WO2015063647A1 - Vectors for expression of prostate-associated antigens - Google Patents

Vectors for expression of prostate-associated antigens Download PDF

Info

Publication number
WO2015063647A1
WO2015063647A1 PCT/IB2014/065419 IB2014065419W WO2015063647A1 WO 2015063647 A1 WO2015063647 A1 WO 2015063647A1 IB 2014065419 W IB2014065419 W IB 2014065419W WO 2015063647 A1 WO2015063647 A1 WO 2015063647A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
nucleotide sequence
polypeptide
immunogenic
psma
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2014/065419
Other languages
French (fr)
Inventor
Joseph John Binder
Helen Kim Cho
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Pfizer Inc
Original Assignee
Pfizer Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MYPI2016701396A priority Critical patent/MY182168A/en
Priority to CA2928908A priority patent/CA2928908C/en
Priority to SI201431100T priority patent/SI3062815T1/en
Priority to DK14802175.1T priority patent/DK3062815T3/en
Priority to JP2016526872A priority patent/JP2016535989A/en
Priority to MX2016005656A priority patent/MX2016005656A/en
Priority to EP18207060.7A priority patent/EP3524262A1/en
Priority to NZ718652A priority patent/NZ718652A/en
Priority to RU2016114416A priority patent/RU2650860C2/en
Priority to CN201480059609.4A priority patent/CN105682679B/en
Priority to KR1020167014145A priority patent/KR102006527B1/en
Priority to AU2014343321A priority patent/AU2014343321B2/en
Priority to ES14802175T priority patent/ES2715890T3/en
Application filed by Pfizer Inc filed Critical Pfizer Inc
Priority to SG11201602625YA priority patent/SG11201602625YA/en
Priority to PL14802175T priority patent/PL3062815T3/en
Priority to KR1020197021909A priority patent/KR102196884B1/en
Priority to EP14802175.1A priority patent/EP3062815B1/en
Priority to BR112016008806A priority patent/BR112016008806A2/en
Publication of WO2015063647A1 publication Critical patent/WO2015063647A1/en
Priority to IL244897A priority patent/IL244897A0/en
Priority to PH12016500673A priority patent/PH12016500673B1/en
Anticipated expiration legal-status Critical
Priority to AU2020202114A priority patent/AU2020202114A1/en
Priority to PH12020551666A priority patent/PH12020551666A1/en
Ceased legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C12N15/861—Adenoviral vectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404—Indoles, e.g. pindolol
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/436—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/496—Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
    • A61K31/5375—1,4-Oxazines, e.g. morpholine
    • A61K31/5377—1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088—Compounds having three or more nucleosides or nucleotides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A61K39/001194—Prostate specific antigen [PSA]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A61K39/001195—Prostate specific membrane antigen [PSMA]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/08—Drugs for disorders of the urinary system of the prostate
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6424—Serine endopeptidases (3.4.21)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53—DNA (RNA) vaccination
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511—Organic adjuvants
    • A61K2039/55516—Proteins; Peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511—Organic adjuvants
    • A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
    • A61K2039/645—Dendrimers; Multiple antigen peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/70—Multivalent vaccine
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75—Agonist effect on antigen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341—Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10371—Demonstrated in vivo effect
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00—Vector systems having a special element relevant for transcription
    • C12N2830/001—Vector systems having a special element relevant for transcription controllable enhancer/promoter combination
    • C12N2830/005—Vector systems having a special element relevant for transcription controllable enhancer/promoter combination repressible enhancer/promoter combination, e.g. KRAB
    • C12N2830/006—Vector systems having a special element relevant for transcription controllable enhancer/promoter combination repressible enhancer/promoter combination, e.g. KRAB tet repressible
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00—Vectors comprising a special translation-regulating system
    • C12N2840/20—Vectors comprising a special translation-regulating system translation of more than one cistron
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00—Vectors comprising a special translation-regulating system
    • C12N2840/20—Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203—Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21—Serine endopeptidases (3.4.21)
    • C12Y304/21077—Semenogelase (3.4.21.77), i.e. prostate specific antigen or PSA or kallikrein 3
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • sequence listing is provided as a file in .txt format entitled "PC72055A_FF_SEQ_LISTING_ST25.txt", created on October 6, 2014 and having a size of 429 KB.
