to the side chain of the amino acid component of ⁇ .
  • Z 2 if present, is a spacer bound at one terminus by Y, which may be a nitrogen, oxygen or sulfur atom, and at the other terminus by X, which may be a bond or an acyl (-CO-), sulfinyl (-SO-), sulfonyl (-S0 2 -)or absent.
  • Z 2 may be a spacer of formula (— indicate points of attachment):
  • Y may be -NH, -NR, -S or -O, where R may be alkyl, a protecting group or may form a linkage to another part of the spacer, with the remaining valency forming a linkage to Z 1 ;
  • X may be a bond, CO- SO- or S0 2 - with the remaining valency forming a linkage to the side chain of the amino acid component of ⁇ ;
  • V is a bivalent organic moiety linking Y and X; and n may be 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10. Where n is 2 or more, each Y, V, and X is independent of every other Y, V, and X.
  • Z 2 may be bound at each side by amide, sulfinamide, sulfonamide, or ester linkages or by amino, ether, or thioether linkages depending upon the nature of Y and X and the corresponding linking groups on Z and the side chain.
  • each V may also be bound to each adjacent V by linkages as described.
  • linkages are amides, esters or sulfonamides, most preferably amides.
  • each Y is -NH or -NR and each X is CO- or S0 2 -.
  • Z 2 is a spacer of formula or -SB-SA-, wherein SA and SB are as defined below.
  • Z 2 is selected from -SA-, -SB-, or -SB-SA-, that is, [side chain]-Z 2 Z 1 is [side chain]-SA-Z 1 , [side chain]-SB-Z 1 or [side chain]-S B -SA-Z 1 .
  • the group SA is the group SA
  • SA may be a single amino acid residue or a residue of an amino acid derivative, especially an amino acid derivative residue having a sulfinyl or sulfonyl in place of the carboxy moiety at the C terminus. Additionally or alternatively, the single amino acid residue may have an oxygen or sulfur atom in place of the nitrogen atom at the N terminus.
  • SA may comprise a nitrogen-containing heterocycle, said nitrogen-containing heterocycle being bound within the lipophilic group at one end via a bond, a carboxy, a sulfinyl, or a sulfonyl group, and at the other via a ring nitrogen atom.
  • SA may comprise a piperazine ring.
  • SA is a 5-8-membered heterocycle having 1 or 2 nitrogen atoms and substituted with an -X or an -L-X group, where X is a bond, CO-, SO-, or SO2-, and where L, if present, is Ci-4alkylene (- denotes a point of attachment within the lipophilic group).
  • SA is a 6-membered heterocycle having 1 or 2 nitrogen atoms, preferably 2, and substituted with a -CH 2 CO- -CH 2 SO- or -CH2SO2- group.
  • SA may be:
  • SA may be:
  • SA is a single amino acid residue or piperazine-1 -yl-acetyl. More preferably SA is a single amino acid residue
  • the amino acid may be selected from ⁇ - Glu, a-Glu, a-Asp, ⁇ -Asp, Ala, Dapa (2,3-diaminopropionic acid), or Dab (2,4- diaminobutanoic). It will be understood that where more than one carboxylic acid or amino moiety is present, connection may be at any moiety as appropriate. Any carboxylic acid or amino resides not bound within the residue may be free, that is, present as a free carboxylic acid or primary amine, or may be derivatised.
  • Suitable derivatisation is known in the art.
  • carboxylic acid moieties may be present in SA amino acid residues as esters, for example, as methyl esters.
  • Amino moieties may be present as alkylated amines, for example, methylated, or may be protected as amide or carbamate moieties.
  • Other suitable amino acids include ⁇ -Ala (3-aminopropanoic acid) and Gaba (4-aminobutanoic acid) and similar ⁇ amino acids.
  • amino acids may be D or L, or a racemic or enantioenriched mixture.
  • the amino acid is an L-amino acid.
  • the amino acid is a D-amino acid.
  • SA has a carboxylic acid substituent, with ⁇ -Glu, a-Glu, a- Asp, and ⁇ -Asp, and sulfinyl and sulfonyl derivatives thereof, being preferred. Accordingly, in some embodiments, the amino acid residue is:
  • -X- is -CO- -SO-, -SO2-, preferably -CO-, and a is 1 or 2, preferably 2.
  • the carboxylic acid is an ester, and the amino acid residue is:
  • R is Ci- 4 alkyl or Cearyl.
  • R is Ci- 4 alkyl, preferably methyl or ethyl, more preferably ethyl.
  • a preferred SA group bearing a carboxylic acid is ⁇ -Glu.
  • SA is selected from Dapa or ⁇ -Glu.
  • SA is ⁇ -Glu.
  • SB may be a linker of general formula:
  • each polymeric unit Pu may be bound at each side by amide, sulfinamide, sulfonamide, or ester linkages or by amino, ether, or thioether linkages depending upon the nature of Y and X and the corresponding linking groups on Z SA, and Lys.
  • each Pu may be independently a unit of formula:
  • Y may be -NH, -NR, -S or -O, wherein R may be alkyl, a protecting group or may form a linkage to another part of the spacer, with the remaining valency forming a linkage to Z ;
  • X may be a bond, CO-, SO-, or SO2-, with the remaining valency forming a linkage to Lys; and V is a bivalent organic moiety linking Y and X.
  • V is the a-carbon of a natural or unnatural amino acid, that is V is - CHR AA - wherein R AA is an amino acid side chain; or V is an optionally substituted
  • Ci- 6 alkylene, or V is a chain comprising one or more units of ethylene glycol in series, also known as PEG chain, for example, -CH2CH2-(OCH 2 CH2)m-0-(CH2) P - where m is 0, 1 , 2, 3, 4, or 5, and p is 1 , 2, 3, 4, or 5; when X is CO-, p is preferably 1 , 3, 4, or 5.
  • Optional alkylene substituents include fluoro, methyl, hydroxy, hydroxymethy, and amino.
  • Preferred Pu units include: (i) . Single amino acid residues: Pu' ;
  • Amino-(PEG)m-carboxylic acid residues Pu"', and may be present in any combination or order.
  • SB may comprise one or more of each of Pu', Pu", and Pu'" in any order, or may comprise one or more units of Pu', Pu", and Pu"' only, or one of more units selected from Pu' and Pu", Pu' and Pu"', or Pu" and Pu"'.
  • Each Pu' may be independently selected from any natural or unnatural amino acid residue and, for example, may be selected from Gly, Pro, Ala, Val, Leu, lie, Met, Cys, Phe, Tyr, Trp, His, Lys, Arg, Gin, Asn, a-Glu, ⁇ -Glu, Asp, Ser Thr, Dapa, Gaba, Aib, ⁇ -Ala, 5- aminopentanoyl, 6-aminohexanoyl, 7-aminoheptanoyl, 8-aminooctanoyl, 9-aminononanoyl, and 10-aminodecanoyl.
  • Pu' amino acid residues are selected from Gly, Ser, Ala, Thr, and Cys, more preferably from Gly and Ser.
  • SB is -(Pu')n-, wherein n is 1 to 8, more preferably 5 to 7, most preferably 6.
  • S B is -(Pu%- n is 6 and each Pu' is independently selected from Gly or Ser, with a preferred sequence being -Gly-Ser-Gly-Ser- Gly-Gly-.
  • Each Pu may be independently selected from any dipeptide residue comprising two natural or unnatural amino acid residues bound by an amide linkage.
  • Preferred Pu" dipeptide residues include Gly-Gly, Gly-Ser, Ser-Gly, Gly-Ala, Ala-Gly, and Ala-Ala, more preferably Gly-Ser and Gly-Gly.
  • SB is -(Pu'%-, wherein n is 2 to 4, more preferably 3, and each Pu" is independently selected from Gly-Ser and Gly-Gly.
  • S B is - ( ⁇ ") ⁇ -, n is 3 and each Pu" is independently selected from Gly-Ser and Gly-Gly, with a preferred sequence being -(Gly-Ser)-(Gly-Ser)-(Gly-Gly).
  • Amino acids having stereogenic centres within Pu' and Pu" may be racemic, enantioenriched, or enantiopure.
  • the or each amino acid is independently an L-amino acid.
  • the or each amino acid is independently a D-amino acid.
  • Each Pu'" may be independently a residue of general formula: wherein m is 0, 1 , 2, 3, 4, or 5, preferably 1 , 2, 3, or 4, more preferably 1 or 2, and p is 1 , 2, 3, 4 or 5, e.g. 1 , 3, 4, or 5, preferably 1 .
  • m is 1 and p is 1 , that is, Pu"' is a residue of 8-amino-3,6- dioxaoctanoic acid (also known as ⁇ 2-[2-aminoethoxy]ethoxy ⁇ acetic acid and H2N-PEG 3 - COOH). This residue is referred to herein as -PEG 3 -.
  • m is 5 and p is 2, that is, Pu'" is a residue of 2-[2-[2-[2-[2- [2- (2- aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid (also known as H2N-PEG6- COOH). This residue is referred to herein as -PEG 6 -.
  • m is 2 and p is 1 , that is, Pu in is a residue of 11-amino-3,6,9- trioxaundecanoic acid (also known as H2N-PEG4-COOH). This residue is referred to herein
  • SB is -( ⁇ "') ⁇ -, wherein n is 1 to 3, more preferably 2.
  • S B is selected from -PEG3-PEG3- and -PEG3-PEG3- PEG3-. Most preferably, S B is -PEG3-PEG3-.
  • the GIP analogue compounds employed in the context of the invention may provide an attractive treatment option for metabolic diseases including obesity, diabetes mellitus
  • Diabetes comprises a group of metabolic diseases characterized by hyperglycemia resulting from defects in insulin secretion, insulin action, or both. Diabetes is classified into type 1 diabetes, type 2 diabetes and gestational diabetes on the basis on pathogenic characteristics. Type 1 diabetes accounts for 5-10% of all diabetes cases and is caused by auto-immune destruction of insulin-secreting pancreatic ⁇ -cells. Acute signs of diabetes include excessive urine production, resulting compensatory thirst and increased fluid intake, blurred vision, unexplained weight loss, lethargy, and changes in energy metabolism. However, in type 2 diabetes symptoms are often not severe or may be absent.
  • Type 2 diabetes accounts for 90-95% of diabetes cases and is a result of a complex set of metabolic disorders. However, symptoms are often not severe or may be absent. Type 2 diabetes is the consequence of endogenous insulin production becoming insufficient to maintain plasma glucose levels below diagnostic thresholds. Gestational diabetes refers to any degree of glucose intolerance identified during pregnancy.
  • Pre-diabetes includes impaired fasting glucose and impaired glucose tolerance and refers to those states that occur when blood glucose levels are elevated but below the levels that are established for the clinical diagnosis for diabetes.
  • a large proportion of people with type 2 diabetes and pre-diabetes are at increased risk of morbidity and mortality due to the high prevalence of additional metabolic risk factors, including abdominal obesity (excessive fat tissue around the abdominal internal organs), atherogenic dyslipidemia (blood fat disorders including high triglycerides, low HDL cholesterol and/or high LDL cholesterol, which foster plaque buildup in artery walls), elevated blood pressure (hypertension) a prothrombotic state (e.g. high fibrinogen or plasminogen activator inhibitor- 1 in the blood), and/or a proinflammatory state (e.g., elevated C-reactive protein in the blood).
  • abdominal obesity excessive fat tissue around the abdominal internal organs
  • atherogenic dyslipidemia blood fat disorders including high triglycerides, low HDL cholesterol and/or high LDL cholesterol, which foster plaque buildup in artery walls
  • elevated blood pressure hypertension
  • a prothrombotic state e.g. high fibrinogen or plasminogen activator inhibitor- 1 in the blood
  • Dyslipidemia is associated with increased risk of cardiovascular disease.
  • High Density Lipoprotein (HDL) is of clinical importance since an inverse correlation exists between plasma HDL concentrations and risk of atherosclerotic disease.
  • the majority of cholesterol stored in atherosclerotic plaques originates from LDL and hence an elevated concentration of Low
  • LDL Density Lipoproteins
  • GIP-GLP1 dual agonists act as GIP-GLP1 dual agonists.
  • the dual agonist may combine the effect of GIP, e.g., on fat metabolism and weight loss, and blood glucose, with the effect of GLP-1 , e.g., on blood glucose levels and food intake. They may therefore act to accelerate elimination of excessive adipose tissue, induce sustainable weight loss, and improve glycemic control.
  • Dual GIP-GLP1 agonists may also act to reduce cardiovascular risk factors such as high cholesterol, such as high LDL-cholesterol.
  • the GIP-GLP1 dual agonist compounds of the present invention may therefore be used (alone or in combination) as pharmaceutical agents for preventing weight gain, promoting weight loss, reducing excess body weight or treating obesity (e.g., by control of appetite, feeding, food intake, calorie intake, and/or energy expenditure and lipolysis), including morbid obesity, as well as associated diseases and health conditions including but not limited to obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea.
  • the GIP-GLP1 dual agonist compounds employed in the context of the invention may also be used for treatment of insulin resistance, glucose intolerance, pre-diabetes, increased fasting glucose, type 2 diabetes, hypertension, dyslipidemia (or a combination of these metabolic risk factors), atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease and stroke. These are all conditions which may be associated with obesity. However, the effects of the compounds employed in the context of the invention on these conditions may be mediated in whole or in part via an effect on body weight, or may be independent thereof.
  • the GIP-GLP1 dual agonist compounds may thus be used (alone or in combination) for the treatment and/or prevention of any of the diseases, disorders, or conditions described herein, including insulin resistance, glucose intolerance, increased fasting glucose, pre-diabetes, type 1 diabetes, type 2 diabetes, gestational diabetes hypertension, dyslipidemia, or a combination thereof.
  • the diabetes related disorder is selected from
  • the blood fat disorder is selected from high triglycerides, low HDL cholesterol, high LDL cholesterol, plaque buildup in artery walls, or a combination thereof.
  • the prothrombotic state is selected from high fibrinogen levels in the blood and high plasminogen activator inhibitor-1 levels in the blood.
  • the proinflammatory state is an elevated C-reactive protein level in the blood.
  • the obesity related disorder is selected from obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea.
  • the GIP-GLP1 dual agonist compounds may also be used for the treatment and/or prevention of any of the diseases, disorders, or conditions associated with diabetes related osteoporosis including increased risk of bone fractures.
  • the observed increase in fracture risk is likely to be related to impaired bone quality rather than to bone mineral density.
  • the related mechanisms due at least in part to hyperglycemia, neuropathy, and higher incidence of hypovitaminosis D, are not yet fully understood.
  • the invention provides the use of a GIP-GLP1 dual agonist compound as described, in the manufacture of a medicament for any of the clinical applications described in this
  • the invention also provides a therapeutic kit comprising a GIP analogue of the invention, optionally in combination with a pharmaceutically acceptable carrier.
  • the invention provides a device comprising a GIP analogue of the invention for delivery of the GIP analogue to a subject.
  • the GIP-GLP1 dual agonist compounds of the present invention, or salts or solvates thereof, may be formulated as pharmaceutical compositions prepared for storage or administration, which typically comprise a therapeutically effective amount of a compound employed in the context of the invention, or a salt or solvate thereof, in a pharmaceutically acceptable carrier.
  • the pharmaceutical composition is formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of the GIP-GLP1 dual agonist compound.
  • the therapeutically effective amount of a compound of the present invention will depend, e.g., on the route of administration, the type of mammal being treated, and the physical characteristics of the specific mammal under consideration.
  • This amount and the method of administration can be tailored to achieve optimal efficacy, and may depend on such factors as weight, diet, concurrent medication and other factors, well known to those skilled in the medical arts.
  • the dosage sizes and dosing regimen most appropriate for human use may be guided by the results obtained by the present invention, and may be confirmed in properly designed clinical trials.
  • An effective dosage and treatment protocol may be determined by conventional means, starting with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Numerous factors may be taken into consideration by a clinician when determining an optimal dosage for a given subject. Such considerations are known to the skilled person.
  • pharmaceutically acceptable carrier includes any of the standard pharmaceutical carriers.
  • Pharmaceutically acceptable carriers for therapeutic use are well known in the
  • Suitable pH buffering agents may be, e.g., phosphate, citrate, acetate, lactate, maleate,
  • TIS tris/hydroxymethyl)aminomethane
  • TAPS /V-Tris(hydroxymethyl)methyl-3- aminopropanesulphonic acid
  • ammonium bicarbonate diethanolamine
  • histidine which in certain embodiments is a preferred buffer, arginine, lysine, or acetate or mixtures thereof.
  • pharmaceutically acceptable salt refers to a salt of the compound. Salts include pharmaceutically acceptable salts, such as, e.g., acid addition salts and basic salts.
  • Examples of acid addition salts include hydrochloride salts, citrate salts and acetate salts.
  • Examples of basic salts include salts where the cation is selected from alkali metals, such as sodium and potassium, alkaline earth metals such as calcium, and ammonium ions
  • R 3 and R 4 independently designate optionally substituted Ci-6-alkyl, optionally substituted C2- 6 -alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • R 3 and R 4 independently designate optionally substituted Ci-6-alkyl, optionally substituted C2- 6 -alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • Other examples of pharmaceutically acceptable salts are described in
  • Treatment is an approach for obtaining beneficial or desired clinical results.
  • beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment may also mean prolonging survival as compared to expected survival if not receiving treatment.
  • Treatment is an intervention performed with the intention of preventing the development or altering the pathology of a disorder. Accordingly, “treatment” refers to both therapeutic treatment and prophylactic or preventative measures in certain embodiments. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. By treatment is meant inhibiting or reducing an increase in pathology or symptoms (e.g. weight gain, hyperglycemia) when compared to the absence of treatment, and is not necessarily meant to imply complete cessation of the relevant condition.
  • pathology or symptoms e.g. weight gain, hyperglycemia
  • compositions of the invention may be in unit dosage form.
  • the composition is divided into unit doses containing appropriate quantities of the active component.
  • the unit dosage form can be a packaged preparation, the package containing discrete quantities of the preparations, for example, packeted tablets, capsules, and powders in vials or ampoules.
  • the unit dosage form can also be a capsule, cachet, or tablet itself, or it can be the appropriate number of any of these packaged forms. It may be provided in single dose injectable form, for example in the form of an injection pen.
  • Compositions may be formulated for any suitable route and means of administration.
  • Pharmaceutically acceptable carriers or diluents include those used in formulations suitable for oral, rectal, nasal or parenteral (including subcutaneous, intramuscular, intravenous, intradermal, and
  • transdermal administration may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy.
  • Subcutaneous or transdermal modes of administration may be particularly suitable for certain of the compounds described herein.
  • a GIP-GLP-1 dual agonist compound employed in the context of the invention may be administered as part of a combination therapy with at least one other agent for treatment of diabetes, obesity, dyslipidemia, or hypertension.
  • the at least two active agents may be given together or separately, and as part of the same pharmaceutical formulation or as separate formulations.
  • the GIP-GLP-1 dual agonist compound employed in the context of the invention (or the salt or solvate thereof) may be used in combination with an antidiabetic agent including but not limited to metformin, a sulfonylurea, a glinide, a DPP-IV inhibitor, a glitazone, or insulin.
  • the compound or salt or solvate thereof is used in combination with insulin, DPP-IV inhibitor, sulfonylurea or metformin, particularly sulfonylurea or metformin, for achieving adequate glycemic control.
  • the compound or salt or solvate thereof is used in combination with insulin or an insulin analogue for achieving adequate glycemic control.
  • insulin analogues include but are not limited to Lantus®, NovoRapid®, Humalog®, NovoMix®, Actraphane HM®, Levemir® and Apidra®.
  • the GIP-GLP-1 dual agonist compound or salt or solvate thereof may further be used in combination with one or more of an anti-obesity agent, including but not limited to a glucagon-like peptide receptor 1 agonist, peptide YY or analogue thereof, cannabinoid receptor 1 antagonist, lipase inhibitor, melanocortin receptor 4 agonist, or melanin concentrating hormone receptor 1 antagonist.
  • an anti-hypertension agent including but not limited to an angiotensin-converting enzyme inhibitor, angiotensin II receptor blocker, diuretics, beta- blocker, or calcium channel blocker.
  • the GIP-GLP-1 dual agonist compound or salt thereof may be used in combination with an anti-dyslipidemia agent, including but not limited to a statin, a fibrate, a niacin and/or a cholesterol absorption inhibitor.
  • an anti-dyslipidemia agent including but not limited to a statin, a fibrate, a niacin and/or a cholesterol absorption inhibitor.
  • a nucleic acid molecule may encode the amino acid sequence of Formula I or a precursor thereof.
  • the amino acid sequence encoded can be regarded as a precursor of a compound of the invention.
  • nucleic acid sequences will be provided as expression constructs wherein the encoding nucleic acid is in functional linkage with appropriate control sequences to direct its expression.
  • the expression construct may be provided in the context of a host cell capable of expressing (and optionally also secreting) the amio acid precursor, or ina cell-free expression system.
  • the invention provides a method of producing a GIP analogue of the invention, the method comprising expressing an amino acid precursor of the GIP analogue and modifying the precursor to provide the GIP analogue.
  • the modification may conmprise chemical modification of a Lys, Arg or Cys residue present at position 17 to introduce the lipophilic moiety, modification of the N- or C- terminus, and/or modification of any other amino acid side chains in the molecule (e.g. to introduce a non-naturally occurring amino acid residue).
  • the compounds of the invention may also be manufactured by standard peptide synthetic methods, e.g. by standard solid-phase or liquid-phase methodology, either stepwise or by fragment assembly, and isolating and purifying the final peptide compound product, or by any combinations of recombinant and synthetic methods. It may be preferable to synthesize the peptide compounds of the invention by means of solid- phase or liquid-phase peptide synthesis.
  • synthesize the peptide compounds of the invention by means of solid- phase or liquid-phase peptide synthesis.
  • GIP-GLP1 dual agonist compounds that exhibit signaling selectivity, and methods for screening these compounds.
  • Signaling selectivity may be, for example, preferential pathway activation or preferential pathway inhibition, or both.
  • the GIP-GLP1 dual agonist compounds may be useful for the treatment and/or prevention of diseases or conditions caused or characterized by excess body weight, including, but not limited to, obesity, morbid obesity, obesity linked inflammation, obesity linked gallbladder disease, obesity induced sleep apnea, metabolic syndrome, pre-diabetes, insulin resistance, glucose intolerance, type 2 diabetes, type I diabetes, hypertension, atherogenic dyslipidaemia, atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease, and stroke or microvascular disease.
  • Piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40°C).
  • the reaction vessel was drained and a second portion of piperidine/NMP (20%; 10 ml) was added and heated (75°C; 3 min.) again.
  • the resin was then washed with DMF (6 x 10 ml).
  • Fmoc-Lys(ivDde)-OH or alternatively another amino acid with an orthogonal side chain protective group was introduced at the position of the acylation.
  • the N-terminal of the peptide backbone was then Boc-protected using Boc20 or alternatively by using a Boc-protected amino acid in the last coupling. While the peptide was still attached to the resin, the orthogonal side chain protective group was selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 x 15 min.
  • the unprotected lysine side chain was first coupled with Fmoc-Glu-OtBu or another spacer amino acid, which was deprotected with piperidine and acylated with a lipophilic moiety using the peptide coupling methodology as described above.
  • Abbreviations employed are as follows:
  • COMU l-[(l-(cyano-2-ethoxy-2-oxoethylideneaminooxy)-dimethylamino- morpholinomethylene)]methanaminium hexaflourophosphate
  • ivDde 1 -(4,4-dimethyl-2,6-dioxocyclohexylidene)3-methyl-butyl
  • DIPEA diisopropylethylamine
  • HATU /V-[(dimethylamino)-1 H-1 ,2,3-triazol[4,5-b]pyridine-1 -ylmethylene]-/V- methylmethanaminium hexafluorophosphate
  • MeCN acetonitrile
  • TIS triisopropylsilane
  • the resin was washed with EtOH (3 x 10 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.).
  • the crude peptide was cleaved from the resin by treatment with TFA/TIS/water (95/2.5/2.5; 40 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
  • the crude peptide was purified to greater than 90% by preparative reverse phase HPLC using a PerSeptive Biosystems VISION Workstation equipped with a C-18 column (5 cm; 10 ⁇ ) and a fraction collector and run at 35 ml/min with a gradient of buffer A (0.1 % TFA, aq.) and buffer B (0.1% TFA, 90% MeCN, aq.). Fractions were analyzed by analytical HPLC and MS and relevant fractions were pooled and lyophilized. The final product was characterized by HPLC and MS.
  • Solid phase peptide synthesis was performed on a CEM Liberty Peptide Synthesizer using standard Fmoc chemistry.
  • TentaGel S Ram S resin (1 ,05 g; 0.25 mmol/g) was swelled in DMF (10 ml) prior to use and transferred between tube and reaction vessel using DCM and DMF.
  • Lys17 was incorporated as Fmoc-Lys(Dde)-OH for orthogonal coupling.
  • the first 9 amino acids and amino acid number 24 (counting from the C-terminal) was double couple meaning the building block was coupled twice before deprotection.
  • Boc- Tyr(tBu)-OH was incorporated as the final building block in the N-terminal. Deprotection
  • Piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40°C).
  • the reaction vessel was drained and a second portion of piperidine/DMF (20%; 10 ml) was added and heated (75°C; 3 min.) again.
  • the resin was then washed with DMF (6 x 10 ml). Side chain acylation
  • the orthogonal side chain protective group was selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 x 15 min.
  • the unprotected lysine side chain was first coupled with Fmoc-Glu-OtBu and the two Peg3 buildingblocks using standard coupling and deprotection conditions as explained aboved.
  • the lipophilic moiety was incporated as a 17-carboxy-heptadecanoic acid mono tert butyl ester again using standard coupling conditions.
  • the resin was washed with EtOH (3 x 0 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.).
  • the crude peptide was cleaved from the resin by treatment with TFA/TIS/H2O (95/2.5/2.5; 60 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
  • the crude peptide was first purified from 45% by preparative reverse phase HPLC using a PerSeptive Biosystems VISION Workstation equipped with a Gemini NX 5 ⁇ C-18 110A,
  • GIP R Human GIP receptor
  • GLP-1 R GLP-1 receptor
  • HEK293 cells expressing the human GIP R or GLP-1 R were seeded at 30,000 cells/well in 96-well microtiter plates coated with 0.01 % poly-L-lysine, and grown for 1 day in culture in 200 ⁇ growth medium (DMEM, 10% FCS, Penicillin (100 lU/ml), Streptomycin (100 pg/ml)). On the day of analysis, growth medium was removed and the cells were washed once with 150 ml Tyrode's buffer (Tyrode's Salts (9.6 g/l), 10 mM HEPES, pH 7.4). Cells were then incubated in 100 ml Assay buffer
  • Table 3 EC50 average values of all the compounds on the GIP-R and GLP1-R.
  • mice Males with a body weight of approximately 25 g were given either a single subcutaneous (s.c.) bolus or a single intravenous (i.v.) bolus of each peptide to be tested.
  • s.c. subcutaneous
  • i.v. intravenous
  • the dosing vehicle was a phosphate buffer containing mannitol (pH 7.5).
  • mice were included for each compound and each administration route.
  • the mice were euthanized immediately after blood sampling by cervical dislocation.
  • Plasma samples were analyzed after solid phase extraction (SPE) or protein precipitation followed by liquid chromatography mass
  • IPGTT Intraperitoneal Glucose Tolerance Test
  • the GLP-1 analogue liraglutide (10 nmol/kg) was administered subcutaneously 4 hours before the i.p. injection of glucose.
  • mice Male C57BL/6J mice (Taconic A/S, Denmark) fed high-fat diet (60% of total energy from fat, D12492, Research Diet Inc.) for approximately 6 months were used.
  • Mice from cages of 4 were split into two cages (2 mice per cage) two weeks prior to start of the mock phase. All mice were mock-treated (once daily s.c. injection of vehicle) for a week to acclimatize the animals to handling and injections.
  • OGTT oral glucose tolerance test