  • sequence listing contained in the .txt file is part of the specification and is herein incorporated by reference in its entirety.
  • the present invention relates generally to immunotherapy and specifically to vaccines and methods for treating or preventing neoplastic disorders.
  • Prostate cancer is the second most commonly diagnosed cancer and the fourth leading cause of cancer-related death in men in the developed countries worldwide.
  • Various prostate-associated antigens such as prostate-specific antigen (PSA), prostate-specific membrane antigen (PSMA), and prostate stem cell antigen (PSCA) have been shown to be overexpressed by prostate cancer cells as compared to normal counterparts.
  • PSA prostate-specific antigen
  • PSMA prostate-specific membrane antigen
  • PSCA prostate stem cell antigen
  • PSCA is a 123-amino acid membrane protein.
  • the native full length human PSCA consists of amino acids 1 and 4-125 of SEQ ID NO:21 (wihtout the alanine and serine residues at the second and third position respectively).
  • PSCA has high tissue specificity and is expressed on more than 85% of prostate cancer specimens, with expression levels increasing with higher Gleason scores and androgen independence. It is expressed in 80-100% of bone metastasis of prostate cancer patients.
  • PSA is a kallikrein-like serine protease that is produced exclusively by the columnar epithelial cells lining the acini and ducts of the prostate gland.
  • PSA imRNA is translated as an inactive 261 -amino acid preproPSA precursor.
  • PreproPSA has 24 additional residues that constitute the pre-region (the signal polypeptide) and the propolypeptide. Release of the propolypeptide results in the 237- amino acid, mature extracellular form, which is enzymatically active.
  • the full length sequence of the native human PSA consists of amino acids 4-263 of SEQ ID NO: 15.
  • PSA is organ-specific and, as a result, it is produced by the epithelial cells of benign prostatic hyperplastic (BPH) tissue, primary prostate cancer tissue, and metastatic prostate cancer tissue.
  • BPH benign prostatic hyperplastic
  • PSMA also known as Folate hydrolase 1 (FOLH1 )
  • FOLH1 Folate hydrolase 1
  • PSMA also known as Folate hydrolase 1 (FOLH1 )
  • the amino acid sequence of the full length human PSMA is provided in SEQ ID NO:1 .
  • PSMA includes a cytoplasmic domain (amino acids 1 -19), a transmembrane domain (amino acids 20-43), and an extracellular domain (amino acids 44-750).
  • PSMA was found to be expressed in prostate cancer cells it at 1000-fold higher levels than normal tissues. It is abundantly expressed on neovasculature of a variety of other solid tumors such as colon, breast, liver, bladder, pancreas, lung, renal cancers as well as melanoma and sarcomas.
  • PSMA is considered a target not only specific for prostate cancer cells but also a pan-carcinoma target for other cancers.
  • cancer antigens are usually self-derived and, therefore, poorly immunogenic because the immune system is self-regulated not to recognize self- proteins. Accordingly, a need exists for a method to enhance the immunogenicity or therapeutic effect of cancer vaccines.
  • TLR agonists TLR agonists
  • TNFR agonists TNFR agonists
  • CTLA-4 inhibitors protein kinase inhibitors
  • TLRs Toll-like receptors
  • PAMP pathogen-associated molecular patterns
  • TLR9 Stimulation of the TLR9 receptor directs antigen-presenting cells (APCs) towards priming potent, ⁇ 1 -dominated T-cell responses, by increasing the production of pro-inflammatory cytokines and the presentation of co-stimulatory molecules to T cells.
  • APCs antigen-presenting cells
  • CpG oligonucleotides, ligands for TLR9 were found to be a class of potent immunostimulatory factors.
  • CpG therapy has been tested against a wide variety of tumor models in mice, and has consistently been shown to promote tumor inhibition or regression.
  • CTLA-4 Cytotoxic T-Lymphocyte Antigen 4
  • CTLA-4 is a member of the immunoglobulin superfamily and is expressed on the surface of Helper T cells.
  • CTLA-4 is a negative regulator of CD28 dependent T cell activation, and acts as an inhibitory checkpoint for the adaptive immune response. Similar to the T-cell costimulatory protein CD28, CTLA- 4 binds to CD80 and CD86 on antigen-presenting cells.
  • CTLA-4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.
  • Human antibodies against human CTLA-4 have been described as immunostimulation modulators in a number of disease conditions, such as treating or preventing viral and bacterial infection and for treating cancer (WO 01 /14424 and WO 00/37504).
  • CTLA-4 blockade by monoclonal antibodies enhances the host immune response against immunogenic tumors, and can even reject established tumors.
  • Two fully human anti-human CTLA-4 monoclonal antibodies ipilimumab (MDX- 010) and Tremelimumab (also known as CP-675206), have been investigated in clinical trials in the treatment of various types of solid tumors.
  • the tumor necrosis factor (TNF) superfamily is a group of cytokines that engage specific cognate cell surface receptors, the TNF receptor (TNFR) superfamily.
  • TNF receptor TNF receptor
  • Members of the tumor necrosis factor superfamily act through ligand-mediated trimerization, causing recruitment of several intracellular adaptors to activate multiple signal transduction pathways, such as apoptosis, NF-kB pathway, JNK pathway, as well as immune and inflammatory responses.
  • TNF superfamily examples include CD40 ligands, OX40 ligands, 4-1 BB ligands, CD27, CD30 ligand (CD153), TNF- alpha, TNF- beta, RANK ligands, LT- alpha, LT- beta, GITR ligands, and LIGHT.
  • the TNFR superfamily includes, for example, CD40, OX40, 4-1 BB, CD70 (CD27 ligand), CD30, TNFR2, RANK, LT- beta R, HVEM, GITR, TROY, and RELT.
  • CD40 agonists including various CD40 agonistic antibodies, such as the fully human agonist CD40 monoclonal antibody CP870893, have been extensively explored for usage in therapies.
  • Protein kinases are a family of enzymes that catalyze the phosphorylation of specific residues in proteins.
  • a number of kinase inhibitors have been investigated in clinical investigation for use in anti-cancer therapies, which includes, for example, MK0457, VX-680, ZD6474, MLN8054, AZD2171 , SNS-032, PTK787/ZK222584, Sorafenib (BAY43-9006), SU5416, SU6668 AMG706, Zactima (ZD6474), MP-412, Dasatinib, CEP-701 , (Lestaurtinib), XL647, XL999, Tykerb, (Lapatinib), MLN518, (formerly known as CT53518), PKC412, ST1571 , AMN107, AEE 788, OSI-930, OSI-817, Sunitinib malate (Sutent; SU1 1248), Vatalanib (PTK787/ZK 222584), SNS-032, SNS- 314 and Axitinib (
  • the present disclosure relates to vectors constructed from chimpanzee adenovirus ChAd68 genomic sequences for expression of two or more immunogenic PAA polypeptides.
  • the vector comprises (1 ) a C68 DNA sequence, (2) a multi-antigen construct for expression of two or more immunogenic PAA polypeptides, and (3) regulatory sequences that control the transcription and translation of the antigen products (i.e., the immunogenic PAA polypeptides).
  • the C68 DNA sequence included in the vector is derived from C68 genomic sequence by functional deletion of one or more viral genes but is sufficient for production of an infectious viral particle.