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Diabetes (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Endocrinology (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hematology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Obesity (AREA)
  • Rheumatology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Pain & Pain Management (AREA)
  • Child & Adolescent Psychology (AREA)
  • Pulmonology (AREA)
  • Emergency Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)

Abstract

The present invention relates to acylated GIP analogues which have dual GIP and GLP-1 activity, and their use in the treatment of metabolic disorders.

Description

GIP-GLP-1 DUAL AGONIST COMPOUNDS AND METHODS
Field of the Invention
The invention relates to compounds having agonist activity at both the GIP and GLP- receptors, and to their use in the treatment of metabolic disorders.
Background of the Invention
Diabetes and obesity are increasing health problems globally and are associated with various other diseases, particularly cardiovascular diseases (CVD), obstructive sleep apnea, stroke, peripheral artery disease, microvascular complications and osteoarthritis. There are 246 million people worldwide with diabetes, and by 2025 it is estimated that 380 million will have diabetes. Many have additional cardiovascular risk factors including high/aberrant LDL and triglycerides and low HDL. Cardiovascular diseases account for about 50% of the mortality in people with diabetes, and the morbidity and mortality rates relating to obesity and diabetes underscore the medical need for efficacious treatment options.
Incretins are gastrointestinal hormones that regulate blood glucose by enhancing glucose- stimulated insulin secretion (Drucker, DJ and Nauck, MA, Lancet 368: 1696-705 (2006)). To date there are two known incretins: glucagon-like peptide-1 (GLP-1 ), and glucose-dependent insulinotropic polypeptide (GIP). The incretin GLP-1 is derived from the pre-proglucagon gene. Pre-proglucagon is a 158-amino acid precursor polypeptide that is processed in different tissues to form a number of different proglucagon-derived peptides, including glucagon, GLP-1 , glucagon-like peptide-2 (GLP-2) and oxyntomodulin (OXM). Glucagon is a 29-amino acid peptide that corresponds to amino acids 33 through 61 of pre-proglucagon, while GLP-1 is produced as a 37-amino acid peptide that corresponds to amino acids 72 through 108 of pre-proglucagon. GIP is a 42-amino acid peptide derived by proteolytic processing from a 133-amino acid precursor, pre-pro-GIP. All the peptides are involved in a wide variety of physiological functions, including glucose homeostasis, insulin secretion, gastric emptying, and intestinal growth, as well as the regulation of food intake.
The discovery of the incretins has led to the development of two new classes of drugs for the treatment of diabetes mellitus. Thus, injectable GLP-1 receptor agonists, and small molecule compounds (oral DPP-4 inhibitors) that inhibit enzymatic inactivation of both endogenous GLP-1 and GIP, are now on the market (GLP-1 receptor agonists: Byetta™, Bydureon™ Lixisenatide™ and Victoza™; and DPP-4 inhibitors: Januvia™, Galvus™, Onglyza™ and Trajenta™). Apart from the acute effects of GLP-1 and GIP on insulin secretion, the incretins have some long-term effects. Evidence from several laboratories shows that GLP-1 receptor agonists protect pancreatic β-cells by inhibiting apoptosis and enhancing proliferation. For instance, a study by Farilla ei a/, showed that GLP-1 has anti-apoptotic effects in human islets (Farilla, L, Endocrinology 144: 5 49-58 (2003)). Such effects have not been reported for GIP until recently. Weidenmaier et al. reported that a DPP-4 resistant GIP analogue had anti- apoptotic effects (Weidenmaier, SD, PLOS One 5(3): e9590 (2010)). Interestingly, in a mouse model of diabetes and obesity, the combination of the GLP-1 receptor agonist Liraglutide and an acylated GIP analogue showed superior glucose-lowering and insulinotropic effects compared to treatment with Liraglutide and GIP analogue alone (Gault, VA, Clinical Science 121 : 107-117 (201 1 )).
Chronic treatment with GLP-1 receptor agonists causes significant weight loss in diabetic humans. Interestingly, extended use of DPP-4 inhibitors in similar patients does not consistently change body weight. Evidence suggests (Matthias Tschop oral presentation at ADA (American Diabetes Association), 2011 ) that body weight loss associated with GLP-1 agonist treatment is enhanced when GLP-1 and GIP are co-administered. In rodents, coadministration of GLP-1 and GIP results in greater body weight loss than GLP-1 treatment alone (Finan, Sci Transl Med. 2013; 5(209):209ra151. Irwin N et al, 2009, Regul Pept; 153: 70-76. Gault et al, 201 1 , Clin Sci; 121 :107-117).. Thus, in addition to improving blood glucose control, GIP may also enhance GLP-1 -mediated body weight loss.
Recently, different peptides have been shown to bind and activate both the GIP and the GLP- 1 receptor and to suppress body weight gain and reduce food intake (see, for example WO2012/0881 16, WO2010/148089, WO2012/167744, WO 2913/164483,
WO 2014/096145, WO 2014/096150 and WO 2014/096149). However, most of these peptides have short terminal elimination half-life (VA).
Summary of the Invention
Broadly, the present invention concerns acylated and truncated GIP analogues which comprise one or more substitutions as compared to wild-type GIP and which may have the property of an altered, preferably increased GLP-1 activity, e.g., as assessed in in vitro efficacy assays and an altered, preferably increased terminal elimination half-life (T½), as assessed in in vivo studies in mice.
It has been found in animals that GIP-GLP1 dual acting receptor agonists are superior to existing and marketed GLP-1 analogues because the dual agonists offer improved glycemic control, and enhanced body weight loss. The GIP-GLP1 dual agonists disclosed herein (also referred to as GIP analogues) may thus be used as therapeutics for metabolic disorders including, but not limited to, type 2 diabetes mellitus, obesity and related disorders.
The invention provides a GIP analogue having the general Formula I:
R1-Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-X10-Ser-lle-X13-Leu-X15-X16^-Ala-X19-X20-X21- Phe-X23-X24-Trp-Leu-X27-X28-X29-X30-Pv2 (I)
wherein
R1 is H, Ci-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X10 is selected from Tyr and Leu;
X13 is selected from Ala, Tyr and Aib;
X15 is selected from Asp and Glu;
X16 is selected from Glu and Lys;
X19 is selected from Gin and Ala;
X20 is selected from Lys and Arg;
X21 is selected from Ala and Glu;
X23 is selected from Val and lie;
X24 is selected from Asn and Glu;
X27 is selected from Leu, Glu and Val;
X28 is selected from Ala, Ser and Arg;
X29 is selected from Aib, Ala, and Gin;
X30 is selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1; where:
-Z1 is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S02-;
-Z2- (if present) is a spacer of formula: -Y-V-X- n connecting Z1 to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO- SO- or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NH2 or -OH;
or a pharmaceutically acceptable salt or solvate thereof.
The invention also provides a GIP analogue having the general Formula lb:
R -Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-X10-Ser-lle-X13-Leu-X15-X1 β-Ψ-Ala-XI 9-X20-X21 - Phe-X23-X24-Trp-Leu-X27-X28-X29-X30-R2 (lb)
wherein
R1 is H, C1-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X10 is selected from Tyr and Leu;
X13 is selected from Ala, Tyr and Aib;
X15 is selected from Asp and Glu;
X16 is selected from Glu and Lys;
X19 is selected from Gin and Ala;
X20 is selected from Lys and Arg;
X21 is selected from Ala and Glu;
X23 is selected from Val and lie;
X24 is selected from Asn and Glu;
X27 is selected from Leu, Glu and Val;
X28 is selected from Ala, Ser and Arg;
X29 is selected from Aib, Ala, Glu and Gin; X30 is selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1; where:
-Z1 is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -SO2-;
-Z2- (if present) is a spacer of formula:
-Y-V-X
J n connecting Z to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO- SO-, or S02-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NHzor -OH;
or a pharmaceutically acceptable salt or solvate thereof.
The invention further provides a GIP analogue having the general Formula II: R1-Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-lle-X13-Leu-X1 S-Glu-M^-Ala-Ala-Arg ^I -
Phe-X23-X24-Trp-Leu-Leu-X28-X29-X30-R2 (II)
wherein
R1 is H, Ci-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X13 s selected from Ala, Tyr;
X15 s selected from Asp and Glu;
X21 s selected from Ala and Glu;
X23 s selected from Val and lie;
X24 s selected from Asn and Glu;
X28 s selected from Ala, Ser;
X29 s selected from Ala, Glu and Gin; and
X30 s selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser; Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z or -Z2-Z1; where:
-Z is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S02-;
-Z2- (if present) is a spacer of formula:
-Y-V-X- connecting Z1 to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO- SO-, or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NH2or -OH;
or a pharmaceutically acceptable salt or solvate thereof.
For the avoidance of doubt, in all aspects of the invention, those positions which are not expressly stated to permit variability are fixed and may only include the stated residue. Combinations of residues which may be present at some of the variable positions from 1 to 29 include:
Gln19, Arg20, Ala21 ;
Aib2, Gln19, Arg20, Ala21 ;
Asp15, Gln19, Arg20, Ala21 ;
Aib2, Ala13, Gln19, Arg20, Ala21 ;
Lys16, Gln19, Arg20, Ala21 ;
Aib2, Ala13, Gln19, Arg20, Ala21 ;
Aib2, Asp15, Gln19, Arg20, Ala21 ;
Aib2, Lys16, Gln19, Arg20, Ala21 ;
Aib2, Asp15, Lys16, Gln19, Arg20, AIa21 ;
Leu27, Ala28, Gln29;
Glu24, Leu27, Ala28, Gln29;
Gln19, Arg20, Ala21 ; Leu27, Ala28, Gln29;
Gln19, Arg20, Ala21 ; Glu24, Leu27, Ala28, Gln29;
Asp15, Gln19, Arg20, Ala21 ;
Glu15, Gln19, Arg20, Ala21 ;
Aib2, Glu15, Gln19, Arg20, Ala21 ;
Aib2, Glu15, Lys16, Gln19, Arg20, Ala21 ;
Glu15, Leu27, Ala28, Gln29; Glu15, Gln19, Arg20, Ala21 ; Leu27, Ala28, Gln29;
Glu15, Gln19, Arg20, Ala21 , Glu24;
Aib2, Glu15, Gln19, Arg20, Ala21 , Glu24;
Aib2, Ala13, Asp15, Gln19, Arg20, Ala21 , Glu24;
Aib2, Ala13, Asp15, Gln19, Arg20, Ile23, Glu24;
Aib2, Glu15, Lys16, Gln19, Arg20, Ala21 , Glu24;
Aib2, Ala13, Gln19, Arg20, Ala21 , Glu24;
Asp15, Ile23, Gln29
Glu15, Glu24, Leu27, Ala28, Gln29;
Glu15, Gln19, Arg20, Ala21 ; Glu24, Leu27, Ala28, Gln29;
Ala19, Lys20, Glu21 ;
Ala13, Ala19, Lys20, Glu21 ;
Ala19, Lys20, Glu21 , Ser28;
Ala19, Lys20, Glu21 , Ala29;
Ala19, Lys20, Glu21 , Ser28, Ala29;
Glu15, Ala19, Lys20, Glu21 ;
Ala13, Asp15, Ala19, Lys20, Glu21 ;
Glu15, Ala19, Lys20, Glu21 , Ser28;
Glu15, Ala19, Lys20, Glu21 , Ala29;
Ala13, Asp15, Ala19, Lys20, Glu21 , Ala29;
Glu15, Ala19, Lys20, Glu21 , Ser28, Ala29;
Glu16, Ala19, Lys20, Glu21 ;
Ala13, Asp15, Glu24,Gln29
Glu16, Ala19, Lys20, Glu21 , Ser28;
Glu16, Ala19, Lys20, Glu21 , Ala29;
Glu16, Ala19, Lys20, Glu21 , Ser28, Ala29;
Ala13, Asp15, ile23;
Glu27, Ser28, Ala29;
Glu16, Glu27, Ser28, Ala29;
Ala19, Lys20, Glu21 , Glu27, Ser28, Ala29;
Glu16, Ala19, Lys20, Glu21 , Glu27, Ser28, Ala29;
Val27, Aib29;
Asn24, Val27, Aib29;
Ala13, Asp15, Glu27;
Asn24, Aib29;
Glu15, Glu27;
Glu15, Glu24; and Leu 10, or any of the above in combination with Leu 10.
In some embodiments, positions 1 to 29 of the GIP analogue have a maximum of 8 changes (within the constraints of Formula I) compared to the sequence:
Y-Aib-EGTFTSDYSIYLDKKAQRAFVEWLLAQ
e.g. a maximum of 1 , 2, 3, 4, 5, 6 or 7 changes compared to that sequence.
If positions 1 to 29 of the GIP analogue have 6 or more changes compared to that sequence, then they may possess all of Ala19, Lys20 and Glu21. They may also possess one or both of Ser28 and Ala29.
If the analogue does not possess Ala19, Lys20 and Glu21 , then positions 1 to 29 typically have 4 or fewer changes compared to that sequence. In other embodiments, positions 1 to 29 of the GIP analogue have a maximum of 6 changes (within the constraints of Formula I) compared to the sequence
Y-Aib-EGTFTSDYSIYLEKKAAKEFVEWLLSA or
Y-Ai b-EGTFTSDYSI YLD E KAAKE F I EW LES A
e.g. a maximum of 1 , 2, 3, 4 or changes compared to one of those sequences.
It may be desirable that such analogues retain one, two, or all of Ala19, Lys20 and Glu21.
They may additionally possess one or more of the following:
Glu15 and/or Glu16;
Ser28 and/or Ala29;
Val27 and/or Aib29;
Asn24, Val27 and/or Aib29;
Asn24 and/or Aib29;
Glu15 and/or Glu27;
Ala13, Glu15 and/or Glu16;
Ala13, Ser28 and/or Ala29;
Ala13, Val27 and/or Aib29;
Ala13, Asn24, Val27 and/or Aib29;
Ala13, Asn24 and/or Aib29;
Ala13, Glu15 and/orGlu27;
Asp15 and/or Glu16;
Asp15, Ser28 and/or Ala29;
Asp15, Val27 and/or Aib29; Asp15, Asn24, Val27 and/or Aib29;
Asp 15, Asn24 and/or Aib29;
Asp15 and/or Glu27;
Glu15 or Glu16 and/or Ile23;
Ile23, Ser28 and/or Ala29;
Ile23, Val27 and/or, Aib29;
Ile23, Asn24, Val27 and/or Aib29;
Ile23, Asn24 and/or Aib29;
Glu15, IIe23 and/or Glu27.
Aib2 and/or Ala13;
Aib2 and/or Tyr13;
Asp15 and/or Glu16;
Ile23 and/or Glu24;
DAIa, Ser28 and/or Ala29;
Asn24 and/or, Arg20;
Asn24 and/or, Ala29.
Specific combinations of residues which may be present at the variable positions between 1 and 29 include:
Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
D-Ala2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Glu15, Lys16, Ala19, Lys20, Glu21 , Val23, Glu24, Leu27, Ser28, Ala29; Aib2, Tyr10, Aib13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Leu27, Ala28, Aib29; Aib2, Tyr10, Tyr13, Asp15, Glu16, Ala19, Lys20, Glu21 , Ile23, Glu24, Glu27, Ser28, Ala29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Val27, Ala28, Aib29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; Aib2, Leu10, Aia13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; Aib2, Tyr10, Tyr13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Arg28, Ala29; Aib2, Leu10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Val27, Ala28 Aib29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gin19, Arg20, Ala21 , Val23, Glu24, Val27, Ala28, Aib29; Aib2, Tyi-10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Glu27, Ala28, Gin29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; D-Ala2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Ala19, Lys20, Glu21 , Val23, Glu24, Leu27, Ser28, Ala29;
Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Leu27, Ala28, Aib29; Aib2, Tyr10, Ala13, Asp15, Glu16, Ala19, Lys20, Glu21 , Ile23, Glu24, Glu27, Ser28, Ala29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Arg28, Ala29;
Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
D-Ala2, Tyr10, Tyr13, Asp15, Lys16, Gin 19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Glu15, Lys16, Ala19, Lys20, Glu21 , Ile23, Glu24, Leu27, Ser28, Ala29; Aib2, Tyr10, Aib13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Asn24, Leu27, Ala28, Aib29;
Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Asn24, Val27, Ala28, Aib29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, A!a28, Gln29; Aib2, Tyr10, Tyr13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Arg28, Ala29;
Aib2, Leu10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Asn24, Val27, Ala28 Aib29;
Aib2, Tyi-10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Val27, Ala28, Aib29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29; Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29.
Residues 1-29 of Formula I may have the sequence: Y-Aib-EGTFTSDYSIYLDKTAQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIYLDKH^AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEKMJAAKEFVEWLLSA;
Y-Aib-EGTFTSDYSI-Aib-LDKΨ AQRAFVEWLLAQ
Y-Aib-EGTFTSDYSIYLDKΨAQRAFVNWLLA-Aib;
Y-Aib-EGTFTSDYSIYLDETAAKEFIEWLESA;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVNWLVA-Ai ;
Y-Aib-EGTFTSDYSIALEKΨ AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEKT AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEHWAQRAFVEWLLRA;
Y-Aib-EGTFTSDLSIALDKTAQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLVA-Aib;
Y-Aib-EGTFTSDYSIALEK AQRAFVEWLEAQ
Y-Aib-EGTFTSDLSIALEKTAQRAFVEWLEAQ
Y-Aib-EGTFTSDYSIALEKT AQRAFVEWLLAQ
Y-DAIa-EGTFTSDYSIALEKΨAQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEKT AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDKΨ AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALDKMJ AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAAP;
Y-Aib-EGTFTSDYSIALDKΨAAKEFVEWLLSA;
Y-Aib-EGTFTSDYSIALDEΨAQRAFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKAFVEWLLAA
Y-Aib-EGTFTSDYSIALDE4W_3RAFVEWLLAA
Y-Aib-EGTFTSDYSIYLDKH'AQREFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQREFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAA
Y-Aib-EGTFTSDYSIALDKMJAQRAFIEWLLAQ-
Y-Aib-EGTFTSDYSIALDKΨ AQRAFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAA
Y-Aib-EGTFTSDYSIYLDKΨAQRAFVEWLLAE; or
Y-Aib-EGTFTSDYSIALDK4JAQRAFVEWLLAE.
Residues 1 -29 of Formula I may have the sequence:
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQ RAFVEW LLAQ ;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQ RAFVEW LLAQ ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)-AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-GSGSGG)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)-AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQ RAF VEW LLAQ ;
Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSA; Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLLA-Aib;
Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFIEWLESA;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLVA-Aib;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ; or
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ.
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA;
Y-DAIa-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Peg3-Peg3)-AQRAFVEWLLAQ; Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)-AQRAFVEWLLAQ; Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ; Y-Aib-EGTFTSDYSIALDK-Ki -carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSA;
Y-Aib-EGTFTSDYSIALDE-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDE-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKAFVEWLLAA;
Y-Aib-EGTFTSDYSIYLDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFIEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-Ki carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-Ki -Carboxy-nonadecanoyl)-[(Piperazine-1 -yl)-acetyl]-Peg3- Peg 3 )- AQ RAF VE W LL AQ ; or
Y-Aib-EGTFTSDYS!ALDK-Ki -Carboxy-nonadecanoyl)-[(Piperazine-1 -yl)-acetyl]-Peg3- Peg3)-AQKEFVEWLLAA.
The peptide backbone of Formula ! may have the sequence:
Y-Aib-EGTFTSDYSIYLDKM^AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIYLDKMJAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLEKΨAAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSI-Aib-LDKΨAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLD^AQRAFVNWLLA-Aib-K;
Y-Aib-EGTFTSDYSIYLDEΨAAKEFIEWLESA;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVNWLVA-Aib-KPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLLAQK;
Y-Aib-EGTFTSDLSIALEK'+'AQRAFVEWLLAQK;
Y-Aib-EGTFTSDYSIYLEKΨAQ AFVEWLLRA;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVNWLVA-Aib-K;
Y-Aib-EGTFTSDLSIALDKΨAQPAFVNWLVA-Aib-K;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLVA-Aib-K;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLEA QGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLEAQK;
Y-Aib-EGTFTSDLSIALEKTAQRAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALEKΨAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEKΨAQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKMJAQRAFVEWLLAQKPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALDKΨAQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAAPSSGAPPPS;
Y-Aib-EGTFTSDYS!ALDKΨAAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAQGPSSGAPPPS; Y-Aib-EGTFTSDYSIALDEΨAQRAFVEWLLAQGPSSGAPPPS;
Υ-Αιΐ-ΕΟΤΡΤβϋΥεΐΑίΟΕΨΑΩ ΑΡνΕννίίΑΑΟΡεεθΑΡΡΡε;
Y-Aib-EGTFTSDYSIALD^AQKAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLD^AQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYsiALD^AQREFVEWLi_AQGPSSGAPPPS;
Y-Aib-EGTFTSDYsiALD^AQKEFVEWLi_AQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALD^AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYsiALD^AQRAFiEWLi_AQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALD^AQRAFVEWLLAQGPSSGAPPP;
Y-Aib-EGTFTSDYSIALDKTAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALD^AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEKΨAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYsiYLD^AQRAFVEwi_i_AEGPSSGAPPPs;
Y-Aib-EGTHTSDYSIALD^AQRAFVEWLLAEGPSSGAPPPS; or
Y-Aib-EGTFTSDYSIALD^AQF^FVEWLLAEPSSGAPPPS.
The peptide backbone of Formula I may have the sequence:
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)- AQRAFVEWLLAQGPSSGAPPPS
HY-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-GSGSGG)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLLA- Aib-K;
Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AAKEFIEWLESA; Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-KPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-KPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLRA; Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-K;
Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-K;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLVA- Aib-K;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLAQK; Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLEAQK; Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLAQK; Y-Aib-EGTFTSDYSIYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLRA; Y-DAIa-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAQGPSSGAPPPS; Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFIEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3)- AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS; or
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEPSSGAPPPS.
The peptide backbone of Formula I may have the sequence:
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-GSGSGG)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2
H-H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLLA-Aib-K-NH2;
H-Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFIEWLESA-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib-KPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-KPSSGAPPPS-NH2; H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK-NH2;
H-Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib-K-NH2;
H-Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib-K-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLVA-Aib-K-NH2;
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQPvAFVEWLEAQK-NH2;
H-Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK-NH2;
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK-NH2;
H-Y-Aib-EGTFTSDYSiYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA-NH2;
H-Y-DAla-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoy!]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)- AQRAFVEWLLAQGPSSGAPPPS-NH2; r
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK-NH2;
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS-NH2;
H-Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2; H-Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKAFVEWLLAAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFIEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3- Peg3)-AQKEFVEWLLAAGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS-NH2;
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS-NH2; or
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEPSSGAPPPS-NH2.
Certain of the Y1 groups, when present, may provide increased stability in vivo, e.g. in serum, and so may contribute to the half life of the GIP analogue. Without wishing to be bound by theory, it is believed that these groups may help to stabilize the three dimensional
conformation of the molecule and/or provide resistance to proteolytic degradation.
For example, the Y1 sequences Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser- Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro- Ser have homology with a C-terminal portion of the Exendin-4 molecule and appear to contribute to the stability of the molecule without concomitantly providing significant levels of GLP-1 agonist activity.
The invention further provides a pharmaceutical composition comprising a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, in admixture with a carrier, preferably a pharmaceutically acceptable carrier. The GIP analogue may.for example, be a pharmaceutically acceptable acid addition salt.
The pharmaceutical composition may be formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of said GIP analogue. The invention further provides a therapeutic kit comprising a GIP analogue as descibed herein, and a device comprising a GIP analogue as described herein.
The invention further provides a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, for use in a method of medical treatment, e.g. for use in the treatment and/or prevention of a metabolic disorder.
The invention further provides the use of a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, in the preparation of a medicament for the treatment and/or prevention of a metabolic disorder.
The invention further provides a method of prevention and or/treatment of a metabolic disorder in a subject, comprising administering a GIP analogue as described herein, or a pharmaceutically acceptable salt or solvate thereof, to the subject.
The metabolic disorder may be diabetes or a diabetes related disorder, or obesity or an obesity related disorder. The link between obesity and diabetes is well known, so these conditions are not necessarily separate or mutually exclusive.
Diabetes related disorders include insulin resistance, glucose intolerance, increased fasting glucose, pre-diabetes, type 1 diabetes, type 2 diabetes, gestational diabetes hypertension, dyslipidemia, and combinations thereof.
Diabetes related disorders also include atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease and stroke; or conditions associated with atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, bone related disorders and a proinflammatory state.
Bone related disorders include, but are not limited to, osteoporosis and increased risk of bone fracture.
The blood fat disorder may be selected from high triglycerides, low HDL cholesterol, high LDL cholesterol, and plaque buildup in artery walls, or a combination thereof. The prothrombotic state may be selected from high fibrinogen levels in the blood and high plasminogen activator inhibitor-1 levels in the blood.
The proinflammatory state may be an elevated C-reactive protein level in the blood.
Obesity related disorders include obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or may be associated with a condition selected from atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, and a proinflammatory state, or a combination thereof.
Brief Description of the Drawings
Figure 1 : Blood glucose levels (A, B) and area under the blood glucose curves (AUC) (C) in an IPGTT in 5-hour fasted diabetic db/db mice. The mice were injected s.c. with vehicle or GIP-GLP-1 dual acting receptor agonists (0.5 and 5 nmol/kg) 22 hours prior to the i.p.
injection of glucose (t = 0). The GLP-1 analogue liraglutide (10 nmol/kg) was administered s.c. 4 hours before the i.p. injection of glucose. Data are means ± SEM; n = 8.
Figure 2: Relative body weight changes (delta Δ = body weight at each study day - body weight at day 0) in DIO mice during the 18-days study period (A) and absolute body weight changes (delta Δ = body weight at day 18 - body weight at day 0) (B). Animals were treated once every third day with s.c. injections of vehicle or GIP-GLP-1 dual acting receptor agonists (3 nmol/kg). Data are means ± SEM; n = 7-9.
Figure 3: Accumulated food intake in DIO mice. Animals were treated once every third day with s.c. injections of vehicle or GIP-GLP-1 dual acting receptor agonists (3 nmol/kg). Data are means ± SEM; n = 4-5.
Figure 4: Blood glucose levels during the OGTT (A) and area under the blood glucose curves (AUC) (B) on day 12 in 5-hour fasted DIO mice. The mice were injected with vehicle or test substances (3 nmol/kg) 5 hours prior to the oral gavage of glucose (t = 0). Data are means ± SEM; n = 7-9.
Figure 5: Blood glucose on day 18 in 5-hour fasted DIO mice. The mice were injected with vehicle or GIP-GLP-1 dual acting receptor agonists (3 nmol/kg) 5 hours prior to the blood sampling. Data are means ± SEM; n = 7-9. Detailed Description of the Invention
Unless otherwise defined herein, scientific and technical terms used in this application shall have the meanings that are commonly understood by those of ordinary skill in the art.
Generally, nomenclature used in connection with, and techniques of, chemistry, molecular biology, cell and cancer biology, immunology, microbiology, pharmacology, and protein and nucleic acid chemistry, described herein, are those well known and commonly used in the art.
Definitions
Unless specified otherwise, the following definitions are provided for specific terms, which are used in the above written description.
Throughout this specification, the word "comprise" or variations such as "comprises" or "comprising" will be understood to imply the inclusion of a stated integer (or components) or group of integers (or components), but not the exclusion of any other integer (or components) or group of integers (or components).
The singular forms "a," "an," and "the" include the plurals unless the context clearly dictates otherwise. The term "including" is used to mean "including but not limited to." "Including" and "including but not limited to" are used interchangeably.
The terms "patient," "subject," and "individual" may be used interchangeably and refer to either a human or a non-human animal. These terms include mammals such as humans, primates, livestock animals (e.g., bovines, porcines), companion animals (e.g., canines, felines) and rodents (e.g., mice and rats).
The term "solvate" in the context of the present invention refers to a complex of defined stoichiometry formed between a solute (in casu, a peptide conjugate or pharmaceutically acceptable salt thereof according to the invention) and a solvent. The solvent in this connection may, for example, be water, ethanol or another pharmaceutically acceptable, typically small-molecular organic species, such as, but not limited to, acetic acid or lactic acid. When the solvent in question is water, such a solvate is normally referred to as a hydrate. The term "agonist" as employed in the context of the invention refers to a substance (ligand) that activates the receptor type in question. The term "GIP-GLP 1 dual receptor agonist" as employed in the context of the invention refers to a substance (ligand) that activates both the GIP receptor and the GLP-1 receptor.
Throughout the description and claims the conventional one-letter and three-letter codes for natural (or "proteinogenic") amino acids are used, as well as generally accepted three letter codes for other (non-natural or "non-proteinogenic") a-amino acids, such as Aib (a- aminoisobutyric acid), Orn (ornithine) and D-Ala (D-alanine). All amino acid residues in peptides of the invention are preferably of the L-configuration except where explicitly stated. Among sequences disclosed herein are sequences incorporating an "H-" moiety at the amino terminus (N-terminus) of the sequence, and either an "-OH" moiety or an "-NH2" moiety at the carboxy terminus (C-terminus) of the sequence. In such cases, and unless otherwise indicated, an Ή-" moiety at the N-terminus of the sequence in question indicates a hydrogen atom (i.e. R = H), corresponding to the presence of a free primary or secondary amino group at the N-terminus, while an "-OH" or an "-NH2" moiety at the C-terminus of the sequence (i.e. R2 = OH or NH2) indicates a carboxy (COOH) group or an amido (CONH2) group at the C-terminus, respectively.
Other R groups are possible at the N-terminus, including pyroglutamic acid (pGlu; (S)-(-)-2- pyrrolidone-5-carboxylic acid), Ci-4 alkyl, acetyl, formyl, benzoyl and trifluoroacetyl.
Receptor agonist activity
As mentioned above, the compounds described herein are GIP-GLP 1 dual receptor agonists. That is to say, they have agonist activity at both the GIP receptor and the GLP-1 receptor.
The term "agonist" as employed in the context of the invention refers to a substance (ligand) that is capable of binding to a particular receptor and activating signaling by that
receptor. Thus a GIP receptor agonist is capable of binding to the GIP receptor (designated GIP-R) and activating signaling by that receptor, e.g. by generation of cAMP or inducing Ca2+ release. Agonist activity at the GIP receptor may therefore be measured by assessing GIP receptor signalling, which may may, for example, be measured via cAMP production or Ca2+ release.
The cDNA sequence encoding the human GIP receptor has GenBank accession no.
BC101673.1 (GL75516688). The encoded amino acid sequence (including signal peptide) is:
1 MTTSPILQLL LRLSLCGLLL QRAETGSKGQ TAGELYQRWE RYRRECQETL AAAEPPSGLA 61 CNGSFDMYVC WDYAAPNATA RASCPWYLPW HHHVAAGFVL RQCGSDGQ G LWRDHTQCEN 121 PEKNEAFLDQ RLILERLQVM YTVGYSLSLA TLLLALLILS LFRRLHCTRN YIHINLFTSF 181 MLRAAAILSR DRLLPRPGPY LGDQALALWN QALAACRTAQ IVTQYCVGAN YTWLLVEGVY
241 LHSLLVLVGG SEEGHFRYYL LLGWGAPALF VIPWVIVRYL YENTQCWERN EVKAIWWIIR
301 TPILMTILIN FLIFIRILGI LLSKLRTRQM RCRDYRLRLA RSTLTLVPLL GVHEVVFAPV
361 TEEQARGALR FAKLGFEIFL SSFQGFLVSV LYCFINKEVQ SEIRRGWHHC RLRRSLGEEQ
421 RQLPERAFRA LPSGSGPGEV PTSRGLSSGT LPGPGNEASR ELESYC
(GenBank AAI01674.1 Gl:75516689). This may be employed in any assays to determine GIP signalling.
Similarly the compounds have agonist activity at the GLP-1 receptor (GLP-1 -R), i.e. they are capable of binding to the GLP-1 receptor and activating signaling by that receptor, e.g. by generation of cAMP or inducing Ca2+ release. Agonist activity at the GLP-1 receptor may therefore be measured by assessing GLP-1 receptor signalling, which may may, for example, be measured via cAMP production or Ca2+ release. The GLP-1 receptor may have the sequence of the human glucagon-like peptide 1 receptor (GLP-1 R) having primary accession number P43220. The precursor protein (including signal peptide) has primary accession number NP_002053.3; Gl:166795283 and has sequence:
1 MAGAPGPLRL ALLLLGMVGR AGPRPQGATV SLWETVQKWR EYRRQCQRSL TEDPPPATDL 61 FCNRTFDEYA CWPDGEPGSF VNVSCPWYLP WASSVPQGHV YRFCTAEGLW LQKDNSSLPW
121 RDLSECEESK RGERSSPEEQ LLFLYIIYTV GYALSFSALV IASAILLGFR HLHCTRNYIH
181 LNLFASFILR ALSVFIKDAA LKWMYSTAAQ QHQWDGLLSY QDSLSCRLVF LLMQYCVAAN
241 YYWLLVEGVY LYTLLAFSVL SEQWIFRLYV SIGWGVPLLF VVPWGIVKYL YEDEGCWTRN
301 SNMNYWLIIR LPILFAIGVN FLIFVRVICI VVSKLKANLM CKTDIKCRLA STLTLIPLL 361 GTHEVIFAFV MDEHARGTLR FIKLFTELSF TSFQGLMVAI LYCFVNNEVQ LEFRKSWERW
421 RLEHLHIQRD SSMKPLKCPT SSLSSGATAG SSMYTATCQA SCS.
This may be employed in any assays to determine GIP signalling.
The compounds of the present invention have at least one GIP and one GLP-1 biological activity, in particular in treatment of metabolic diseases such as diabetes and obesity. This can be assessed, e.g., in in vivo assays, for example as described in the examples, in which the blood glucose level or another biological activity is determined after a test animal has been treated or exposed to a GIP analogue. In particular, compounds of the invention may be capable of improving glycaemic control when adminstered to a diabetic subject. Additionally or alternatively, they may be capable of reducing body weight when administered to an overweight or obese subject. In either case, the effect may be superior to that obtained with an equivalent quantity (by mass, or molar ratio) of wild type human GIP or GLP-1 in comparable subjects when given according to a comparable dosing regime. Activity in in vitro assays may also be used as a measure of the compounds' activity.
Typically the compounds have activity at both the GLP-1 and GIP receptors (designated GLP- 1 -R and GIP-R respectively). EC5o values may be used as a numerical measure of agonist potency at a given receptor. An EC50 value is a measure of the concentration of a compound required to achieve half of that compound's maximal activity in a particular assay. Thus, for example, a compound having EC50 [GLP-1 R] lower than the EC50 [GLP-1 R] of native GIP in a particular assay may be considered to have higher potency at the GLP-1 R than GIP. In some embodiments of the present invention, the EC50 GLP-1 -R and/or EC50 GIP-R is below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, below 0.005 nM, or below 0.004 nM, e.g. when assessed using the assay described in Example 2. In any given assay, the EC50 value of a compound in a given assay may be assessed relative to the EC50 of human GIP. Thus, the ratio of the EC50 value of the test compound to the EC50 value of wild type human GIP (ECso[test compound] / EC5o[GIP]) at the human GIP receptor may be less than 10, less than 5, less than 1 , less than 0.1 , less than 0.05 or less than 0.01. The ratio of the EC50 value of the test compound to the EC50 value of wild type human GIP (ECso[test compound] / EC5o[GIP]) at the GLP-1 receptor may be less than 10, less than 5, less than 1 , less than 0.1 , less than 0.05 or less than 0.01. It may also be desirable to compare the ratio of EC50 values at the two receptors for the test compound and for human GIP. Preferably the test compound has an EC5o[GIP] / EC5o[GLP-1] which is greater than the equivalent ratio for GIP in the same assays. Lipophilic group
In all aspects, the compound of the invention comprises a residue Ψ, i.e. a residue selected from Lys, Arg, Orn and Cys in which the side chain is conjugated to a substituent -Z2-Z1- as decribed in more detail below. Without wishing to be bound by any particular theory, it is thought that the substituent binds plasma proteins (e.g. albumin) in the blood stream, thus shielding the compounds of the invention from enzymatic degradation and renal clearance and thereby enhancing the half-life of the compounds. It may also modulate the potency of the compound, e.g. with respect to the GIP receptor and/or the GLP-1 receptor.
The substituent is conjugated to the functional group at the distal end of the side chain from the alpha-carbon. The normal ability of the Lys, Arg, Orn or Cys side chain to participate in interactions mediated by that functional group (e.g. intra- and inter-molecular interactions) may therefore be reduced or completely eliminated by the presence of the substituent. Thus, the overall properties of the compound may be relatively insensitive to changes in the actual amino acid present as residue Ψ. Consequently, it is believed that any of the residues Lys, Arg, Orn and Cys may be present at any position where Ψ is permitted. However, in certain embodiments, it may be advantageous that the amino acid component of Ψ is Lys.
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1;
-Z1 is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X-, at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S02-;
-Z2-, if present, is a spacer of formula:
-Y-V-X- n connecting Z to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO-, SO-, or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10;
The group Z1
Z1 is a fatty chain having a connection to Ψ or to Z2, referred to herein as -X- and, at the end of the chain distal from the connection to Z2, a polar group. -X- may be, for example, a bond, acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-), the connection being located at the co- position with respect to the polar group, that is, at the end of the chain distal from the polar group. When Z1 is bound directly to Ψ, that is, when Z2 is not present, preferably -X- is acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-). Most preferably, -X- is acyl (-CO-). Preferably, the polar group is an acidic or weakly acid group, for example a carboxylic acid or a carboxylic acid bioisostere, a phosphonate, or a sulfonate. The polar group may have a Ka of between -2 and 12 in water, more preferably between 1 and 7, more preferably between 3 and 6. Certain preferred polar groups have a pKa of between 4 and 5.
The polar group preferably comprises a carboxylic acid or carboxylic acid bioisostere.
Suitable carboxylic acid bioisosteres are known in the art. Preferably the bioisostere has a proton having a pKa similar to the corresponding carboxylic acid. Examples of suitable bioisoteres may include, not by way of limitation, tetrazole, acylsulfomides,
acylhydroxylamine, and squaric acid derivatives, as shown below (— indicates the point of attachment):
Figure imgf000028_0001
The polar group may be a group of formula A-B-, wherein A is a carboxylic acid (-COOH) or a carboxylic acid bioisostere, a phosphonic acid (-P(0)(OH)2), or a sulfonic acid (-SO2OH) group, and B is a bond or linker between A and the fatty chain. In some embodiments, the polar group is -COOH, that is, A is -COOH and B is a bond. When B is a linker, it may be a cycloalkylene, heterocycloalkylene, Cearylene, or
C5-6heteroarylene, or C6arylene-0- or C5-6heteroarylene-0-
When B is phenylene it may, for example, be selected from 1 ,2-phenylene, 1 ,3-phenylene, 1 ,4-phenylene, preferably 1 ,4-phenylene (so that A-B- is a 4-benzoic acid substituent or 4-benzoic acid bioisostere). When B is phenylene-O- it may, for example, be selected from 1 ,2-phenylene-O-, 1 ,3-phenylene-O- 1 ,4-phenylene-O- preferably 1 ,4-phenylene-O. Each phenylene of B may be optionally substituted with one or more substituents selected from fluoro, methyl, trifluoromethyl, amino, hydroxyl, and Ci-4alkoxy, preferably methoxy. It will be appreciated that substituent identity and position may be selected to subtly alter the pKa of the polar group. Suitable inductively or mesomerically electron-withdrawing or donating groups and their positional effects are known in the art. In some embodiments, B may be Cs-eheteroarylene, for example, pyridinylene or thiofuranylene, and may be optionally substituted as described.
For example, in some embodiments, A-B- may be selected from:
Figure imgf000029_0001
Preferably, A is -COOH. In some preferred polar groups, A is a carboxylic acid and B is C6arylene-0-
Fatty chain as used herein refers to a moiety comprising a chain of carbon atoms, the carbon atoms being predominantly substituted with hydrogen or hydrogen-like atoms, for example, a hydrocarbon chain. Such fatty chains are often referred to as lipophilic, although it will be appreciated that substitution may alter the lipophilic properties of the overall molecule.
The fatty chain may by aliphatic. It may be entirely saturated or may include one or more double or triple bonds. Each double bond, if present, may be in the E or Z configuration. The fatty chain may also have one or more cycloalkylene or heterocycloalkylene moieties in its length, and additionally or alternatively may have one or more arylene or heteroarylene moieties in its length. For example, the fatty chain may incorporate a phenylene or piperazinylene moiety in its length as, for example, shown below (wherein— represents the points of attachment within the chain).
Figure imgf000029_0002
The fatty chain may be derived from a fatty acid, for example, it may be derived from a medium-chain fatty acid (MCFA) with an aliphatic tail of 6-12 carbon atoms, a long-chain fatty acid (LCFA) with an aliphatic tail of 13-21 carbon atoms, or a very long-chain fatty acid (LCFA) with an aliphatic tail of 22 carbon atoms or more. Examples of linear saturated fatty acids from which suitable fatty chains may be derived include tridecylic (tridecanoic) acid, myristic (tetradecanoic) acid, pentadecylic (pentadecanoic) acid, palmitic (hexadecanoic) acid, margaric (heptadecanoic) acid, and arachidic (eicosanoic) acid. Examples of linear unsaturated fatty acids from which suitable fatty chains may be derived include myristoleic acid, palmitoleic acid, sapienic acid and oleic acid.
The fatty chain may be connected to Ψ or to Z2 by an amide linkage, a sulfinamide linkage, a sulfonamide linkage, or by an ester linkage, or by an ether, thioether or amine linkage. Accordingly, the fatty chain may have at the ω position, that is, the position distal to the polar group, a bond to Z2 or an acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-) group. Preferably, the fatty chain has an acyl (-CO-) group at the position distal to the polar group and is connected to Z2 by an amide or ester linkage. In some embodiments, Z1 is a group of formula:
A-B-Alk-X- where A-B- is the polar group defined above, X is a bond, acyl (-CO-), sulfinyl (-SO-), or sulfonyl (-SO2-), and Alk is a fatty chain that may be optionally substituted with one or more substituents. The fatty chain is preferably 16 to 28 carbon atoms in length (e.g. a
Ci6-28alkylene), more preferably, 16 to 26 carbons in length (e.g. a Ci6-26alkylene), more preferably, 16 to 22 carbons in length (e.g. Ci6-alkylene), and may be saturated or
unsaturated. Preferably, Alk is saturated, that is, preferably Alk is alkylene.
In some embodiments, Z1 is an acyl group of formula:
A-B-Alk-(CO)- or a sulfonyl group of formula:
A-B-Alk-(S02)-.
Optional substituents on the fatty chain may be independently selected from fluoro, Ci-4alkyl, preferably methyl; trifluoromethyl, hydroxymethyl, amino, hydroxyl,
Figure imgf000030_0001
preferably methoxy; oxo, and carboxyl, and may be independently located at any point along the chain. In some embodiments, each optional substituent is selected from fluoro, methyl, and hydroxyl. Where more than one substituent is present, substituents may be the same or different. Preferably, the number of substituents is 0 to 3; more preferably the fatty chain is unsubstituted.
Preferably, Z1 is an acyl group of formula: A-B-alkylene-(CO)- where A and B are as defined above. In some embodiments, Z1 is:
4-carboxyphenoxynonanoyl HOOC-C6H4-0-(CH2)8-(CO)-.
Certain preferred Z1 are derived from long-chain saturated α,ω-dicarboxylic acids of formula HOOC-(CH2)i2-22-COOH, preferably, long-chain saturated α,ω-dicarboxylic acids having an even number of carbon atoms in the aliphatic chain . For example, and not by way of limitation, Z1 may be:
17-carboxyheptadecanoyl HOOC-(CH2)i6-(CO)-;
19-carboxynonadecanoyl HOOC-(CH2)i8-(CO)-; or
21-carboxyhenicosanoyl HOOC-(CH2)2o-(CO)-.
The carboxylic acid group may be replaced by a bioisotere as detailed herein.
The group Z2
Z2 is an optional spacer that connects Z1 to the side chain of the amino acid component of Ψ. At its most general, Z2, if present, is a spacer bound at one terminus by Y, which may be a nitrogen, oxygen or sulfur atom, and at the other terminus by X, which may be a bond or an acyl (-CO-), sulfinyl (-SO-), sulfonyl (-S02-)or absent. Accordingly, Z2 may be a spacer of formula (— indicate points of attachment):
-Y-V-X- n wherein:
Y may be -NH, -NR, -S or -O, where R may be alkyl, a protecting group or may form a linkage to another part of the spacer, with the remaining valency forming a linkage to Z1;