  • the C68 DNA sequence used in the vector is the entire C68 genome with only functional deletions in the E1 and E3 regions.
  • the multi-antigen construct carried by the vector comprises nucleotide sequences encoding two or more immunogenic PAA polypeptides selected from immunogenic PSMA polypeptide, immunogenic PSA polypeptide, and immunogenic PSCA polypeptide.
  • the multi-antigen construct carried by the vector comprises (1 ) a nucleotide sequence encoding at least one immunogenic PSMA polypeptide, (2) a nucleotide sequence encoding at least one immunogenic PSA polypeptide, and (3) a nucleotide sequence encoding at least one immunogenic PSCA polypeptide.
  • the multi-antigen constructs may also include separator sequences that enable expression of separate PAA polypeptides encoded by the construct. Examples of separator sequences include 2A peptide sequences and IRESs.
  • the vector comprises a multi-antigen construct having one of the following structures: (1 ) PSA-F2A-PSMA-mlRES-PSCA;
  • the nucleotide sequence encoding the immunogenic PSA polypeptide comprises nucleotides 1 1 15-1825 of SEQ ID NO:58 or comprises nucleotides 1 106-1825 of SEQ ID NO:58
  • the nucleotide sequence encoding the immunogenic PSCA polypeptide comprises nucleotides 1892-2257 of SEQ ID NO:58 or comprises nucleotides 1886-2257 of SEQ ID NO:58
  • the nucleotide sequence encoding the immunogenic PSMA polypeptide comprises nucleotides 2333-4543 of SEQ ID NO:58 or comprises nucleotides 2324-4543 of SEQ ID NO:58.
  • the multi-antigen construct comprises nucleotide sequence selected from the group consisting of SEQ ID NOs:33, 34, 35, and 36. In a particular embodiment, the multi-antigen construct comprises a nucleotide sequence that encodes a polypeptide sequence of SEQ ID NO:60. In another particular embodiment, the multi-antigen construct comprises a nucleotide sequence of SEQ ID NO:61 .
  • compositions comprising the vectors.
  • the composition is an immunogenic composition useful for eliciting an immune response against a PAA in a mammal, such as a mouse, dog, monkey, or human.
  • the composition is a vaccine composition useful for immunization of a mammal, such as a human, for inhibiting abnormal cell proliferation, for providing protection against the development of cancer (used as a prophylactic), or for treatment of disorders (used as a therapeutic) associated with PAA over-expression, such as cancer, particularly prostate cancer.
  • the present disclosure further relates to methods of using the vectors or compositions for eliciting an immune response against a PAA, or for treating cancers, such as prostate cancers, in a mammal, particularly a human.
  • the vectors or compositions, including vaccine compositions are administered to the mammal, particularly human, in combination with one or more immune modulators that enhance the immunogenicity or effect of the vectors or compositions.
  • the method involves co-administration of a vaccine provided by the present invention in combination with at least one immune-suppressive-cell inhibitor and at least one immune-effector-cell enhancer.
  • FIG. 1 Schematic illustration of PJV7563 vector.
  • FIG. 2 Amino acid alignment of five viral 2A cassettes. The skipped glycine- proline bonds are indicated by asterisks.
  • FIG. 3 Sequence of the preferred EMCV IRES.
  • the translation initiation site is indicated by the asterisk.
  • the minimal IRES element excludes the underlined first 5 codons of the EMCV L protein.
  • FIG. 4 Graph showing the Kaplan-Meier survival curves of the groups of mice from a representative study evaluating the effect of sunitinib malate (Sutent) and an anti- murine CTLA-4 monoclonal antibody (clone 9D9) on the anti-tumor efficacy of a cancer vaccine (vaccine) in subcutaneous TUBO tumor bearing BALB/neuT mice.
  • FIG. 5 Graph depicting the IFND ELISPOT results from a representative study evaluating the effect of CpG7909 and an anti-CD40 antibody (Bioxcell #BE0016-2) on the antigen specific T cell responses induced by a cancer vaccine (rHER2).