X may be a bond, CO- SO- or S02- with the remaining valency forming a linkage to the side chain of the amino acid component of Ψ;
V is a bivalent organic moiety linking Y and X; and n may be 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10. Where n is 2 or more, each Y, V, and X is independent of every other Y, V, and X.
Accordingly, Z2 may be bound at each side by amide, sulfinamide, sulfonamide, or ester linkages or by amino, ether, or thioether linkages depending upon the nature of Y and X and the corresponding linking groups on Z and the side chain. Where n is 2 or greater, each V may also be bound to each adjacent V by linkages as described. Preferably, linkages are amides, esters or sulfonamides, most preferably amides. Accordingly, in some embodiments, each Y is -NH or -NR and each X is CO- or S02-. In some embodiments, Z2 is a spacer of formula or -SB-SA-, wherein SA and SB are as defined below.
In some embodiments, Z2 is selected from -SA-, -SB-, or -SB-SA-, that is, [side chain]-Z2Z1 is [side chain]-SA-Z1, [side chain]-SB-Z1 or [side chain]-SB-SA-Z1.
The group SA
SA may be a single amino acid residue or a residue of an amino acid derivative, especially an amino acid derivative residue having a sulfinyl or sulfonyl in place of the carboxy moiety at the C terminus. Additionally or alternatively, the single amino acid residue may have an oxygen or sulfur atom in place of the nitrogen atom at the N terminus.
SA may comprise a nitrogen-containing heterocycle, said nitrogen-containing heterocycle being bound within the lipophilic group at one end via a bond, a carboxy, a sulfinyl, or a sulfonyl group, and at the other via a ring nitrogen atom. For example, SA may comprise a piperazine ring.
Suitably, SA is a 5-8-membered heterocycle having 1 or 2 nitrogen atoms and substituted with an -X or an -L-X group, where X is a bond, CO-, SO-, or SO2-, and where L, if present, is Ci-4alkylene (- denotes a point of attachment within the lipophilic group).
Preferably, SA is a 6-membered heterocycle having 1 or 2 nitrogen atoms, preferably 2, and substituted with a -CH2CO- -CH2SO- or -CH2SO2- group. For example, SA may be:
Figure imgf000032_0001
For example, SA may be:
Figure imgf000032_0002
(referred to herein a piperazine-1 -yl-acetyl).
Preferably, SA is a single amino acid residue or piperazine-1 -yl-acetyl. More preferably SA is a single amino acid residue In some embodiments, the amino acid may be selected from γ- Glu, a-Glu, a-Asp, β-Asp, Ala, Dapa (2,3-diaminopropionic acid), or Dab (2,4- diaminobutanoic). It will be understood that where more than one carboxylic acid or amino moiety is present, connection may be at any moiety as appropriate. Any carboxylic acid or amino resides not bound within the residue may be free, that is, present as a free carboxylic acid or primary amine, or may be derivatised. Suitable derivatisation is known in the art. For example, carboxylic acid moieties may be present in SA amino acid residues as esters, for example, as methyl esters. Amino moieties may be present as alkylated amines, for example, methylated, or may be protected as amide or carbamate moieties. Other suitable amino acids include β-Ala (3-aminopropanoic acid) and Gaba (4-aminobutanoic acid) and similar ω amino acids.
It will be understood that amino acids may be D or L, or a racemic or enantioenriched mixture. In some embodiments, the amino acid is an L-amino acid. In some embodiments, the amino acid is a D-amino acid.
In some preferred embodiments, SA has a carboxylic acid substituent, with γ-Glu, a-Glu, a- Asp, and β-Asp, and sulfinyl and sulfonyl derivatives thereof, being preferred. Accordingly, in some embodiments, the amino acid residue is:
Figure imgf000033_0001
where -X- is -CO- -SO-, -SO2-, preferably -CO-, and a is 1 or 2, preferably 2. In some embodiments, the carboxylic acid is an ester, and the amino acid residue is:
Figure imgf000033_0002
where -X- is -CO-, -SO-, -SO2-, preferably -CO-, and a is 1 or 2, preferably 2, and R is Ci-4alkyl or Cearyl. Preferably R is Ci-4alkyl, preferably methyl or ethyl, more preferably ethyl.
A preferred SA group bearing a carboxylic acid is γ-Glu. Preferably, SA is selected from Dapa or γ-Glu. Most preferably, SA is γ-Glu.
The group SB
SB may be a linker of general formula:
Figure imgf000034_0001
wherein Pu is a polymeric unit and n is 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10. One terminus of the linker SB is an -NH, -NR, -S or -O, wherein R may be alkyl, a protecting group or may form a linkage to another part of the polymeric unit; while the other is a bond or CO-, SO- or SO2- . Accordingly, each polymeric unit Pu may be bound at each side by amide, sulfinamide, sulfonamide, or ester linkages or by amino, ether, or thioether linkages depending upon the nature of Y and X and the corresponding linking groups on Z SA, and Lys.
In some embodiments, each Pu may be independently a unit of formula:
Y-V-X wherein: Y may be -NH, -NR, -S or -O, wherein R may be alkyl, a protecting group or may form a linkage to another part of the spacer, with the remaining valency forming a linkage to Z ;
X may be a bond, CO-, SO-, or SO2-, with the remaining valency forming a linkage to Lys; and V is a bivalent organic moiety linking Y and X.
In some embodiments, V is the a-carbon of a natural or unnatural amino acid, that is V is - CHRAA- wherein RAA is an amino acid side chain; or V is an optionally substituted
Ci-6alkylene, or V is a chain comprising one or more units of ethylene glycol in series, also known as PEG chain, for example, -CH2CH2-(OCH2CH2)m-0-(CH2)P- where m is 0, 1 , 2, 3, 4, or 5, and p is 1 , 2, 3, 4, or 5; when X is CO-, p is preferably 1 , 3, 4, or 5. Optional alkylene substituents include fluoro, methyl, hydroxy, hydroxymethy, and amino.
Preferred Pu units include: (i) . Single amino acid residues: Pu' ;
(ii) . Dipeptide residues: Pu"; and
(iii) . Amino-(PEG)m-carboxylic acid residues: Pu"', and may be present in any combination or order. For example, SB may comprise one or more of each of Pu', Pu", and Pu'" in any order, or may comprise one or more units of Pu', Pu", and Pu"' only, or one of more units selected from Pu' and Pu", Pu' and Pu"', or Pu" and Pu"'.
(i) . Pu' single amino acid residues
Each Pu' may be independently selected from any natural or unnatural amino acid residue and, for example, may be selected from Gly, Pro, Ala, Val, Leu, lie, Met, Cys, Phe, Tyr, Trp, His, Lys, Arg, Gin, Asn, a-Glu, γ-Glu, Asp, Ser Thr, Dapa, Gaba, Aib, β-Ala, 5- aminopentanoyl, 6-aminohexanoyl, 7-aminoheptanoyl, 8-aminooctanoyl, 9-aminononanoyl, and 10-aminodecanoyl. Preferably, Pu' amino acid residues are selected from Gly, Ser, Ala, Thr, and Cys, more preferably from Gly and Ser.
In some embodiments, SB is -(Pu')n-, wherein n is 1 to 8, more preferably 5 to 7, most preferably 6. In some preferred embodiments, SB is -(Pu%- n is 6 and each Pu' is independently selected from Gly or Ser, with a preferred sequence being -Gly-Ser-Gly-Ser- Gly-Gly-.
(ii) . Pu" dipeptide residues
Each Pu" may be independently selected from any dipeptide residue comprising two natural or unnatural amino acid residues bound by an amide linkage. Preferred Pu" dipeptide residues include Gly-Gly, Gly-Ser, Ser-Gly, Gly-Ala, Ala-Gly, and Ala-Ala, more preferably Gly-Ser and Gly-Gly.
In some embodiments, SB is -(Pu'%-, wherein n is 2 to 4, more preferably 3, and each Pu" is independently selected from Gly-Ser and Gly-Gly. In some preferred embodiments SB is - (Ρυ")η-, n is 3 and each Pu" is independently selected from Gly-Ser and Gly-Gly, with a preferred sequence being -(Gly-Ser)-(Gly-Ser)-(Gly-Gly).
Amino acids having stereogenic centres within Pu' and Pu" may be racemic, enantioenriched, or enantiopure. In some embodiments, the or each amino acid is independently an L-amino acid. In some embodiments, the or each amino acid is independently a D-amino acid. (iii). PuNi amino-(PEG)m-carboxylic acid residues
Each Pu'" may be independently a residue of general formula:
Figure imgf000036_0001
wherein m is 0, 1 , 2, 3, 4, or 5, preferably 1 , 2, 3, or 4, more preferably 1 or 2, and p is 1 , 2, 3, 4 or 5, e.g. 1 , 3, 4, or 5, preferably 1 .
In some embodiments, m is 1 and p is 1 , that is, Pu"' is a residue of 8-amino-3,6- dioxaoctanoic acid (also known as {2-[2-aminoethoxy]ethoxy}acetic acid and H2N-PEG3- COOH). This residue is referred to herein as -PEG3-.
In some embodiments, m is 5 and p is 2, that is, Pu'" is a residue of 2-[2-[2-[2-[2- [2- (2- aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid (also known as H2N-PEG6- COOH). This residue is referred to herein as -PEG6-. In some embodiments, m is 2 and p is 1 , that is, Puin is a residue of 11-amino-3,6,9- trioxaundecanoic acid (also known as H2N-PEG4-COOH). This residue is referred to herein
In some embodiments, SB is -(Ρυ"')η-, wherein n is 1 to 3, more preferably 2.
In some preferred embodiments, SB is selected from -PEG3-PEG3- and -PEG3-PEG3- PEG3-. Most preferably, SB is -PEG3-PEG3-.
Preferred -Z2-Z1
It will be understood that the above preferences may be independently combined to give preferred -Z1 and -Z2-Z1 combinations.
Some preferred -Z2-Z1 combinations are shown below (in each case,— indicates the point of attachment to the side chain of the amino acid component of Ψ:
Figure imgf000036_0002
(ii) [17-Carboxy-heptadecanoyl]-isoGlu
Figure imgf000037_0001
(iii) [17-Carboxy-heptadecanoyl]-Peg3-Peg3-isoGlu
Figure imgf000037_0002
(iv) [17-Carboxy-heptadecanoyl]-isoGlu-GSGSGG
Figure imgf000037_0003
(v) [17-Carboxy-heptadecanoyi]-AA-Peg3-Peg3
Figure imgf000037_0004
(vi) ([19-Carboxy-nonadecanoyl]-AA-Peg3-Peg3-Peg3)
Figure imgf000038_0001
(ix) [17-Carboxy-heptadecanoyl]-Dapa-Peg3-Peg3
Figure imgf000039_0001
(x) [19-Carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3
Figure imgf000039_0002
(xi) [19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3
Figure imgf000039_0003
(xii) (19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3
Figure imgf000040_0001
(xiii) (19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg6
Figure imgf000040_0002
The skilled person will be well aware of suitable techniques for preparing the compounds employed in the context of the invention. For examples of suitable chemistry, see, e.g., WO98/08871 , WOOO/55184, WOOO/551 19, Madsen et al. (J. Med. Chem. 2007, 50, 6126-32), and Knudsen et al. 2000 (J. Med Chem. 43, 1664-1669).
Clinical utility
The GIP analogue compounds employed in the context of the invention may provide an attractive treatment option for metabolic diseases including obesity, diabetes mellitus
(diabetes), obesity-related disorders, and diabetes-related disorders. Diabetes comprises a group of metabolic diseases characterized by hyperglycemia resulting from defects in insulin secretion, insulin action, or both. Diabetes is classified into type 1 diabetes, type 2 diabetes and gestational diabetes on the basis on pathogenic characteristics. Type 1 diabetes accounts for 5-10% of all diabetes cases and is caused by auto-immune destruction of insulin-secreting pancreatic β-cells. Acute signs of diabetes include excessive urine production, resulting compensatory thirst and increased fluid intake, blurred vision, unexplained weight loss, lethargy, and changes in energy metabolism. However, in type 2 diabetes symptoms are often not severe or may be absent. The chronic hyperglycemia of diabetes is associated with long-term damage, dysfunction, and failure of various organs, notably the eyes, kidneys, nerves, heart and blood vessels. Type 2 diabetes accounts for 90-95% of diabetes cases and is a result of a complex set of metabolic disorders. However, symptoms are often not severe or may be absent. Type 2 diabetes is the consequence of endogenous insulin production becoming insufficient to maintain plasma glucose levels below diagnostic thresholds. Gestational diabetes refers to any degree of glucose intolerance identified during pregnancy.
Pre-diabetes includes impaired fasting glucose and impaired glucose tolerance and refers to those states that occur when blood glucose levels are elevated but below the levels that are established for the clinical diagnosis for diabetes.
A large proportion of people with type 2 diabetes and pre-diabetes are at increased risk of morbidity and mortality due to the high prevalence of additional metabolic risk factors, including abdominal obesity (excessive fat tissue around the abdominal internal organs), atherogenic dyslipidemia (blood fat disorders including high triglycerides, low HDL cholesterol and/or high LDL cholesterol, which foster plaque buildup in artery walls), elevated blood pressure (hypertension) a prothrombotic state (e.g. high fibrinogen or plasminogen activator inhibitor- 1 in the blood), and/or a proinflammatory state (e.g., elevated C-reactive protein in the blood). Conversely, obesity confers an increased risk of developing pre-diabetes, type 2 diabetes as well as, e.g., certain types of cancer, obstructive sleep apnea and gall-bladder disease.
Dyslipidemia is associated with increased risk of cardiovascular disease. High Density Lipoprotein (HDL) is of clinical importance since an inverse correlation exists between plasma HDL concentrations and risk of atherosclerotic disease. The majority of cholesterol stored in atherosclerotic plaques originates from LDL and hence an elevated concentration of Low
Density Lipoproteins (LDL) is closely associated with atherosclerosis. The HDL/LDL ratio is a clinical risk indictor for atherosclerosis and coronary atherosclerosis in particular.
Compounds employed in the context of the invention act as GIP-GLP1 dual agonists. The dual agonist may combine the effect of GIP, e.g., on fat metabolism and weight loss, and blood glucose, with the effect of GLP-1 , e.g., on blood glucose levels and food intake. They may therefore act to accelerate elimination of excessive adipose tissue, induce sustainable weight loss, and improve glycemic control. Dual GIP-GLP1 agonists may also act to reduce cardiovascular risk factors such as high cholesterol, such as high LDL-cholesterol.
The GIP-GLP1 dual agonist compounds of the present invention may therefore be used (alone or in combination) as pharmaceutical agents for preventing weight gain, promoting weight loss, reducing excess body weight or treating obesity (e.g., by control of appetite, feeding, food intake, calorie intake, and/or energy expenditure and lipolysis), including morbid obesity, as well as associated diseases and health conditions including but not limited to obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea. The GIP-GLP1 dual agonist compounds employed in the context of the invention may also be used for treatment of insulin resistance, glucose intolerance, pre-diabetes, increased fasting glucose, type 2 diabetes, hypertension, dyslipidemia (or a combination of these metabolic risk factors), atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease and stroke. These are all conditions which may be associated with obesity. However, the effects of the compounds employed in the context of the invention on these conditions may be mediated in whole or in part via an effect on body weight, or may be independent thereof.
The GIP-GLP1 dual agonist compounds may thus be used (alone or in combination) for the treatment and/or prevention of any of the diseases, disorders, or conditions described herein, including insulin resistance, glucose intolerance, increased fasting glucose, pre-diabetes, type 1 diabetes, type 2 diabetes, gestational diabetes hypertension, dyslipidemia, or a combination thereof. In certain embodiments, the diabetes related disorder is selected from
atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease and stroke; or associated with a condition selected from atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, and proinflammatory state, or a combination thereof. In certain embodiments, the blood fat disorder is selected from high triglycerides, low HDL cholesterol, high LDL cholesterol, plaque buildup in artery walls, or a combination thereof. In certain embodiments, the prothrombotic state is selected from high fibrinogen levels in the blood and high plasminogen activator inhibitor-1 levels in the blood. In certain embodiments, the proinflammatory state is an elevated C-reactive protein level in the blood. In certain embodiments, the obesity related disorder is selected from obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea.
The GIP-GLP1 dual agonist compounds may also be used for the treatment and/or prevention of any of the diseases, disorders, or conditions associated with diabetes related osteoporosis including increased risk of bone fractures.. The observed increase in fracture risk is likely to be related to impaired bone quality rather than to bone mineral density. The related mechanisms, due at least in part to hyperglycemia, neuropathy, and higher incidence of hypovitaminosis D, are not yet fully understood.
The invention provides the use of a GIP-GLP1 dual agonist compound as described, in the manufacture of a medicament for any of the clinical applications described in this
specification. Reference to a compound for use in any such method should be construed accordingly.
In some embodiments, the invention also provides a therapeutic kit comprising a GIP analogue of the invention, optionally in combination with a pharmaceutically acceptable carrier. In some embodiments, the invention provides a device comprising a GIP analogue of the invention for delivery of the GIP analogue to a subject.
Pharmaceutical compositions
The GIP-GLP1 dual agonist compounds of the present invention, or salts or solvates thereof, may be formulated as pharmaceutical compositions prepared for storage or administration, which typically comprise a therapeutically effective amount of a compound employed in the context of the invention, or a salt or solvate thereof, in a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition is formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of the GIP-GLP1 dual agonist compound. The therapeutically effective amount of a compound of the present invention will depend, e.g., on the route of administration, the type of mammal being treated, and the physical characteristics of the specific mammal under consideration. These factors and their relationship to determining this amount are well known to skilled practitioners in the medical arts. This amount and the method of administration can be tailored to achieve optimal efficacy, and may depend on such factors as weight, diet, concurrent medication and other factors, well known to those skilled in the medical arts. The dosage sizes and dosing regimen most appropriate for human use may be guided by the results obtained by the present invention, and may be confirmed in properly designed clinical trials. An effective dosage and treatment protocol may be determined by conventional means, starting with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Numerous factors may be taken into consideration by a clinician when determining an optimal dosage for a given subject. Such considerations are known to the skilled person. The term
"pharmaceutically acceptable carrier" includes any of the standard pharmaceutical carriers. Pharmaceutically acceptable carriers for therapeutic use are well known in the
pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). For example, sterile saline and phosphate- buffered saline at slightly acidic or physiological pH may be used. Suitable pH buffering agents may be, e.g., phosphate, citrate, acetate, lactate, maleate,
tris/hydroxymethyl)aminomethane (TRIS), /V-Tris(hydroxymethyl)methyl-3- aminopropanesulphonic acid (TAPS), ammonium bicarbonate, diethanolamine, histidine, which in certain embodiments is a preferred buffer, arginine, lysine, or acetate or mixtures thereof. The term further encompasses any agents listed in the US Pharmacopeia for use in animals, including humans. The term "pharmaceutically acceptable salt" refers to a salt of the compound. Salts include pharmaceutically acceptable salts, such as, e.g., acid addition salts and basic salts.
Examples of acid addition salts include hydrochloride salts, citrate salts and acetate salts. Examples of basic salts include salts where the cation is selected from alkali metals, such as sodium and potassium, alkaline earth metals such as calcium, and ammonium ions
+N(R3)3(R4), where R3 and R4 independently designate optionally substituted Ci-6-alkyl, optionally substituted C2-6-alkenyl, optionally substituted aryl, or optionally substituted heteroaryl. Other examples of pharmaceutically acceptable salts are described in
"Remington's Pharmaceutical Sciences" ,17th edition. Ed. Alfonso R. Gennaro (Ed.), Mark Publishing Company, Easton, PA, U.S.A., 1985 and more recent editions, and in the
Encyclopaedia of Pharmaceutical Technology.
"Treatment" is an approach for obtaining beneficial or desired clinical results. For purposes of this invention, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. "Treatment" may also mean prolonging survival as compared to expected survival if not receiving treatment.
"Treatment" is an intervention performed with the intention of preventing the development or altering the pathology of a disorder. Accordingly, "treatment" refers to both therapeutic treatment and prophylactic or preventative measures in certain embodiments. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. By treatment is meant inhibiting or reducing an increase in pathology or symptoms (e.g. weight gain, hyperglycemia) when compared to the absence of treatment, and is not necessarily meant to imply complete cessation of the relevant condition.
The pharmaceutical compositions of the invention may be in unit dosage form. In such form, the composition is divided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of the preparations, for example, packeted tablets, capsules, and powders in vials or ampoules. The unit dosage form can also be a capsule, cachet, or tablet itself, or it can be the appropriate number of any of these packaged forms. It may be provided in single dose injectable form, for example in the form of an injection pen. Compositions may be formulated for any suitable route and means of administration. Pharmaceutically acceptable carriers or diluents include those used in formulations suitable for oral, rectal, nasal or parenteral (including subcutaneous, intramuscular, intravenous, intradermal, and
transdermal) administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy.
Subcutaneous or transdermal modes of administration may be particularly suitable for certain of the compounds described herein.
Combination therapy
In certain embodiments, a GIP-GLP-1 dual agonist compound employed in the context of the invention may be administered as part of a combination therapy with at least one other agent for treatment of diabetes, obesity, dyslipidemia, or hypertension.
In such cases, the at least two active agents may be given together or separately, and as part of the same pharmaceutical formulation or as separate formulations. Thus, the GIP-GLP-1 dual agonist compound employed in the context of the invention (or the salt or solvate thereof) may be used in combination with an antidiabetic agent including but not limited to metformin, a sulfonylurea, a glinide, a DPP-IV inhibitor, a glitazone, or insulin. In certain embodiments, the compound or salt or solvate thereof is used in combination with insulin, DPP-IV inhibitor, sulfonylurea or metformin, particularly sulfonylurea or metformin, for achieving adequate glycemic control. In certain preferred embodiments, the compound or salt or solvate thereof is used in combination with insulin or an insulin analogue for achieving adequate glycemic control. Examples of insulin analogues include but are not limited to Lantus®, NovoRapid®, Humalog®, NovoMix®, Actraphane HM®, Levemir® and Apidra®.
In certain embodiments, the GIP-GLP-1 dual agonist compound or salt or solvate thereof may further be used in combination with one or more of an anti-obesity agent, including but not limited to a glucagon-like peptide receptor 1 agonist, peptide YY or analogue thereof, cannabinoid receptor 1 antagonist, lipase inhibitor, melanocortin receptor 4 agonist, or melanin concentrating hormone receptor 1 antagonist. In certain embodiments, the GIP-GLP-1 dual agonist compound or salt or solvate thereof may be used in combination with an anti-hypertension agent, including but not limited to an angiotensin-converting enzyme inhibitor, angiotensin II receptor blocker, diuretics, beta- blocker, or calcium channel blocker. In certain embodiments, the GIP-GLP-1 dual agonist compound or salt thereof may be used in combination with an anti-dyslipidemia agent, including but not limited to a statin, a fibrate, a niacin and/or a cholesterol absorption inhibitor.
Synthesis of compounds of the invention
A nucleic acid molecule may encode the amino acid sequence of Formula I or a precursor thereof. The amino acid sequence encoded can be regarded as a precursor of a compound of the invention.
Typically, such nucleic acid sequences will be provided as expression constructs wherein the encoding nucleic acid is in functional linkage with appropriate control sequences to direct its expression. The expression construct may be provided in the context of a host cell capable of expressing (and optionally also secreting) the amio acid precursor, or ina cell-free expression system. The invention provides a method of producing a GIP analogue of the invention, the method comprising expressing an amino acid precursor of the GIP analogue and modifying the precursor to provide the GIP analogue. The modification may conmprise chemical modification of a Lys, Arg or Cys residue present at position 17 to introduce the lipophilic moiety, modification of the N- or C- terminus, and/or modification of any other amino acid side chains in the molecule (e.g. to introduce a non-naturally occurring amino acid residue).
The compounds of the invention may also be manufactured by standard peptide synthetic methods, e.g. by standard solid-phase or liquid-phase methodology, either stepwise or by fragment assembly, and isolating and purifying the final peptide compound product, or by any combinations of recombinant and synthetic methods. It may be preferable to synthesize the peptide compounds of the invention by means of solid- phase or liquid-phase peptide synthesis. In this context, reference may be made to WO 98/1 1 125 or, inter alia, Fields, G.B. et a\., "Principles and Practice of Solid-Phase Peptide Synthesis"; in: Synthetic Peptides, Gregory A. Grant (ed.), Oxford University Press (2nd edition, 2002) and the synthesis examples herein.
Examples
The following examples demonstrate certain embodiments of the present invention. However, it is to be understood that these examples neither purport nor are they intended to be wholly definitive as to conditions and scope of this invention. The examples were carried out using standard techniques, which are well known and routine to those of skill in the art, except where otherwise described in detail. The following examples are presented for illustrative purposes only, and should not be construed in any way as limiting the scope of this invention.
Disclosed are GIP-GLP1 dual agonist compounds that exhibit signaling selectivity, and methods for screening these compounds. Signaling selectivity may be, for example, preferential pathway activation or preferential pathway inhibition, or both. The GIP-GLP1 dual agonist compounds may be useful for the treatment and/or prevention of diseases or conditions caused or characterized by excess body weight, including, but not limited to, obesity, morbid obesity, obesity linked inflammation, obesity linked gallbladder disease, obesity induced sleep apnea, metabolic syndrome, pre-diabetes, insulin resistance, glucose intolerance, type 2 diabetes, type I diabetes, hypertension, atherogenic dyslipidaemia, atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease, and stroke or microvascular disease. While some embodiments of the invention have been described by way of illustration, it will be apparent that the invention can be put into practice with many different modifications, variations and adaptations, and with the use of numerous equivalents or alternative solutions that are within the scope of persons skilled in the art, without departing from the spirit of the invention or exceeding the scope of the claims.
All publications, patents, and patent applications referred to herein are herein incorporated by reference in their entirety to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety.
The methods used in the instant invention are described below, except where expressly indicated otherwise
Example 1 General synthesis of acylated GIP analogues
Solid phase peptide synthesis was performed on a CEM Liberty Peptide Synthesizer using standard Fmoc chemistry. TentaGel S Ram resin (1 g; 0.25 mmol/g) was swelled in NMP (10 ml) prior to use and transferred between tube and reaction vessel using DCM and NMP. Coupling
An Fmoc-amino acid in DMF/DCM (2:1 ; 0.2 M; 5 ml) was added to the resin in a CEM Discover microwave unit together with HATU/DMF or COMU/DMF (0.5 M; 2 ml) and DIPEA- DMF/DCM (2:1 ) (2.0 M; 1 ml). The coupling mixture was heated to 75°C for 5 min while nitrogen was bubbled through the mixture. The resin was then washed with DMF (4 x 10 ml).
Deprotection
Piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40°C). The reaction vessel was drained and a second portion of piperidine/NMP (20%; 10 ml) was added and heated (75°C; 3 min.) again. The resin was then washed with DMF (6 x 10 ml).
Side chain acylation
Fmoc-Lys(ivDde)-OH or alternatively another amino acid with an orthogonal side chain protective group was introduced at the position of the acylation. The N-terminal of the peptide backbone was then Boc-protected using Boc20 or alternatively by using a Boc-protected amino acid in the last coupling. While the peptide was still attached to the resin, the orthogonal side chain protective group was selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 x 15 min. The unprotected lysine side chain was first coupled with Fmoc-Glu-OtBu or another spacer amino acid, which was deprotected with piperidine and acylated with a lipophilic moiety using the peptide coupling methodology as described above. Abbreviations employed are as follows:
COMU: l-[(l-(cyano-2-ethoxy-2-oxoethylideneaminooxy)-dimethylamino- morpholinomethylene)]methanaminium hexaflourophosphate
ivDde: 1 -(4,4-dimethyl-2,6-dioxocyclohexylidene)3-methyl-butyl
Dde: 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)-ethyl
DCM: dichloromethane
DMF: A/,A/-dimethylformamide
DIPEA: diisopropylethylamine
EtOH: ethanol
Et20: diethyl ether
HATU: /V-[(dimethylamino)-1 H-1 ,2,3-triazol[4,5-b]pyridine-1 -ylmethylene]-/V- methylmethanaminium hexafluorophosphate A/-oxide MeCN: acetonitrile
NMP: /V-methylpyrrolidone
TFA: trifluoroacetic acid
TIS: triisopropylsilane
Cleavage
The resin was washed with EtOH (3 x 10 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.). The crude peptide was cleaved from the resin by treatment with TFA/TIS/water (95/2.5/2.5; 40 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
HPLC purification of the crude peptide
The crude peptide was purified to greater than 90% by preparative reverse phase HPLC using a PerSeptive Biosystems VISION Workstation equipped with a C-18 column (5 cm; 10 μιη) and a fraction collector and run at 35 ml/min with a gradient of buffer A (0.1 % TFA, aq.) and buffer B (0.1% TFA, 90% MeCN, aq.). Fractions were analyzed by analytical HPLC and MS and relevant fractions were pooled and lyophilized. The final product was characterized by HPLC and MS.
The synthesized compounds are shown in Table 1.
Table 1.
Compound No.
1 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
2 H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
3 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)- AQRAFVEWLLAQGPSSGAPPPS-NH2
4 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu- GSGSGG)-AQRAFVEWLLAQGPSSGAPPPS-NH2
5 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2
6 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3-Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
7 H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3- Peg3 )-AQRAFVEW LLAQG PSSG APPPS-N H2
8 H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3- Peg 3-Peg 3)-AQ RAFVEWLLAQG PSSG APPPS-N H2
9 H-Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
10 H-Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AAKEFVEWLLSAGPSSGAPPPS-NH2 H-Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu- Peg3-Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVNWLLA-Aib-K-NH2
H-Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AAKEFIEWLESA-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVNWLVA-Aib-KPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVNWLVA-Aib-KPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQ AFVEWLLAQK-NH2
H-Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQK-NH2
H-Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLRA-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg 3 )- AQ RAFVN W L VA-Ai b-K- N H 2
H-Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVNWLVA-Aib-K-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLVA-Aib-K-NH2
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLEAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg 3 )-AQ RAFVEW L E AQ K-N H2
H-Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLEAQK-NH2
H-Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQK-NH2
H-Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLEAQK-NH2
H-Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLEAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQK-NH2
H-Y-Aib-EGTFTSDYSIYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLRA-NH2
H-Y-DAIa-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3- Peg3)-AQRAFVEWLLAQKPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)- AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3- Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2 H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
38 Peg3)-AQRAFVEWLLAQKPSSGAPPPS-NH2
H-Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
39 Peg3)-AQRAFVEWLLAQKPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
40 Peg3)-AQRAFVEWLLAAPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
41 Peg3)-AAKEFVEWLLSAGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSiALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
42 Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
43 Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
44 Peg3)-AQRAFVEWLLAAGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
45 Peg3)-AQKAFVEWLLAAGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
46 Peg3)-AQREFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
47 Peg3)-AQREFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
48 Peg3)-AQKEFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
49 Peg3)-AQKEFVEWLLAAGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-
50 Peg3)-AQRAFIEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-
51 Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-
52 yl)-acetyl]-Peg3-Peg3)-AQRAFVEWLLAQGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-
53 yl)-acetyl]-Peg3-Peg3)-AQKEFVEWLLAAGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-
Peg3)-AQRAFVEWLLAEGPSSGAPPPS-NH2
54
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-
55 Peg3-Peg3)-AQRAFVEWLLAEGPSSGAPPPS-NH2
H-Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-
56 Peg3-Peg3)-AQPvAFVEWLLAEPSSGAPPPS-NH2
Synthesis of compound no. 10
Solid phase peptide synthesis was performed on a CEM Liberty Peptide Synthesizer using standard Fmoc chemistry. TentaGel S Ram S resin (1 ,05 g; 0.25 mmol/g) was swelled in DMF (10 ml) prior to use and transferred between tube and reaction vessel using DCM and DMF.
Coupling An Fmoc-amino acid in DMF/DCM (2:1 ; 0.2 M; 5 ml) was added to the resin in a CEM Discover microwave unit together with COMU/DMF (0.5 M; 2 ml) and DIPEA-DMF/DCM (2:1 ) (2.0 M; 1 ml). The coupling mixture was heated to 75°C for 5 min while nitrogen was bubbled through the mixture. The resin was then washed with DMF (4 x 10 ml). Fmoc- Tyr(OtBu)-Ser(Psi Me,Me)-OH pseudoproline was used for amino acid number 29 and 30 counting from the C-terminal. Lys17 was incorporated as Fmoc-Lys(Dde)-OH for orthogonal coupling. The first 9 amino acids and amino acid number 24 (counting from the C-terminal) was double couple meaning the building block was coupled twice before deprotection. Boc- Tyr(tBu)-OH was incorporated as the final building block in the N-terminal. Deprotection
Piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40°C). The reaction vessel was drained and a second portion of piperidine/DMF (20%; 10 ml) was added and heated (75°C; 3 min.) again. The resin was then washed with DMF (6 x 10 ml). Side chain acylation
While the peptide was still attached to the resin, the orthogonal side chain protective group was selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 x 15 min. The unprotected lysine side chain was first coupled with Fmoc-Glu-OtBu and the two Peg3 buildingblocks using standard coupling and deprotection conditions as explained aboved. Lastly the lipophilic moiety was incporated as a 17-carboxy-heptadecanoic acid mono tert butyl ester again using standard coupling conditions.
Cleavage
The resin was washed with EtOH (3 x 0 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.). The crude peptide was cleaved from the resin by treatment with TFA/TIS/H2O (95/2.5/2.5; 60 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
HPLC purification of the crude peptide
The crude peptide was first purified from 45% by preparative reverse phase HPLC using a PerSeptive Biosystems VISION Workstation equipped with a Gemini NX 5μ C-18 110A,
10x250 mm column and a fraction collector and run at 35 ml/min with a gradient of buffer A (0.1% TFA, aq.) and buffer B (0.1% TFA, 90% MeCN, aq.). Fractions were analyzed by analytical HPLC and MS and relevant fractions were pooled and lyophilized. The product (96 mg) was analysed to give a purity of 91 % as characterized by HPLC and MS. Calculated monoisotopic mass = 4921 ,51 , found 4921 ,45.
Example 2
Human GIP receptor (GIP R) and GLP-1 receptor (GLP-1 R) activity assay
In vitro effects of peptide conjugates of the invention were assessed by measuring the induction of cAMP following stimulation of the respective receptor by GIP, GLP1 or analogues of these, as outlined in the invention, using the AlphaSceen® cAMP kit from Perkin-Elmer according to instructions. Briefly, HEK293 cells expressing the human GIP R or GLP-1 R (stable cell lines generated through transfection of the cDNA for human GIP R or GLP-1 and selection of stable clones) were seeded at 30,000 cells/well in 96-well microtiter plates coated with 0.01 % poly-L-lysine, and grown for 1 day in culture in 200 μΙ growth medium (DMEM, 10% FCS, Penicillin (100 lU/ml), Streptomycin (100 pg/ml)). On the day of analysis, growth medium was removed and the cells were washed once with 150 ml Tyrode's buffer (Tyrode's Salts (9.6 g/l), 10 mM HEPES, pH 7.4). Cells were then incubated in 100 ml Assay buffer
(0.1 % W/V Alkali-treated Casein and 100 μΜ IBMX in Tyrode's Buffer) containing increasing concentrations of control and test compounds for 15 min at 37° C. The Assay buffer was removed and cells are lysed in 80 μΙ Lysis buffer (0.1 % w/v BSA, 5 mM HEPES, 0.3 % v/v Tween-20) per well. From each well 10 μΙ lysed cells was transferred to a 384-well plate and mixed with 15 μΙ bead-mix (1 Unit/15 μΙ anti-cAMP Acceptor Beads, 1 Unit/15 μΙ Donor Beads, and 1 Unit/15 μΙ Biotinylated cAMP in Assay Buffer). The plates were mixed and incubated in the dark for an hour at room temperature before measuring using an Envision™ plate reader (Perkin-Elmer). Results were converted into cAMP concentrations using a cAMP standard curve prepared in KRBH buffer containing 0.1% (v/v) DMSO. The resulting cAMP curves were plotted as absolute cAMP concentrations (nM) over log (test compound concentration) and analyzed using the curve fitting program XLfit. Parameters calculated to describe both the potency as well as the agonistic activity of each test compound on the receptors were:
EC50, a concentration resulting in a half-maximal elevation of cAMP levels, reflecting the potency of the test compound. The results are summarized in Table 2, 2a and 3. The most comprehensive data are summarized in Table 3. Table 2: EC50 average values of the compounds on the GIP-R and GLP1-R compared to control peptides.
Figure imgf000055_0001
NT: Not Tested
* These EC50 values (hGIP-R and GLP1-R) for compound 14 are believed to be in error. Table 2a: A secondary assay study with EC50 average values of the compounds 1 to 21 on the GIP-R and GLP1-R.
Figure imgf000056_0001
Table 3: EC50 average values of all the compounds on the GIP-R and GLP1-R.
Figure imgf000056_0002
0.008 0.015
0.011 0.006
0.014 0.022
0.007 0.014
0.010 0.011
0.007 0.011
0.060 0.061
0.200 0.044
0.260 0.011
0.009 0.011
0.580 0.014
0.060 0.061
0.024 0.015
0.025 0.033
0.017 0.035
0.008 0.017
0.018 0.056
0.009 0.014
0.012 0.015
0.016 0.012
0.010 0.015
0.017 0.014
0.005 0.012
0.011 0.006
0.023 0.021
0.015 0.038
0.009 0.017
0.005 0.016
0.007 0.015
0.005 0.024
0.006 0.010
0.005 0.016
0.006 0.052
0.009 0.053
0.007 0.015
0.005 0.017
0.010 0.012
0.006 0.014
0.016 0.012
0.016 0.013
0.025 0.033 Example 3
Pharmacokinetics of selected compounds in mice
Method
C57BL/6J mice (males with a body weight of approximately 25 g) were given either a single subcutaneous (s.c.) bolus or a single intravenous (i.v.) bolus of each peptide to be tested.
Following s.c. administration of the selected compounds (50, 100 or 200 nmol/kg), blood samples were drawn at 8 (eight) timepoints up to 72 hours post-dose. Following i.v.
administration of the selected compounds (50, 100 or 200 nmol/kg), blood samples were drawn at 8 (eight) timepoints up to 48 hours post-dose. Blood samples were drawn by sublingual bleeding. The dosing vehicle was a phosphate buffer containing mannitol (pH 7.5).
At each sampling time point, samples from two mice were drawn, i.e. 16 mice were included for each compound and each administration route. The mice were euthanized immediately after blood sampling by cervical dislocation. Plasma samples were analyzed after solid phase extraction (SPE) or protein precipitation followed by liquid chromatography mass
spectrometry (LC-MS/MS). Mean plasma concentrations were used for calculation of the pharmacokinetic parameters using the non-compartmental approach in Phoenix WinNonlin 6.3. Plasma terminal elimination half-life (T½) was determined as Ιη(2)/λζ where λζ is the magnitude of the slope of the log linear regression of the log concentration versus time profile during the terminal phase. Bioavailability was determined as AUQnf (s.c.) / AUCinf (/.v.) x 100, where AUCmf is the area under the plasma concentration - time curve extrapolated to infinity (AUCinf = AUCiast + Clast/λζ, where Ciast is the last observed plasma concentration). Tmax is the post-dose time where the maximal plasma concentration was observed. The results are summarized in Table 4.
Table 4. Terminal elimination half-life (h) and bioavailability in mice following s.c. and i.v. administration of selected compounds.
Figure imgf000059_0001
-: Parameter not calculated
*: The bioavailability was capped to 100%
Example 4
IPGTT (Intraperitoneal Glucose Tolerance Test) in diabetic db/db mice.
Male diabetic db/db (BKS.Cg-Dock7m+/+LeprdbJ) mice (Charles River, France), were maintained on normal chow (Altromin 1324, Brogaarden A/S, Gentofte, Denmark) and domestic quality water with added citric acid to pH ~ 3.6. The animals were housed in groups of n = 4 in a light-, temperature-, and humidity-controlled room (12:12 h light-dark cycle, with lights on at 06.00-18.00 hr; 23 ± 0.5°C; 50-80% relative humidity). Mice, 1 1-12 weeks old, were fasted for 5 hr before the IPGTT. GIP-GLP-1 dual acting receptor agonists (0.5 and 5 nmol/kg) and vehicle were administered subcutaneously (s.c.) 22 hours before the intraperitoneal (i.p.) injection of glucose (t = 0 min; 1 g/kg; 5 ml/kg). The GLP-1 analogue liraglutide (10 nmol/kg) was administered subcutaneously 4 hours before the i.p. injection of glucose. Tail vein blood was sampled at time t = 0 (before glucose administration), 15, 30, 60, 120, and 180 min for measurements of blood glucose. Results are shown in Figure 1. Example 5
Sub-chronic effects of GIP-GLP-1 receptor dual acting agonists on body weight, food intake, glucose tolerance and fasted blood glucose in diet-induced obese (DIP) C57BL/6J mice
Male C57BL/6J mice (Taconic A/S, Denmark) fed high-fat diet (60% of total energy from fat, D12492, Research Diet Inc.) for approximately 6 months were used. The animals were housed in groups of n = 3-4 in a light-, temperature-, and humidity-controlled room (12:12 h light-dark cycle, with lights on at 06.00-18.00 hr; 20-22X; 50-80% relative humidity). Mice from cages of 4 were split into two cages (2 mice per cage) two weeks prior to start of the mock phase. All mice were mock-treated (once daily s.c. injection of vehicle) for a week to acclimatize the animals to handling and injections. Subsequently, the mice were stratified according to body weight into 6 groups (n = 7-9). The average starting body weight was 45-46 grams. Animals were thereafter treated once every third day with s.c. injections (5 ml/kg) of vehicle (25 mM phosphate, 125 mM sodium chloride buffer, pH 7.4), or GIP-GLP-1 dual acting receptor agonists (3 nmol/kg). First day of dosing was on day 0 and last day of dosing on day 18. The daily injections were given in the morning (at 8.00-9.00). Body weight was determined daily throughout the study. Food and water intake per cage were measured every third day of the study (in conjunction with dosing). On day 12, animals were fasted for 5 hours and an oral glucose tolerance test (OGTT) was performed. The animals were dosed in the morning 5 hour before the oral gavage of glucose (t = 0 min; 2 g/kg; 5 ml/kg). Tail vein blood was sampled at time t = 0 (before glucose administration), 15, 30, 60, 120, and 180 min for measurements of blood glucose. On day 18, animals were fasted for 5 hours, and blood samples were taken for measurements of blood glucose. The animals were dosed in the morning 5 hour before the blood sampling. After the final blood sampling, the mice were euthanized. Results are shown in Figure 2 - 5.
Statistical analyses were performed using Graph Pad Prism version 5. The measured parameters were compared using one-way or two-way ANOVAs followed by Dunnett's Multiple Comparison Tests vs. vehicle group or by Bonferroni post tests vs. vehicle group, respectively. Differences were considered statistically significant at p < 0.05. Statistical differences vs vehicle: *p<0.05, **p<0.01 , ***p<0.001.

Claims

Claims:
1. A GIP analogue having the general Formula I:
R -Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-X10-Ser-lle-X13-Leu-X15-X16-Ψ-Ala-X19-X20-X21-
Phe-X23-X24-Trp-Leu-X27-X28-X29-X30-R2 (I)
wherein
R1 is H, C1-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X10 is selected from Tyr and Leu;
X13 is selected from Ala, Tyr and Aib;
X15 is selected from Asp and Glu;
X16 is selected from Glu and Lys;
X19 is selected from Gin and Ala;
X20 is selected from Lys and Arg;
X21 is selected from Ala and Glu;
X23 is selected from Val and lie;
X24 is selected from Asn and Glu;
X27 is selected from Leu, Glu and Val;
X28 is selected from Ala, Ser and Arg;
X29 is selected from Aib, Ala, and Gin;
X30 is selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1; where:
-Z1 is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -S02-;
(if present) is a spacer of formula -Y-V-X- n connecting Z1 to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO- SO- or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NH2 or -OH;
or a pharmaceutically acceptable salt or solvate thereof.
2. A GIP analogue having the general Formula lb:
R1-Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-X10-Ser-lle-X13-Leu-X15-X1 β-Ψ-Ala-XI 9-X20-X21 -
Phe-X23-X24-Trp-Leu-X27-X28-X29-X30-R2 (lb)
wherein
R1 is H, C1-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X10 is selected from Tyr and Leu;
X13 is selected from Ala, Tyr and Aib;
X15 is selected from Asp and Glu;
X16 is selected from Glu and Lys;
X19 is selected from Gin and Ala;
X20 is selected from Lys and Arg;
X21 is selected from Ala and Glu;
X23 is selected from Val and lie;
X24 is selected from Asn and Glu;
X27 is selected from Leu, Glu and Val;
X28 is selected from Ala, Ser and Arg;
X29 is selected from Aib, Ala, Glu and Gin; X30 is selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, ΡΓο-Ser-Ser-Gly-Ala-Pro· Pro-Pro-Ser and Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser;
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z or -Z2-Z1; where:
-Z1 is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2, -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO- or -S02-;
-Z2- (if present) is a spacer of formula:
-Y-V-X- n connecting Z1 to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO- SO-, or S02-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NH2or -OH;
or a pharmaceutically acceptable salt or solvate thereof.
3. A GIP analogue having the general Formula II:
R1-Tyr-X2-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-lle-X13-Leu-X15-Glu-Ψ-Ala-Ala-Arg-X21-
Phe-X23-X24-Trp-Leu-Leu-X28-X29-X30-R2 (II)
wherein
R1 is H, C1-4 alkyl, acetyl, formyl, benzoyl, trifluoroacetyl or pGlu;
X2 is selected from Aib and D-Ala;
X13 is selected from Ala, Tyr;
X15 is selected from Asp and Glu;
X21 is selected from Ala and Glu;
X23 is selected from Val and lie;
X24 is selected from Asn and Glu;
X28 is selected from Ala, Ser;
X29 is selected from Ala, Glu and Gin; and
X30 is selected from Lys, Gly and Y1 , or is absent;
Y1 (when present) is selected from Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser, Lys-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser, Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser, Pro-Ser-Ser-Gly-Ala-Pro- Pro-Pro-Ser and Pro-Ser-Ser-Gly-A!a-Pro-Pro-Ser;
Ψ is a residue of Lys, Arg, Orn or Cys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1; where:
-Z is a fatty chain having a polar group at one end of the chain and a connection to Ψ or Z2 -X- at the end of the chain distal from the polar group, wherein the polar group comprises a carboxylic acid or a carboxylic acid bioisostere, a phosphonic acid, or a sulfonic acid group; and -X- is a bond, -CO-, -SO-, or -SO2-; -Z2- (if present) is a spacer of formula:
-Y-V-X- n connecting Z to Ψ; wherein: each Y is independently -NH, -NR, -S or -O, where R is alkyl, a protecting group or forms a linkage to another part of the spacer Z2; each X is independently a bond, CO-, SO- or SO2-; with the proviso that when Y is -S, the X to which it is bound is a bond; each V is independently a bivalent organic moiety linking Y and X; and n is 1-10; and
R2 is -NH2 or -OH;
or a pharmaceutically acceptable salt or solvate thereof.
4. A GIP analogue according to any one of claims 1 to 3 comprising one of the following residues or combinations of residues:
Gln19, Arg20, Ala21 ;
Aib2, Gln19, Arg20, Ala21 ;
Aib2, Ala13, Gln19, Arg20, Ala21 ;
Asp15, Gln19, Arg20, Ala21 ;
Lys16, Gln19, Arg20, Ala21 ;
Aib2, Ala13, Asp15, Gln19, Arg20, Ala21 ;
Aib2, Asp15, Gln19, Arg20, Ala21 ;
Aib2, Lys16, Gin 19, Arg20, Ala21 ;
Aib2, Asp15, Lys16, Gln19, Arg20, Ala21 ;
Leu27, Ala28, Gln29;
Glu24, Leu27, Ala28, Gln29;
Gln19, Arg20, Ala21 ; Leu27, Ala28, Gln29;
Gln19, Arg20, Ala21 ; Glu24, Leu27, Ala28, Gln29;
Asp15, Gln19, Arg20, Ala21 ;
Glu15, Gln19, Arg20, Ala21 ;
Aib2, Glu15, Gln19, Arg20, Ala21 ;
Aib2, Glu15, Lys16, Gln19, Arg20, Ala21 ;
Glu15, Leu27, Ala28, Gln29;
Glu15, Gln19, Arg20, Ala21 ; Leu27, Ala28, Gln29;
Glu15, Gln19, Arg20, Ala21 , Glu24;
Aib2, Glu15, Gln19, Arg20, Ala21 , Glu24;
Aib2, Ala13, Asp15, Gln19, Arg20, Ala21 , Glu24; Aib2, Ala13, Asp15, Gln19, Arg20, Ile23, Glu24;
Aib2, Glu15, Lys16, Gln19, Arg20, Ala21 , Glu24;
Aib2, Ala13, Gln19, Arg20, Ala21 , Glu24;
Asp15, Ile23, Gln29
Glu15, Glu24, Leu27, Ala28, Gln29;
Glu15, Gln19, Arg20, Ala21 ; Glu24, Leu27, Ala28, Gln29;
Ala19, Lys20, Glu21 ;
Ala13, Ala19, Lys20, Glu21 ;
Ala19, Lys20, Glu21 , Ser28;
Ala19, Lys20, Glu21 , Ala29;
Ala19, Lys20, Glu21 , Ser28, Ala29;
Glu15, Ala19, Lys20, Glu21 ;
Ala13, Asp15, Ala19, Lys20, Glu21 ;
Glu15, Ala19, Lys20, Glu21 , Ser28;
Glu15, Ala19, Lys20, Glu21 , Ala29;
Ala13, Asp15, Ala19, Lys20, Glu21 , Ala29;
Glu15, Ala19, Lys20, Glu21 , Ser28, Ala29;
Glu16, Ala19, Lys20, Glu21 ;
Ala13, Asp15, Glu24, Gln29
Glu16, Ala19, Lys20, Glu21 , Ser28;
Glu16, Ala19, Lys20, Glu21 , Ala29;
Glu16, Ala19, Lys20, Glu21 , Ser28, Ala29;
Ala13, Asp15, Ile23;
Glu27, Ser28, Ala29;
Glu16, Glu27, Ser28, Ala29;
Ala19, Lys20, Glu21 , Glu27, Ser28, Ala29;
Glu16, Ala19, Lys20, Glu21 , Glu27, Ser28, Ala29;
Val27, Aib29;
Asn24, Val27 Aib29;
Asn24, Aib29;
Ala13, Asp15, Glu27;
Glu15, Glu24;
Glu15, Glu24; and
Leui O, or any of the above in combination with Leu10.
5. A GIP analogue according to any one of claims 1 to 3 wherein positions 1 to 29 of the GIP analogue have a maximum of 8 changes compared to the sequence:
Y-Aib-EGTFTSDYSIYLDKKAQRAFVEWLLAQ.
6. A GIP analogue according to claim 5 wherein, if positions 1 to 29 of the GIP analogue have 6 or more changes compared to that sequence, the analogue possesses all of Ala20, Lys21 and Glu22 and optionally one or both of Ser28 and Ala29.
7. A GIP analogue according to claim 5 wherein, if the analogue does not possess Ala19, Lys20 and Glu21 , then positions 1 to 29 have 4 or fewer changes compared to that sequence.
8. A GIP analogue according to claim 1 or claim 4 wherein positions 1 to 29 of the GIP analogue have a maximum of 6 changes compared to the sequence
Y-Aib-EGTFTSDYSIYLEKKAAKEFVEWLLSA or
Y-Aib-EGTFTSDYSIYLDEKAAKEFIEWLESA
9. A GIP analogue according to claim 8 wherein the analogue possesses one, two, or all of Ala19, Lys20 and Glu21.
10. A GIP analogue according to claim 9, wherein the analogue additionally possesses one or more of the following:
Glu15 and/or Glu16;
Ser28 and/or AIa29;
Val27 and/or Aib29;
Asn24, Val27 and/or Aib29;
Asn24 and/or Aib29;
Glu15 and/or Glu27;
Ala13, Glu15 and/or Glu16;
Ala13, Ser28 and/or Ala29;
Ala13, Val27 and/or Aib29;
Ala13, Asn24, Val27 and/or Aib29;
Ala13, Asn24 and/or Aib29;
Ala13, Glu15 and/orGlu27;
Asp15 and/or Glu16;
Asp15, Ser28 and/or Ala29;
Asp15, Val27 and/or Aib29; Asp15, Asn24, Val27 and/or Aib29;
Asp15, Asn24, Aib29;
Asp15, Glu27;
Glu15 or Glu16 or lle23;
Ile23, Ser28 and/or Ala29;
Ile23, Val27 and/or, Aib29;
Ile23, Asn24, Val27 and/or Aib29;
Ile23, Asn24 and/or Aib29;
Glu15, Ile23 and/or Glu27;
Aib2 and/or Ala13;
Aib2 and/or Tyr13;
Asp15 and/or Glu16;
Ile23 and/or Glu24;
DAIa, Ser28 and/or Ala29;
Asn24 and/or Arg20;
Asn24 and/or Ala29.
1 1. A GIP analogue according to any one of the preceding claims possessing one of the following combinations of residues at the variable positions between 1 and 29:
Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29; D-Ala2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Glu15, Lys16, Ala19, Lys20, Glu21 , Val23, Glu24, Leu27, Ser28, Ala29;
Aib2, Tyr10, Aib13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Leu27, Ala28, Aib29;
Aib2, Tyr10, Tyr13, Asp15, Glu16, Ala19, Lys20, Glu21 , Ile23, Glu24, Glu27, Ser28, Ala29;
Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Val27, Ala28, Aib29; Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Tyr13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Arg28, Ala29;
Aib2, Leu10, Ala13, Asp15, Lys 6, Gln19, Arg20, Ala21 , Val23, Asn24, Val27, Ala28 Aib29;
Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Val27, Ala28, Aib29; Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Val23, Glu24, Glu27, Ala28, Gln29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Aia28, Gln29; D-Ala2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, Tyr10, Ala13, Glu15, Lys16, Ala19, Lys20, Glu21 , Val23, Glu24, Leu27, Ser28, Ala29; Aib2, Tyr10, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Ala28, Gln29;
Aib2, TyrlO, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Val23, Asn24, Leu27, Ala28, Aib29;
Aib2, TyrlO, Ala13, Asp15, Glu16, Ala19, Lys20, Glu21 , Ile23, Glu24, Glu27, Ser28, Ala29;
Aib2, TyrlO, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Val23, Glu24, Leu27, Arg28, Ala29;
Aib2, TyrlO, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29; D-Ala2, TyrlO, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ne23, Glu24, Leu27, Ala28, Gln29;
Aib2, TyrlO, Tyr13, Glu15, Lys16, Ala19, Lys20, Glu21 , Ile23, Glu24, Leu27, Ser28, Ala29;
Aib2, TyrlO, Aib13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, TyrlO, Tyr13, Asp15, Lys16, Gln19, Arg20, Ala21 , Iie23, Asn24, Leu27, Ala28, Aib29;
Aib2, TyrlO, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Asn24, Val27, Ala28, Aib29; Aib2, TyrlO, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Ala28, Gln29;
Aib2, TyrlO, Tyr13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Leu27, Arg28, Ala29;
Aib2, Leu10, AIa13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Asn24, Val27, Ala28 Aib29;
Aib2, TyrlO, Ala13, Asp15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Val27, Ala28, Aib29; Aib2, TyrlO, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29;
Aib2, Tyrl O, Ala13, Glu15, Lys16, Gln19, Arg20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29;
Aib2, Leu10, Ala13, Glu15, Lys16, Gln19, Arg 20, Ala21 , Ile23, Glu24, Glu27, Ala28, Gln29.
12. A GIP analogue according to any one of claims 1 to 3 wherein residues 1-29 of Formula I have the sequence:
Y-Ai b-EGTFTSDYSIYLD ΚΨ AQ RA F VEWLL AQ ;
Y-DAIa-EGTFTSDYSIYLDKH^AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEKMJAAKEFVEWLLSA;
Y-Ai b- EGT FTS D YS I -Ai b-L D ΚΨΑΟ RAF VEWLL AQ ;
Y-Aib-EGTFTSDYSIYLDKH'AQRAFVNWLLA-Aib;
Y-Aib-EGTFTSDYSIYLDEMJAAKEFIEWLESA;
Y-Ai b- EGT FTS D YS I AL D ΚΨ AQ RAFVN W L VA-Ai b ;
Y-Aib-EGTFTSDYSIALEK'+'AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEKMJAQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEI^AQRAFVEWLLRA;
Y-Aib-EGTFTSDLSIALDKΨAQRAFVNWLVA-Aib;
Y-Ai b- E GT FTS D YS I AL D ΚΨ AQ RAF VEW LVA-Ai b ;
Y-Ai b- E GT FTS D YS I AL E ΚΨ AQ RA F VEWLE AQ ;
Y-Aib-EGTFTSDLSIALEKMJAQRAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEKMJAQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALEK JAQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK4JAQRAFVEWLLAQ;
Y-Ai b-EGTFTSDYSIALD ΚΨ AQ RAF VEW LL AQ ; Y-DAIa-EGTFTSDYSIALD^AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALD^AQRAFVEWLLAAP;
Y-Aib-EGTFTSDYSIALDKΨAAKEFVEWLLSA
Y-Aib-EGTFTSDYSIALDEΨAQRAFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKMJAQKAFVEWLLAA
Υ-Α^-ΕΟΤΡΤ50Υ8ΙΑίΟΕΨΑΟΡ<ΑΡνΕννΐ_Ι_ΑΑ
Y-Aib-EGTFTSDYSIYLD^AQREFVEWLLAQ
Y-Aίb-EGTFTSDYSIALDKΨAQREFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKMJAQKEFVEWLLAA
Y-Aib-EGTFTSDYSIALD^AQRAFIEWLLAQ- Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAQ
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAA
Y-Aib-EGTFTSDYSIYLDKΨAQRAFVEWLLAE; or
Y-Ai b-EGTFTS DYS I ΑΙ_ΟΚΨ AQ RAFVEWLLAE.
13. A GIP analogue according to any one of claims 1 to 3 wherein the peptide backbone
(Formula i) has the sequence:
Y-Aib-EGTFTSDYSIYLD^AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIYLD^AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLE^AAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSI-Aib-LDKTAQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLD^AQRAFVNWLLA-Aib-K;
Y-Aib-EGTFTSDYSIYLDE4WU EFIEWLESA;
Y-Aib-EGTFTSDYSIALDKTAQRAFVNWLVA-Aib-KPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEKHJAQRAFVEWLLAQ K;
Y-Aib-EGTFTSDLSIALEKΨAQRAFVEWLLAQK;
Y-Aib-EGTFTSDYSIYLEKΨAQRAFVEWLLRA;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVNWLVA-Aib-K;
Y-Aib-EGTFTSDLSIALDKΨAQRAFVNWLVA-Aib-K;
Y-Ai b-EGTFTSDYSIALD ΚΨ AQ RAF VEW LVA-Ai b-K;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLEAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLEAQK;
Y-Aib-EGTFTSDLSIALEK4 3RAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALEKΨAQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALEKΨAQRAFVEWLLAQGPSSGAP PS;
Y-Aib-EGTFTSDLSIALE^AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAQKPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALD^AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK AQRAFVEWLLAAPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKΨAAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKTAQRAFVEWLLAQGPSSGAPPPS;
Υ-Αί^ΕΟΤΡΤβΟΥβΙΑίΟΕΨΑΟΡίΑΡνΕ ν ΑΟΟΡεεθΑΡΡΡε;
Y-Aib-EGTFTSDYSIALDETAQRAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKTAQKAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDKTAQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKTAQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKΨAQKEFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKTAQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDKTAQRAFIEWLLAQGPSSGAPPPS-;
Y-Aib-EGTFTSDYSIALD^AQRAFVEWLLAQGPSSGAPPP;
Y-Aib-EGTFTSDYSIALDKTAQRAFVEWLLAQGPSSGAPPPS; Y-Aib-EGTFTSDYSIALD^AQKEFVEWLLAAGPSSGAPPPS
Y-Aib-EGTFTSDLSIALE^AQRAFVEWLLAQGPSSGAPPPS
Y-Aib-EGTFTSDYSIYLD^AQRAFVEWLLAEGPSSGAPPPS
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAEGPSSGAPPPS or
Y-Aib-EGTFTSDYSIALDKΨAQRAFVEWLLAEPSSGAPPPS.
14. A GIP analogue according to any one of the preceding claims wherein Ψ is a residue of Lys in which the side chain is conjugated to a substituent having the formula -Z1 or -Z2-Z1.
15. A GIP analogue according to any one of the preceding claims wherein the substituent has the formula-Z2Z1.so
16. A GIP analogue according to any one of the preceding claims wherein Z1 is HOOC- B-Ci6-22 aIkylene-(CO)-, wherein B is a bond.
17. A GIP analogue according to any one of the preceding claims wherein Z1 is:
17 carboxyheptadecanoyl [HOOC-(CH2)i6-(CO)-];
19-carboxynonadecanoyl [HOOC-(CH2)is-(CO)-]; or
21-carboxyhenicosanoyl [HOOC-(CH2)2o-(CO)-].
18. A GIP analogue according to any one of the preceding claims wherein Z2 comprises a residue of isoGlu, Dapa, or Peg3.
19. A GIP analogue according to any one of the preceding claims wherein-Z2-Z1 is: (i) [17-Carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3
Figure imgf000071_0001
(ii) [17-Carboxy-heptadecanoyl]-isoGlu
Figure imgf000072_0001
(iii) [17-Carboxy-heptadecanoyl]-Peg3-Peg3-isoGlu
Figure imgf000072_0002
(iv) [17-Carboxy-heptadecanoyl]-isoGlu-GSGSGG
Figure imgf000072_0003
(v) [17-Carboxy-heptadecanoyl]-AA-Peg3-Peg3
Figure imgf000072_0004
(vi) ([19-Carboxy-nonadecanoyl]-AA-Peg3-Peg3-Peg3)
Figure imgf000073_0001
Figure imgf000073_0002
Figure imgf000073_0003
Figure imgf000074_0001
Figure imgf000074_0002
(xi) [19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3
Figure imgf000074_0003
(xii) (19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3
Figure imgf000075_0001
or
(xiii) (19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg6
Figure imgf000075_0002
20. A GIP analogue according to any one of claims 1 to 3 wherein residues 1-29 of
Formula I have the sequence:
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)-AQRAFVEWLLAQ;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-GSGSGG)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)-AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSA;
Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLLA-Aib; Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFIEWLESA;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVNWLVA-Aib;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQ RAFVEWL VA-Ai b ;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQPvAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyj]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQ.
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLRA;
Y-DAIa-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Peg3-Peg3)-AQRAFVEWLLAQ; Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)-AQRAFVEWLLAQ; Y-Aib- EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3-Peg3)-AQRAFVEWLLAQ; Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSA; Y-Aib-EGTFTSDYSIALDE-K([19- Peg3-Peg3)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDE-K([19- Peg3- Peg3)-
AQ AFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-K([19- Peg3- Peg3)-
AQKAFVEWLLAA;
Y-Aib-EGTFTSDYSIYLDK-K([19- Peg3- Peg3)-
AQREFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-K([19- Peg3- ■Peg3)- AQREFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-K([19- Peg3- Peg3)-
AQKEFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-K([19- Peg3- Peg3)-
AQKEFVEWLLAA;
Y-Aib-EGTFTSDYSIALDK-K([19- Peg3- Peg3)-
AQRAFIEWLLAQ;
Y-Ai b- EGTFTS D YS I AL D K-K( [ 17- carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-
AQRAFVEWLLAQ;
Y-Aib-EGTFTSDYSIALDK-K((19- Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3- Peg 3 )-AQ RA FVEW LL AQ ; or
Y-Aib-EGTFTSDYSIALDK-K((19- Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-
Peg3)-AQKEFVEWLLAA.
21. A GIP analogue according to any one of claims 1 to 3 wherein the peptide backbone (Formula I) has the sequence:
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu)- AQRAFVEWLLAQGPSSGAPPPS;
H-Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-GSGSGG)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSI-Aib-LDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLLA- Aib-K;
Y-Aib-EGTFTSDYSIYLDE-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AAKEFIEWLESA; Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-KPSSGAPPPS; Y-Aib-EGTFTSDYSIALDK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-KPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQK;
Y-Aib-EGTFTSDYSIYLEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLRA;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA-
Aib-K;
Y-Aib-EGTFTSDLSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVNWLVA- Aib-K;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLVA- Aib-K;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQK;
Y-Aib-EGTFTSDYSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLAQK; Y-Aib-EGTFTSDLSIALEK-K[19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLEAQK; Y-Aib-EGTFTSDYSIALEK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLEAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLAQK; Y-Aib-EGTFTSDYSIYLEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)-AQRAFVEWLLRA; Y-DAIa-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoy!]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-lsoGlu)- AQPvAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-Dapa-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDLSIALEK-K([17-carboxy-heptadecanoyl]-isoGiu-Peg3-Peg3)- AQRAFVEWLEAQK;
Y-Aib-EGTFTSDLSIALEK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-DAIa-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQKPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AAKEFVEWLLSAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoy!]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDE-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAAGPSSGAPPPS; Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKAFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQREFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFI EWLLAQG PSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([17-carboxy-heptadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3)- AQRAFVEWLLAQGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K((19-Carboxy-nonadecanoyl)-[(Piperazine-1-yl)-acetyl]-Peg3-Peg3)- AQKEFVEWLLAAGPSSGAPPPS;
Y-Aib-EGTFTSDYSIYLDK-K([19-Carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS;
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEGPSSGAPPPS; or
Y-Aib-EGTFTSDYSIALDK-K([19-carboxy-nonadecanoyl]-isoGlu-Peg3-Peg3)- AQRAFVEWLLAEPSSGAPPPS.
22. A pharmaceutical composition comprising a GIP analogue according to any one of claims 1 to 21 , or a pharmaceutically acceptable salt or solvate thereof, in admixture with a carrier.
23. A pharmaceutical composition according to claim 22 formulated as a liquid suitable for administration by injection or infusion, or formulated to cause slow release of said GIP
analogue.
24. A GIP analogue according to any one of claims 1 to 21 , or a pharmaceutically
acceptable salt or solvate thereof, for use in a method of medical treatment
25. A GIP analogue according to any one of claims 1 to 21 , or a pharmaceutically
acceptable salt or solvate thereof, for use in a method of treatment and/or prevention of a metabolic disorder.
26 A GIP analogue for use according to claim 25 wherein the metabolic disorder is diabetes or a diabetes related disorder, or obesity or an obesity related disorder.
27. A GIP analogue for use according to claim 26 wherein the diabetes related disorder is insulin resistance, glucose intolerance, increased fasting glucose, hypoglycemia (for example induced by insulin treatment), pre-diabetes, type 1 diabetes, type 2 diabetes, gestational diabetes hypertension, dyslipidemia, bone related disorder or a combination thereof.
28. A GIP analogue for use according to claim 26 wherein the diabetes related disorder is atherosclerosis, arteriosclerosis, coronary heart disease, peripheral artery disease, stroke; or is a condition associated with atherogenic dyslipidemia, a blood fat disorder, elevated blood pressure, hypertension, a prothrombotic state, or a proinflammatory state.
29. A GIP analogue or pharmaceutically acceptable salt or solvate thereof for use according to claim 26 wherein the diabetes-related disorder is osteoporosis, including increased risk of bone fracture.
30. A GIP analogue for use according to claim 28 wherein the blood fat disorder is high triglycerides, low HDL cholesterol, high LDL cholesterol, plaque buildup in artery walls, or a combination thereof.
31. A GIP analogue for use according to claim 28 wherein the prothrombotic state comprises high fibrinogen levels in the blood or high plasminogen activator inhibitor-1 levels in the blood.
32. A GIP analogue for use according to claim 28 wherein the proinflammatory state comprises an elevated C-reactive protein level in the blood.
33. A GIP analogue for use according to claim 26 wherein the obesity related disorder is obesity linked inflammation, obesity linked gallbladder disease or obesity induced sleep apnea, or may be associated with a condition selected from atherogenic dyslipidemia, blood fat disorders, elevated blood pressure, hypertension, a prothrombotic state, and a
proinflammatory state, or a combination thereof.
PCT/EP2014/073970 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods Ceased WO2015067715A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CN201480060723.9A CN105849122B (en) 2013-11-06 2014-11-06 GIP-GLP-1 dual agonist compounds and methods
EA201690660A EA035466B9 (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods
US15/034,778 US10093713B2 (en) 2013-11-06 2014-11-06 GIP-GLP-1 dual agonist compounds and methods
CA2929459A CA2929459C (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods
MX2016005556A MX2016005556A (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods.
KR1020167014987A KR102310389B1 (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods
JP2016527453A JP6682432B2 (en) 2013-11-06 2014-11-06 GIP-GLP-1 dual agonist compounds and methods
BR112016009889-7A BR112016009889B1 (en) 2013-11-06 2014-11-06 gip analogue, pharmaceutical composition comprising a gip analogue, or a pharmaceutically acceptable salt thereof, and its use
EP14802336.9A EP3065767B1 (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods
AU2014345569A AU2014345569B2 (en) 2013-11-06 2014-11-06 GIP-GLP-1 dual agonist compounds and methods
US16/112,926 US11008375B2 (en) 2013-11-06 2018-08-27 GIP-GLP-1 dual agonist compounds and methods

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP13191843.5 2013-11-06
EP13191843 2013-11-06
EP14176878.8 2014-07-14
EP14176878 2014-07-14

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/034,778 A-371-Of-International US10093713B2 (en) 2013-11-06 2014-11-06 GIP-GLP-1 dual agonist compounds and methods
US16/112,926 Continuation US11008375B2 (en) 2013-11-06 2018-08-27 GIP-GLP-1 dual agonist compounds and methods

Publications (2)

Publication Number Publication Date
WO2015067715A2 true WO2015067715A2 (en) 2015-05-14
WO2015067715A3 WO2015067715A3 (en) 2015-10-15

Family

ID=51947303

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2014/073970 Ceased WO2015067715A2 (en) 2013-11-06 2014-11-06 Gip-glp-1 dual agonist compounds and methods

Country Status (12)

Country Link
US (2) US10093713B2 (en)
EP (1) EP3065767B1 (en)
JP (2) JP6682432B2 (en)
KR (1) KR102310389B1 (en)
CN (1) CN105849122B (en)
AU (1) AU2014345569B2 (en)
BR (1) BR112016009889B1 (en)
CA (1) CA2929459C (en)
EA (1) EA035466B9 (en)
MX (1) MX2016005556A (en)
TW (1) TWI670281B (en)
WO (1) WO2015067715A2 (en)

Cited By (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017074714A1 (en) 2015-10-26 2017-05-04 Eli Lilly And Company Glucagon receptor agonists
CN106928086A (en) * 2015-12-31 2017-07-07 深圳翰宇药业股份有限公司 A kind of preparation method of long-chain compound
US9896495B2 (en) 2013-10-17 2018-02-20 Zealand Pharma A/S Acylated glucagon analogues
US9975939B2 (en) 2012-09-17 2018-05-22 Zealand Pharma A/S Glucagon analogues
US9988429B2 (en) 2013-10-17 2018-06-05 Zealand Pharma A/S Glucagon analogues
WO2018104561A1 (en) * 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
WO2018104558A1 (en) * 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
US10004786B2 (en) 2009-07-13 2018-06-26 Zealand Pharma A/S Acylated glucagon analogues
WO2018181864A1 (en) 2017-03-31 2018-10-04 Takeda Pharmaceutical Company Limited Gip receptor activating peptide
US10093713B2 (en) 2013-11-06 2018-10-09 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US10100097B2 (en) 2012-05-03 2018-10-16 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US10131702B2 (en) 2013-11-06 2018-11-20 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
WO2019066609A1 (en) 2017-09-29 2019-04-04 한미약품 주식회사 Protein conjugate comprising non-peptidyl polymer-coupled fatty acid derivative compound as linker and preparation method therefor
US10253078B2 (en) 2014-10-29 2019-04-09 Zealand Pharma A/S GIP agonist compounds and methods
WO2019125929A1 (en) * 2017-12-21 2019-06-27 Eli Lilly And Company Incretin analogs and uses thereof
WO2019125938A1 (en) * 2017-12-21 2019-06-27 Eli Lilly And Company Incretin analogs and uses thereof
US10336802B2 (en) 2015-04-16 2019-07-02 Zealand Pharma A/S Acylated glucagon analogue
US10442847B2 (en) 2012-07-23 2019-10-15 Zealand Pharma A/S Glucagon analogues
WO2020023386A1 (en) * 2018-07-23 2020-01-30 Eli Lilly And Company Gip/glp1 co-agonist compounds
US10604555B2 (en) 2018-05-04 2020-03-31 Novo Nordisk A/S GIP derivatives and uses thereof
WO2020249782A1 (en) * 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
WO2021150673A1 (en) * 2020-01-23 2021-07-29 Eli Lilly And Company Gip/glp1 co-agonist compounds
WO2021260530A1 (en) 2020-06-22 2021-12-30 Sun Pharmaceutical Industries Limited Long acting glp-1/gip dual agonists
CN113950482A (en) * 2019-02-21 2022-01-18 昂热大学 Peptides targeting GIP and GLP-2 receptors for the treatment of bone diseases
WO2022018185A1 (en) 2020-07-22 2022-01-27 Novo Nordisk A/S Glp-1 and gip receptor co-agonists
WO2022018186A1 (en) 2020-07-22 2022-01-27 Novo Nordisk A/S Co-agonists at glp-1 and gip receptors suitable for oral delivery
WO2022079639A1 (en) 2020-10-17 2022-04-21 Sun Pharmaceutical Industries Limited Glp-1/gip dual agonists
WO2022253202A1 (en) * 2021-06-01 2022-12-08 南京知和医药科技有限公司 Polypeptide derivative having effect of dual targeted activation of glp-1r and gipr, preparation method therefor, and use thereof
WO2023139187A1 (en) 2022-01-20 2023-07-27 Novo Nordisk A/S Glp-1/gip receptor co-agonist prodrugs and uses thereof
EP4294423A1 (en) * 2021-02-17 2023-12-27 Eli Lilly and Company Gip/glp1 dual agonist therapeutic methods
RU2815643C2 (en) * 2019-06-14 2024-03-19 Зилэнд Фарма А/С Pharmaceutical parenteral composition of double agonist glp1/2
WO2024165571A2 (en) 2023-02-06 2024-08-15 E-Therapeutics Plc Inhibitors of expression and/or function
WO2024252367A2 (en) 2023-06-09 2024-12-12 Sun Pharmaceutical Industries Limited Novel glp-1/gip dual and glp-1/gcg dual receptor agonists
US12318426B2 (en) 2021-01-20 2025-06-03 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
WO2025114501A1 (en) 2023-11-30 2025-06-05 Novo Nordisk A/S Tri-agonists of the glp-1, gip, and amylin receptors
WO2025125576A2 (en) 2023-12-15 2025-06-19 E-Therapeutics Plc Inhibitors of expression and/or function
WO2025133348A1 (en) 2023-12-22 2025-06-26 E-Therapeutics Plc Inhibitors of expression and/or function
US12343382B2 (en) 2018-07-23 2025-07-01 Eli Lilly And Company Methods of using a GIP/GLP1 co-agonist for therapy
WO2025160082A1 (en) * 2024-01-23 2025-07-31 Viking Therapeutics, Inc. Amylin analogs
WO2025147633A3 (en) * 2024-01-05 2025-08-28 Indiana University Research And Technology Corporation Gip/glp-1 co-agonists and their associated prodrugs
US12421282B2 (en) 2021-09-15 2025-09-23 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
WO2025196502A1 (en) 2024-03-20 2025-09-25 North Carolina Agricultural & Technical State University Choline kinase inhibitors as a therapeutic treatment for obesity
US12453758B2 (en) 2018-07-23 2025-10-28 Eli Lilly And Company Method of using a GIP/GLP1 co-agonist for diabetes
EP4686757A1 (en) 2024-07-31 2026-02-04 e-therapeutics PLC Inhibitors of expression and/or function
US12551534B2 (en) 2020-01-30 2026-02-17 Eli Lilly And Company Therapeutic uses of tirzepatide
EP4410827A4 (en) * 2021-09-02 2026-04-29 Sunshine Lake Pharma Co Ltd Dual-directed polypeptide and fusion protein targeting GLP-1/GIP and applications thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3067890A1 (en) * 2017-06-19 2018-12-27 Talengen International Limited Method for regulating and controling glp-1/glp-1r and drug
KR20210040818A (en) * 2019-10-04 2021-04-14 한미약품 주식회사 Composition of Glucagon and Dual GLP-1/GIP receptor agonist, and therapeutic use thereof
CN113383014B (en) * 2019-11-15 2024-06-18 江苏豪森药业集团有限公司 Dual receptor heavy agonist compound and pharmaceutical composition thereof
AR122579A1 (en) * 2020-06-12 2022-09-21 Lilly Co Eli PROCESS TO PREPARE A GLP-1/GLUCAGON DUAL AGONIST
EP4230640A4 (en) 2020-10-16 2024-11-20 Hanmi Pharm. Co., Ltd. Glp-1/gip dual agonist, long-acting conjugate thereof, and pharmaceutical composition comprising same
WO2022268029A1 (en) * 2021-06-21 2022-12-29 广东东阳光药业有限公司 Triple agonist for glp-1, gcg and gip receptors
WO2025226506A1 (en) * 2024-04-23 2025-10-30 Protagonist Therapeutics, Inc. Mono- and dual-agonist compounds of human glp1r and gipr for obesity & t2dm

Family Cites Families (171)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4288627A (en) 1980-02-12 1981-09-08 Phillips Petroleum Company Oxidation of thiols employing cobalt molybdate/triethylamine catalyst
NZ202757A (en) 1981-12-23 1985-11-08 Novo Industri As Peptides and medicaments
US5120712A (en) 1986-05-05 1992-06-09 The General Hospital Corporation Insulinotropic hormone
US5614492A (en) 1986-05-05 1997-03-25 The General Hospital Corporation Insulinotropic hormone GLP-1 (7-36) and uses thereof
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US5545618A (en) 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
ATE164852T1 (en) 1990-01-24 1998-04-15 Douglas I Buckley GLP-1 ANALOGUE USABLE IN DIABETES TREATMENT
DK0531372T4 (en) 1990-05-09 2004-08-09 Novozymes As Cellulase preparation comprising an endoglucanase enzyme
DK36392D0 (en) 1992-03-19 1992-03-19 Novo Nordisk As USE OF CHEMICAL COMPOUND
DK39892D0 (en) 1992-03-25 1992-03-25 Bernard Thorens PEPTIDE
US5846747A (en) 1992-03-25 1998-12-08 Novo Nordisk A/S Method for detecting glucagon-like peptide-1 antagonists and agonists
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
WO1995005848A1 (en) 1993-08-24 1995-03-02 Novo Nordisk A/S Protracted glp-1
CZ69596A3 (en) 1993-09-07 1997-06-11 Amylin Pharmaceuticals Inc Application of amylin, amylin agonist, amylin analog agonist or amylin antagonist for preparing a pharmaceutical preparation used for the control of gastrointestinal motility
US5705483A (en) 1993-12-09 1998-01-06 Eli Lilly And Company Glucagon-like insulinotropic peptides, compositions and methods
US5512549A (en) 1994-10-18 1996-04-30 Eli Lilly And Company Glucagon-like insulinotropic peptide analogs, compositions, and methods of use
US5523449A (en) 1995-05-17 1996-06-04 Bayer Corporation Process for preparing phosphorodichlorido-dithioates by reacting alkylmercaptans with phosphorus trichloride in the presence of sulfur
WO1997046584A1 (en) 1996-06-05 1997-12-11 Boehringer Mannheim Gmbh Exendin analogues, processes for their preparation and medicaments containing them
US6110703A (en) 1996-07-05 2000-08-29 Novo Nordisk A/S Method for the production of polypeptides
ATE493998T1 (en) 1996-08-08 2011-01-15 Amylin Pharmaceuticals Inc PHARMACEUTICAL COMPOSITION CONTAINING AN EXENDIN-4 PEPTIDE
US6384016B1 (en) 1998-03-13 2002-05-07 Novo Nordisk A/S Stabilized aqueous peptide solutions
US7235627B2 (en) 1996-08-30 2007-06-26 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6458924B2 (en) 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6268343B1 (en) 1996-08-30 2001-07-31 Novo Nordisk A/S Derivatives of GLP-1 analogs
IL128332A0 (en) 1996-08-30 2000-01-31 Novo Nordisk As GLP-1 derivatives
US6277819B1 (en) 1996-08-30 2001-08-21 Eli Lilly And Company Use of GLP-1 or analogs in treatment of myocardial infarction
US6006753A (en) 1996-08-30 1999-12-28 Eli Lilly And Company Use of GLP-1 or analogs to abolish catabolic changes after surgery
AU723268B2 (en) 1996-09-09 2000-08-24 Zealand Pharma A/S Improved solid-phase peptide synthesis and agent for use in such synthesis
EP0932614A1 (en) 1996-09-09 1999-08-04 Zealand Pharmaceuticals A/S Peptide prodrugs containing an alpha-hydroxyacid linker
UA65549C2 (en) 1996-11-05 2004-04-15 Елі Ліллі Енд Компані Use of glucagon-like peptides such as glp-1, glp-1 analog, or glp-1 derivative in methods and compositions for reducing body weight
AU5065198A (en) 1996-11-15 1998-06-10 Maria Grazia Masucci Fusion proteins having increased half-lives
DE122007000044I2 (en) 1997-01-07 2011-05-05 Amylin Pharmaceuticals Inc USE OF EXEDINES AND THEIR ANTAGONISTS TO REDUCE FOOD CONSUMPTION
US6410511B2 (en) 1997-01-08 2002-06-25 Amylin Pharmaceuticals, Inc. Formulations for amylin agonist peptides
US6136784A (en) 1997-01-08 2000-10-24 Amylin Pharmaceuticals, Inc. Amylin agonist pharmaceutical compositions containing insulin
WO1998035033A1 (en) 1997-02-05 1998-08-13 1149336 Ontario Inc. Polynucleotides encoding proexendin, and methods and uses thereof
US5846937A (en) 1997-03-03 1998-12-08 1149336 Ontario Inc. Method of using exendin and GLP-1 to affect the central nervous system
WO1998050351A1 (en) 1997-05-07 1998-11-12 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V., Berlin New cysteine derivatives, processes for their production, and pharmaceuticals containing them
ES2293688T5 (en) 1997-08-08 2011-05-04 Amylin Pharmaceuticals, Inc. NEW EXENDINE ANALOG COMPOUNDS.
US7157555B1 (en) 1997-08-08 2007-01-02 Amylin Pharmaceuticals, Inc. Exendin agonist compounds
US7223725B1 (en) 1997-11-14 2007-05-29 Amylin Pharmaceuticals, Inc. Exendin agonist compounds
ATE383867T1 (en) 1997-11-14 2008-02-15 Amylin Pharmaceuticals Inc NOVEL EXENDIN AGONISTS
US7220721B1 (en) 1997-11-14 2007-05-22 Amylin Pharmaceuticals, Inc. Exendin agonist peptides
MXPA00004670A (en) 1997-11-14 2003-07-14 Amylin Pharmaceuticals Inc Novel exendin agonist compounds.
EP1049486A4 (en) 1997-12-05 2006-01-04 Lilly Co Eli Glp-1 formulations
EP1054594B1 (en) 1998-02-13 2007-07-04 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and glp-1
US6703359B1 (en) 1998-02-13 2004-03-09 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and GLP-1
JP2003522099A (en) 1998-02-27 2003-07-22 ノボ ノルディスク アクティーゼルスカブ GLP-1 derivative of GLP-1 having a delayed action profile and exendin
JP2002506792A (en) 1998-02-27 2002-03-05 ノボ ノルディスク アクティーゼルスカブ N-terminal modified GLP-1 derivative
NZ506839A (en) 1998-03-09 2003-05-30 Zealand Pharma As Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis
WO1999049788A1 (en) 1998-03-30 1999-10-07 Focus Surgery, Inc. Ablation system
SE9802080D0 (en) 1998-06-11 1998-06-11 Hellstroem Pharmaceutical composition for the treatment of functional dyspepsia and / or irritable bowel syndrome and new use of substances therein
DE69941510D1 (en) 1998-08-10 2009-11-19 Us Gov Nat Inst Health DIFFERENTIATION OF NON-INSULIN IN INSULIN-PRODUCING CELLS BY GLP-1 AND EXENDIN-4 AND THEIR USE
EP1119625B1 (en) 1998-10-07 2005-06-29 Medical College Of Georgia Research Institute, Inc. Glucose-dependent insulinotropic peptide for use as an osteotropic hormone
US6284725B1 (en) 1998-10-08 2001-09-04 Bionebraska, Inc. Metabolic intervention with GLP-1 to improve the function of ischemic and reperfused tissue
CZ295044B6 (en) 1998-12-07 2005-05-18 Societe De Conseils De Recherches Et D'application Analogues GLP-1, having aminoisobutyric acid in positions 8 and 35, their use and pharmaceutical composition in which the analogues are comprised
US6902744B1 (en) 1999-01-14 2005-06-07 Amylin Pharmaceuticals, Inc. Exendin agonist formulations and methods of administration thereof
US7399489B2 (en) 1999-01-14 2008-07-15 Amylin Pharmaceuticals, Inc. Exendin analog formulations
ES2278589T3 (en) 1999-01-14 2007-08-16 Amylin Pharmaceuticals, Inc. EXCENDINES FOR THE INHIBITION OF GLUCAGON.
US6451987B1 (en) 1999-03-15 2002-09-17 Novo Nordisk A/S Ion exchange chromatography of proteins and peptides
US6451974B1 (en) 1999-03-17 2002-09-17 Novo Nordisk A/S Method of acylating peptides and novel acylating agents
CZ20013018A3 (en) 1999-03-17 2002-02-13 Novo Nordisk A/S Process for acylation of a peptide or protein amino group and compound
US6271241B1 (en) 1999-04-02 2001-08-07 Neurogen Corporation Cycloalkyl and aryl fused aminoalkyl-imidazole derivatives: modulators and GLP-1 receptors
US6924264B1 (en) 1999-04-30 2005-08-02 Amylin Pharmaceuticals, Inc. Modified exendins and exendin agonists
CA2372214A1 (en) 1999-04-30 2000-11-09 Amylin Pharmaceuticals, Inc. Modified exendins and exendin agonists
US7601691B2 (en) 1999-05-17 2009-10-13 Conjuchem Biotechnologies Inc. Anti-obesity agents
BR0010750A (en) 1999-05-17 2002-02-26 Conjuchem Inc Long-acting insulinotropic peptides
US6506724B1 (en) 1999-06-01 2003-01-14 Amylin Pharmaceuticals, Inc. Use of exendins and agonists thereof for the treatment of gestational diabetes mellitus
US6344180B1 (en) 1999-06-15 2002-02-05 Bionebraska, Inc. GLP-1 as a diagnostic test to determine β-cell function and the presence of the condition of IGT and type II diabetes
US6528486B1 (en) 1999-07-12 2003-03-04 Zealand Pharma A/S Peptide agonists of GLP-1 activity
EP1076066A1 (en) 1999-07-12 2001-02-14 Zealand Pharmaceuticals A/S Peptides for lowering blood glucose levels
US6586438B2 (en) 1999-11-03 2003-07-01 Bristol-Myers Squibb Co. Antidiabetic formulation and method
NZ519752A (en) 2000-10-20 2005-04-29 Amylin Pharmaceuticals Inc Treatment of hibernating myocardium and diabetic cardiomyopathy with a GLP-1 peptide
GB0121709D0 (en) 2001-09-07 2001-10-31 Imp College Innovations Ltd Food inhibition agent
AU2002346491A1 (en) 2001-12-19 2003-07-09 Eli Lilly And Company Crystalline compositions for controlling blood glucose
CZ2004710A3 (en) 2001-12-20 2005-02-16 Eli Lilly And Company Insulin compound exhibiting protracted activity
US20030232761A1 (en) 2002-03-28 2003-12-18 Hinke Simon A. Novel analogues of glucose-dependent insulinotropic polypeptide
EP1837031B1 (en) 2002-06-07 2009-10-14 Waratah Pharmaceuticals, Inc. Compositions and methods for treating diabetes
WO2004005342A1 (en) 2002-07-04 2004-01-15 Zealand Pharma A/S Glp-1 and methods for treating diabetes
BR0314996A (en) 2002-10-02 2005-08-09 Zealand Pharma As Composition, pharmaceutically acceptable composition, method for producing the composition, methods for stabilizing exendin-4 (1-39) or a variant, derivative or analogue thereof against degradation, before, during or after intended use, to treat diseases, to treat disease states associated with elevated blood glucose levels, to regulate blood glucose levels, to regulate gastric emptying, to stimulate the release of insulin in a mammal to reduce blood glucose level in a mammal, to reduce the level of plasma lipids in a mammal, to reduce mortality and morbidity after myocardial infarction in a mammal, to stimulate insulin release in a mammal, and to produce a stabilized exendin (1-39), and stabilized exendin (1-39)
US7192922B2 (en) 2002-11-19 2007-03-20 Allegheny-Singer Research Institute Method of treating left ventricular dysfunction
GB0300571D0 (en) 2003-01-10 2003-02-12 Imp College Innovations Ltd Modification of feeding behaviour
EP1620465A2 (en) 2003-04-29 2006-02-01 Eli Lilly And Company Insulin analogs having protracted time action
BRPI0409976A (en) * 2003-05-09 2006-05-09 Novo Nordisk As compound, methods to slow the progression of type 2 diabetes igt, to slow the progression of type 2 diabetes to insulin requiring diabetes, to treat obesity or to prevent overweight to regulate the appetite to induce satiety, to prevent weight gain after being successful in losing weight, to increase energy expenditure, to treat a disease or condition and to treat bulimia, pharmaceutical composition, and use of a compound
US7623530B2 (en) 2003-11-20 2009-11-24 Nokia Corporation Indication of service flow termination by network control to policy decision function
WO2005072045A2 (en) 2004-01-30 2005-08-11 Waratah Pharmaceuticals, Inc. The combined use of glp-1 agonists and gastrin for regulating blood glucose levels
NZ579621A (en) 2004-02-11 2011-03-31 Amylin Pharmaceuticals Inc Hybrid polypeptides with selectable properties
US8076288B2 (en) 2004-02-11 2011-12-13 Amylin Pharmaceuticals, Inc. Hybrid polypeptides having glucose lowering activity
MX2007005521A (en) 2004-11-12 2007-05-18 Novo Nordisk As Stable formulations of insulinoptropic peptides.
TWI362392B (en) * 2005-03-18 2012-04-21 Novo Nordisk As Acylated glp-1 compounds
CA2607566A1 (en) * 2005-05-06 2006-11-16 Bayer Pharmaceuticals Corporation Glucagon-like peptide 1 (glp-1) receptor agonists and their pharmacological methods of use
ATE553124T1 (en) 2005-06-13 2012-04-15 Imp Innovations Ltd OXYNTOMODULIN ANALOGS AND THEIR EFFECTS ON EATING BEHAVIOR
US20090202497A1 (en) 2005-08-23 2009-08-13 The General Hospital Corporation Use of glp-1, glp-1 derivatives or glp-1 fragments for skin regeneration, stimulation of hair growth, or treatment of diabetes
CA2913805A1 (en) 2005-11-07 2007-05-18 Indiana University Research And Technology Corporation Glucagon analogs exhibiting physiological solubility and stability
WO2007081824A2 (en) 2006-01-06 2007-07-19 Case Western Reserve University Fibrillation resistant proteins
WO2007095737A1 (en) 2006-02-21 2007-08-30 Waratah Pharmaceuticals Inc. Combination therapy for the treatment of diabetes comprising an exendin agonist and a gastrin compound
CA2638800A1 (en) 2006-02-22 2007-09-07 Merck & Co., Inc. Oxyntomodulin derivatives
MX2009000709A (en) 2006-07-18 2009-02-04 Sanofi Aventis ANTAGONIST ANTIBODY AGAINST EPHA2 FOR CANCER TREATMENT.
ITMI20061607A1 (en) 2006-08-09 2008-02-10 Maria Vincenza Carriero PEPTIDES WITH PHARMACOLOGICAL ACTIVITY
WO2008043033A2 (en) 2006-10-04 2008-04-10 Case Western Reserve University Fibrillation-resistant insulin and insulin analogues
CN101573376B (en) 2006-11-08 2013-11-06 西兰制药公司 Selective glucagon-like peptide-2 (GLP-2) analogs
WO2008071010A1 (en) 2006-12-12 2008-06-19 Waratah Pharmaceuticals Inc. Combination treatments with selected growth/hormone regulatory factors for diabetes and related diseases
TWI428346B (en) 2006-12-13 2014-03-01 Imp Innovations Ltd Novel compounds and their effects on feeding behaviour
CA2677932A1 (en) 2007-02-15 2008-08-21 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
FR2917552B1 (en) 2007-06-15 2009-08-28 Sagem Defense Securite METHOD FOR REGULATING THE TRANSMISSION GEIGE WITHIN A RECEPTION TERMINAL
EP2025684A1 (en) 2007-08-15 2009-02-18 Zealand Pharma A/S Glucagon analogues
EP2158214B1 (en) 2007-06-15 2011-08-17 Zealand Pharma A/S Glucagon analogues
EP2190872B1 (en) * 2007-09-05 2018-03-14 Novo Nordisk A/S Glucagon-like peptide-1 derivatives and their pharmaceutical use
MX2010005317A (en) 2007-11-20 2010-06-02 Ambrx Inc Modified insulin polypeptides and their uses.
GB2455553B (en) 2007-12-14 2012-10-24 Nuaire Ltd Motor mounting assembly for an axial fan
JP5695909B2 (en) 2008-01-09 2015-04-08 サノフィ−アベンティス・ドイチュラント・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツング Novel insulin derivatives with extremely delayed time action profiles
MY152979A (en) 2008-01-09 2014-12-15 Sanofi Aventis Deutschland Novel insulin derivatives having an extremely delayed time-action profile
DE102008003568A1 (en) 2008-01-09 2009-07-16 Sanofi-Aventis Deutschland Gmbh New insulin analogs useful for treating diabetes
DE102008003566A1 (en) 2008-01-09 2009-07-16 Sanofi-Aventis Deutschland Gmbh New insulin analogs useful for treating diabetes
US8993516B2 (en) 2008-04-14 2015-03-31 Case Western Reserve University Meal-time insulin analogues of enhanced stability
EP2296692A4 (en) 2008-04-22 2012-06-06 Univ Case Western Reserve INSULIN ANALOGUES SPECIFIC TO ISOFORMS
TWI451876B (en) 2008-06-13 2014-09-11 Lilly Co Eli Pegylated insulin lispro compounds
CN102105159B (en) * 2008-06-17 2015-07-08 印第安纳大学研究及科技有限公司 GIP-based mixed agonists for the treatment of metabolic disorders and obesity
US8450270B2 (en) 2008-06-17 2013-05-28 Indiana University Research And Technology Corporation Glucagon analogs exhibiting enhanced solubility and stability in physiological pH buffers
AR072160A1 (en) 2008-06-17 2010-08-11 Univ Indiana Res & Tech Corp GLUCAGON / GLP-1 RECEIVER CO-AGONISTS
PL219335B1 (en) 2008-07-04 2015-04-30 Inst Biotechnologii I Antybiotyków New slow-release insulin analogues
MX2011001181A (en) 2008-07-31 2011-04-05 Univ Case Western Reserve Halogen-stabilized insulin.
WO2010016940A2 (en) 2008-08-07 2010-02-11 Ipsen Pharma S.A.S. Analogues of glucose-dependent insulinotropic polypeptide
ES2561208T3 (en) 2008-09-12 2016-02-25 Novo Nordisk A/S Acylation method of a peptide or protein
JP5635531B2 (en) 2008-12-15 2014-12-03 ジーランド ファーマ アクティーゼルスカブ Glucagon analog
CN102282167B (en) * 2008-12-15 2014-08-13 西兰制药公司 Glucagon analogues
ES2477880T3 (en) 2008-12-15 2014-07-18 Zealand Pharma A/S Glucagon analogues
EP2370462B1 (en) 2008-12-15 2014-07-16 Zealand Pharma A/S Glucagon analogues
AU2009335715B2 (en) 2008-12-19 2016-09-15 Indiana University Research And Technology Corporation Amide-based insulin prodrugs
JP5789515B2 (en) 2008-12-19 2015-10-07 インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation Insulin analogue
WO2010096052A1 (en) 2009-02-19 2010-08-26 Merck Sharp & Dohme Corp. Oxyntomodulin analogs
US20100240883A1 (en) 2009-03-18 2010-09-23 Nian Wu Lipid-drug conjugates for drug delivery
CN101519446A (en) 2009-03-31 2009-09-02 上海一就生物医药有限公司 Method for preparing recombinant human insulin and analogs of recombinant human insulin
EP2443146B1 (en) 2009-06-16 2016-10-05 Indiana University Research And Technology Corporation Gip receptor-active glucagon compounds
AU2010272944B2 (en) 2009-07-13 2015-11-19 Zealand Pharma A/S Acylated glucagon analogues
US20110144006A1 (en) 2009-12-15 2011-06-16 Igelosa Life Science Ab Protein composition
JP6006118B2 (en) 2009-12-16 2016-10-12 ノヴォ ノルディスク アー/エス GLP-1 analogs and derivatives
WO2011084808A2 (en) 2009-12-21 2011-07-14 Amunix Operating Inc. Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases
US20130157953A1 (en) * 2010-01-20 2013-06-20 Zealand Pharma A/S Treatment of cardiac conditions
KR20120123443A (en) 2010-01-27 2012-11-08 인디애나 유니버시티 리서치 앤드 테크놀로지 코퍼레이션 Glucagon antagonist - gip agonist conjugates and composition for the treatment of metabolic disorders and obesity
AR080592A1 (en) * 2010-03-26 2012-04-18 Lilly Co Eli PEPTIDE WITH ACTIVITY FOR GIP-R AND GLP-1-R, FAMILY FORMULATION THAT UNDERSTANDS IT, ITS USE TO PREPARE A USEFUL MEDICINAL PRODUCT FOR THE TREATMENT OF MELLITUS DIABETES AND TO INDICATE WEIGHT LOSS
EP2552951A1 (en) 2010-03-26 2013-02-06 Novo Nordisk A/S Novel glucagon analogues
CN102933598A (en) 2010-03-26 2013-02-13 诺沃—诺迪斯克有限公司 Novel glucagon analogues
AU2011247824B2 (en) 2010-04-27 2014-02-13 Betta Pharmaceuticals Co., Ltd Glucagon-like peptide-1 analogue and use thereof
CN107129538B (en) 2010-04-27 2021-07-16 西兰制药公司 Peptide conjugates of GLP-1 receptor agonists and gastrin and uses thereof
UY33462A (en) 2010-06-23 2012-01-31 Zealand Pharma As GLUCAGON ANALOGS
US9169310B2 (en) 2010-06-24 2015-10-27 Zealand Pharma A/S Glucagon analogues
JP6039569B2 (en) 2010-11-09 2016-12-07 ノヴォ ノルディスク アー/エス Double acylated GLP-1 derivative
KR20140043709A (en) 2011-01-20 2014-04-10 질랜드 파마 에이/에스 Combination of acylated glucagon analogues with insulin analogues
RU2013145013A (en) 2011-03-28 2015-05-10 Ново Нордиск А/С NEW GLUCAGON ANALOGUES
DK2694095T3 (en) * 2011-04-05 2018-05-28 Longevity Biotech Inc COMPOSITIONS COMPREHENSIVE GLUCAGON ANALOGS AND METHODS FOR PREPARING AND USING THE SAME
PL2696687T3 (en) 2011-04-12 2017-06-30 Novo Nordisk A/S Double-acylated glp-1 derivatives
WO2012150503A2 (en) 2011-05-03 2012-11-08 Zealand Pharma A/S Glu-glp-1 dual agonist signaling-selective compounds
WO2012153196A2 (en) 2011-05-10 2012-11-15 Zealand Pharma A/S Glu-glp-1 dual agonist signaling-selective compounds
US9453062B2 (en) * 2011-06-10 2016-09-27 Beijing Hanmi Pharmaceutical Co., Ltd. Glucose dependent insulinotropic polypeptide analogs, pharmaceutical compositions and use thereof
AU2012311484B2 (en) 2011-09-23 2017-04-13 Novo Nordisk A/S Novel glucagon analogues
TW201326194A (en) 2011-11-03 2013-07-01 Zealand Pharma As GLP-1 gastrin receptor agonist peptide conjugates
IN2014CN04401A (en) 2011-12-23 2015-09-04 Zealand Pharma As
CN104540850B (en) 2012-05-03 2018-05-18 西兰制药公司 Glucagon-like peptide 2 (GLP-2) analogs
IN2014MN02304A (en) * 2012-05-03 2015-08-07 Zealand Pharma As
HK1209034A1 (en) 2012-06-21 2016-03-24 Indiana University Research And Technology Corporation Incretin receptor ligand polypeptide fc-region fusion polypeptides and conjugates with altered fc-effector function
IN2015DN00544A (en) 2012-07-23 2015-06-26 Zealand Pharma As
TWI608013B (en) 2012-09-17 2017-12-11 西蘭製藥公司 Glucagon analog
AU2013366692B2 (en) 2012-12-21 2017-11-23 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/Glucagon agonists
PL3057984T3 (en) 2013-10-17 2018-12-31 Zealand Pharma A/S Acylated glucagon analogues
US9988429B2 (en) 2013-10-17 2018-06-05 Zealand Pharma A/S Glucagon analogues
WO2015067715A2 (en) * 2013-11-06 2015-05-14 Zealand Pharma A/S Gip-glp-1 dual agonist compounds and methods
CN105829339B (en) 2013-11-06 2021-03-12 西兰制药公司 glucagon-GLP-1-GIP triple agonist compounds
EP3080152A1 (en) * 2013-12-13 2016-10-19 Sanofi Non-acylated exendin-4 peptide analogues
MX2016010599A (en) 2014-02-18 2016-11-18 Novo Nordisk As Stable glucagon analogues and use for treatment of hypoglycaemia.
KR102620911B1 (en) 2014-10-29 2024-01-05 질랜드 파마 에이/에스 Gip agonist compounds and methods
DK3283507T3 (en) 2015-04-16 2020-01-02 Zealand Pharma As Acylated glucagon analog

Cited By (91)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10004786B2 (en) 2009-07-13 2018-06-26 Zealand Pharma A/S Acylated glucagon analogues
US10100097B2 (en) 2012-05-03 2018-10-16 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US10442847B2 (en) 2012-07-23 2019-10-15 Zealand Pharma A/S Glucagon analogues
US11795204B2 (en) 2012-07-23 2023-10-24 Zealand Pharma A/S Glucagon analogues
US9975939B2 (en) 2012-09-17 2018-05-22 Zealand Pharma A/S Glucagon analogues
US10253081B2 (en) 2012-09-17 2019-04-09 Zealand Pharma A/S Glucagon analogues
US9988429B2 (en) 2013-10-17 2018-06-05 Zealand Pharma A/S Glucagon analogues
US10457714B2 (en) 2013-10-17 2019-10-29 Zealand Pharma A/S Acylated glucagon analogues
US11091528B2 (en) 2013-10-17 2021-08-17 Zealand Pharma A/S Acylated glucagon analogues
US9896495B2 (en) 2013-10-17 2018-02-20 Zealand Pharma A/S Acylated glucagon analogues
US11884713B2 (en) 2013-10-17 2024-01-30 Zealand Pharma A/S Acylated glucagon analogues
US11034747B2 (en) 2013-10-17 2021-06-15 Zealand Pharma A/S Glucagon analogues and methods of use
US12473339B2 (en) 2013-10-17 2025-11-18 Zealand Pharma A/S Acylated glucagon analogues
US10093713B2 (en) 2013-11-06 2018-10-09 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US11111285B2 (en) 2013-11-06 2021-09-07 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
US10131702B2 (en) 2013-11-06 2018-11-20 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
US11008375B2 (en) 2013-11-06 2021-05-18 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US11814417B2 (en) 2014-10-29 2023-11-14 Zealand Pharma A/S GIP agonist compounds and methods
US10253078B2 (en) 2014-10-29 2019-04-09 Zealand Pharma A/S GIP agonist compounds and methods
US11001619B2 (en) 2014-10-29 2021-05-11 Zealand Pharma A/S GIP agonist compounds and methods
US11274136B2 (en) 2015-04-16 2022-03-15 Zealand Pharma A/S Acylated glucagon analogue
US10336802B2 (en) 2015-04-16 2019-07-02 Zealand Pharma A/S Acylated glucagon analogue
WO2017074714A1 (en) 2015-10-26 2017-05-04 Eli Lilly And Company Glucagon receptor agonists
WO2017074715A1 (en) 2015-10-26 2017-05-04 Eli Lilly And Company Glucagon receptor agonists
US9764004B2 (en) 2015-10-26 2017-09-19 Eli Lilly And Company Glucagon receptor agonists
US9884093B2 (en) 2015-10-26 2018-02-06 Eli Lilly And Company Glucagon receptor agonists
CN108135981A (en) * 2015-10-26 2018-06-08 伊莱利利公司 Glucagon receptor agonist
CN106928086B (en) * 2015-12-31 2019-05-31 深圳翰宇药业股份有限公司 A kind of preparation method of long chain compound
US10399927B2 (en) 2015-12-31 2019-09-03 Hybio Pharmaceutical Co., Ltd. Method for preparing long-chain compound
CN106928086A (en) * 2015-12-31 2017-07-07 深圳翰宇药业股份有限公司 A kind of preparation method of long-chain compound
JP7009423B2 (en) 2016-12-09 2022-01-25 ジーランド・ファーマ・ア/エス Acylated GLP-1 / GLP-2 dual agonist
KR20190091335A (en) * 2016-12-09 2019-08-05 질랜드 파마 에이/에스 Acylated GLP-1 / GLP-2 Dual Agonists
WO2018104561A1 (en) * 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
WO2018104558A1 (en) * 2016-12-09 2018-06-14 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
AU2017371516B2 (en) * 2016-12-09 2021-05-13 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
JP2019214583A (en) * 2016-12-09 2019-12-19 ジーランド・ファーマ・ア/エス Acylated glp-1/glp-2 dual agonists
EP4424320A3 (en) * 2016-12-09 2025-06-11 Zealand Pharma A/S Acylated glp-1/glp-2 dual agonists
KR102502040B1 (en) 2016-12-09 2023-02-24 질랜드 파마 에이/에스 Acylated GLP-1/GLP-2 dual agonists
US11395847B2 (en) 2016-12-09 2022-07-26 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
AU2017371516C1 (en) * 2016-12-09 2021-09-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US10435445B2 (en) 2017-03-31 2019-10-08 Takeda Pharmaceutical Company Limited Peptide compound
US11174301B2 (en) 2017-03-31 2021-11-16 Takeda Pharmaceutical Company Limited Peptide compound
WO2018181864A1 (en) 2017-03-31 2018-10-04 Takeda Pharmaceutical Company Limited Gip receptor activating peptide
WO2019066609A1 (en) 2017-09-29 2019-04-04 한미약품 주식회사 Protein conjugate comprising non-peptidyl polymer-coupled fatty acid derivative compound as linker and preparation method therefor
WO2019125929A1 (en) * 2017-12-21 2019-06-27 Eli Lilly And Company Incretin analogs and uses thereof
US11542313B2 (en) 2017-12-21 2023-01-03 Eli Lilly And Company Incretin analogs and uses thereof
US12365716B2 (en) 2017-12-21 2025-07-22 Eli Lilly And Company Incretin analogs and uses thereof
US12371465B2 (en) 2017-12-21 2025-07-29 Eli Lilly And Company Incretin analogs and uses thereof
US11834486B2 (en) 2017-12-21 2023-12-05 Eli Lilly And Company Incretin analogs and uses thereof
WO2019125938A1 (en) * 2017-12-21 2019-06-27 Eli Lilly And Company Incretin analogs and uses thereof
EP4691555A3 (en) * 2017-12-21 2026-04-22 Eli Lilly and Company Incretin analogs and uses thereof
US10604555B2 (en) 2018-05-04 2020-03-31 Novo Nordisk A/S GIP derivatives and uses thereof
US11633459B2 (en) 2018-05-04 2023-04-25 Novo Nordisk A/S GIP derivatives and uses thereof
US11084861B2 (en) 2018-07-23 2021-08-10 Eli Lilly And Company GIP/GLP1 co-agonist compounds
US12453758B2 (en) 2018-07-23 2025-10-28 Eli Lilly And Company Method of using a GIP/GLP1 co-agonist for diabetes
US12252524B2 (en) 2018-07-23 2025-03-18 Eli Lilly And Company GIP/GLP1 co-agonist compounds
WO2020023386A1 (en) * 2018-07-23 2020-01-30 Eli Lilly And Company Gip/glp1 co-agonist compounds
US12343382B2 (en) 2018-07-23 2025-07-01 Eli Lilly And Company Methods of using a GIP/GLP1 co-agonist for therapy
EP4549454A3 (en) * 2018-07-23 2025-07-09 Eli Lilly and Company Gip/glp1 co-agonist compounds
CN113950482A (en) * 2019-02-21 2022-01-18 昂热大学 Peptides targeting GIP and GLP-2 receptors for the treatment of bone diseases
WO2020249782A1 (en) * 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
WO2020249778A1 (en) * 2019-06-14 2020-12-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual glp1/2 agonist
RU2815643C2 (en) * 2019-06-14 2024-03-19 Зилэнд Фарма А/С Pharmaceutical parenteral composition of double agonist glp1/2
US12576025B2 (en) 2019-06-14 2026-03-17 Zealand Pharma A/S Pharmaceutical parenteral composition of dual GLP1/2 agonist
WO2021150673A1 (en) * 2020-01-23 2021-07-29 Eli Lilly And Company Gip/glp1 co-agonist compounds
TWI770781B (en) * 2020-01-23 2022-07-11 美商美國禮來大藥廠 Gip/glp1 co-agonist compounds
US12551534B2 (en) 2020-01-30 2026-02-17 Eli Lilly And Company Therapeutic uses of tirzepatide
WO2021260530A1 (en) 2020-06-22 2021-12-30 Sun Pharmaceutical Industries Limited Long acting glp-1/gip dual agonists
WO2022018186A1 (en) 2020-07-22 2022-01-27 Novo Nordisk A/S Co-agonists at glp-1 and gip receptors suitable for oral delivery
US11779648B2 (en) 2020-07-22 2023-10-10 Novo Nordisk A/S Co-agonists at GLP-1 and GIP receptors suitable for oral delivery
WO2022018185A1 (en) 2020-07-22 2022-01-27 Novo Nordisk A/S Glp-1 and gip receptor co-agonists
WO2022079639A1 (en) 2020-10-17 2022-04-21 Sun Pharmaceutical Industries Limited Glp-1/gip dual agonists
US12318426B2 (en) 2021-01-20 2025-06-03 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
US12533391B2 (en) 2021-01-20 2026-01-27 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
EP4294423A1 (en) * 2021-02-17 2023-12-27 Eli Lilly and Company Gip/glp1 dual agonist therapeutic methods
WO2022253202A1 (en) * 2021-06-01 2022-12-08 南京知和医药科技有限公司 Polypeptide derivative having effect of dual targeted activation of glp-1r and gipr, preparation method therefor, and use thereof
EP4410827A4 (en) * 2021-09-02 2026-04-29 Sunshine Lake Pharma Co Ltd Dual-directed polypeptide and fusion protein targeting GLP-1/GIP and applications thereof
US12421282B2 (en) 2021-09-15 2025-09-23 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
WO2023139187A1 (en) 2022-01-20 2023-07-27 Novo Nordisk A/S Glp-1/gip receptor co-agonist prodrugs and uses thereof
US11840560B2 (en) 2022-01-20 2023-12-12 Novo Nordisk A/S Prodrugs and uses thereof
WO2024165571A2 (en) 2023-02-06 2024-08-15 E-Therapeutics Plc Inhibitors of expression and/or function
WO2024252366A1 (en) 2023-06-09 2024-12-12 Sun Pharmaceutical Industries Limited Glp-1/gip dual, glp-1/gcg dual and glp-1/gip/gcg triple receptor agonists
WO2024252367A2 (en) 2023-06-09 2024-12-12 Sun Pharmaceutical Industries Limited Novel glp-1/gip dual and glp-1/gcg dual receptor agonists
WO2025114501A1 (en) 2023-11-30 2025-06-05 Novo Nordisk A/S Tri-agonists of the glp-1, gip, and amylin receptors
WO2025125576A2 (en) 2023-12-15 2025-06-19 E-Therapeutics Plc Inhibitors of expression and/or function
WO2025133348A1 (en) 2023-12-22 2025-06-26 E-Therapeutics Plc Inhibitors of expression and/or function
WO2025147633A3 (en) * 2024-01-05 2025-08-28 Indiana University Research And Technology Corporation Gip/glp-1 co-agonists and their associated prodrugs
WO2025160082A1 (en) * 2024-01-23 2025-07-31 Viking Therapeutics, Inc. Amylin analogs
WO2025196502A1 (en) 2024-03-20 2025-09-25 North Carolina Agricultural & Technical State University Choline kinase inhibitors as a therapeutic treatment for obesity
EP4686757A1 (en) 2024-07-31 2026-02-04 e-therapeutics PLC Inhibitors of expression and/or function

Also Published As

Publication number Publication date
JP2020040979A (en) 2020-03-19
EA035466B9 (en) 2020-08-17
KR20160079875A (en) 2016-07-06
TW201605888A (en) 2016-02-16
EP3065767B1 (en) 2020-12-30
US20190218270A1 (en) 2019-07-18
CN105849122B (en) 2021-04-30
US10093713B2 (en) 2018-10-09
CN105849122A (en) 2016-08-10
TWI670281B (en) 2019-09-01
AU2014345569B2 (en) 2020-08-13
BR112016009889B1 (en) 2023-11-28
EA035466B1 (en) 2020-06-22
KR102310389B1 (en) 2021-10-13
EP3065767A2 (en) 2016-09-14
WO2015067715A3 (en) 2015-10-15
US20160280754A1 (en) 2016-09-29
JP6682432B2 (en) 2020-04-15
MX2016005556A (en) 2016-07-15
JP2016540741A (en) 2016-12-28
CA2929459C (en) 2022-05-03
BR112016009889A2 (en) 2017-12-05
US11008375B2 (en) 2021-05-18
EA201690660A1 (en) 2017-03-31
CA2929459A1 (en) 2015-05-14

Similar Documents

Publication Publication Date Title
US11008375B2 (en) GIP-GLP-1 dual agonist compounds and methods
US20240209054A1 (en) Gip agonist compounds and methods
US11111285B2 (en) Glucagon-GLP-1-GIP triple agonist compounds
AU2014345569A1 (en) GIP-GLP-1 dual agonist compounds and methods
HK40069710A (en) Gip agonist compounds and methods
HK1242216B (en) Gip agonist compounds and methods
HK1242216A1 (en) Gip agonist compounds and methods
BR112017008659B1 (en) GIP AGONIST METHODS AND COMPOUNDS

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14802336

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 201690660

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2016527453

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/005556

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2929459

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 15034778

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2014345569

Country of ref document: AU

Date of ref document: 20141106

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016009889

Country of ref document: BR

REEP Request for entry into the european phase

Ref document number: 2014802336

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014802336

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20167014987

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112016009889

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20160502