  • FIG. 6 Graphs depicting results of a representative study that evaluates the immunomodulatory activity of CpG7909 on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD8 T cells were measured. ( * indicates P ⁇ 0.05 by Student's T-test).
  • FIG. 7 Graphs depicting results of a representative study that evaluates the immunomodulatory activity of CpG7909 on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD4 T cells (FIG. 7) were measured. ( * indicates P ⁇ 0.05 by Student's T-test).
  • FIG. 8 Graphs depicting results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-murine CD40 monoclonal antibody on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD8 T cells were measured, (indicates P ⁇ 0.05 by Student's T-test)
  • FIG. 9. Graphs depicting results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-murine CD40 monoclonal antibody on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD4 T cells were measured, (indicates P ⁇ 0.05 by Student's T-test)
  • FIG. 10. Graph showing the Kaplan-Meier survival curves of the groups of mice from a representative study that evaluates the effect of low dose sunitinib malate (Sutent) on the anti-tumor efficacy of a cancer vaccine in spontaneous mammary tumor bearing BALB/neuT mice.
  • FIG. 1 1 Graph showing the genomic organization of the AdC68-734 vector.
  • CMV Enh/pro human cytomegalovirus immediate early enhancer and promoter
  • tet op tetracycline operator
  • T2A Thosea asigna virus 2A
  • F2A Foot and Mouth Disease Virus 2A
  • SV40 pA Simian Virus 40 polyadenylation signal
  • LITR left inverted terminal repeat
  • RITR right inverted terminal repeat.
  • FIG. 12 Dot plots showing expression of PSMA and PSCA on the surface of
  • FIG. 13 Western blot from lysates of A549 infected by AdC68 vectors.
  • adjuvant refers to a substance that is capable of enhancing, accelerating, or prolonging an immune response elicited by a vaccine immunogen.
  • agonist refers to a substance which promotes (induces, causes, enhances or increases) the activity of another molecule or a receptor.
  • agonist encompasses substances which bind receptor (e.g., an antibody, a homolog of a natural ligand from another species) and substances which promote receptor function without binding thereto (e.g., by activating an associated protein).
  • antagonist refers to a substance that partially or fully blocks, inhibits, or neutralizes a biological activity of another molecule or receptor.
  • co-administration refers to administration of two or more agents to the same subject during a treatment period.
  • the two or more agents may be encompassed in a single formulation and thus be administered simultaneously. Alternatively, the two or more agents may be in separate physical formulations and administered separately, either sequentially or simultaneously, to the subject.
  • administered simultaneously or “simultaneous administration” means that the administration of the first agent and that of a second agent overlap in time with each other, while the term “administered sequentially” or “sequential administration” means that the administration of the first agent and that of a second agent does not overlap in time with each other.
  • cytosolic means that, after a nucleotide sequence encoding a particular polypeptide is expressed by a host cell, the expressed polypeptide is retained inside the host cell.
  • degenerate variant refers to a nucleotide sequence that has substitutions of bases as compared to a reference nucleotide sequence but, due to degeneracy of the genetic code, encodes the same amino acid sequence as the reference nucleotide sequence.
  • an effective amount refers to an amount administered to a mammal that is sufficient to cause a desired effect in the mammal.
  • fragment of a given polypeptide refers to a polypeptide that is shorter than the given polypeptide and shares 100% identity with the sequence of the given polypeptide.
  • nucleic acid or polypeptide sequences refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence.
  • immune-effector-cell enhancer refers to a substance capable of increasing or enhancing the number, quality, or function of one or more types of immune effector cells of a mammal.
  • immune effector cells include cytolytic CD8 T cells, CD40 T cells, NK cells, and B cells.
  • immunomodulator refers to a substance capable of altering (e.g., inhibiting, decreasing, increasing, enhancing or stimulating) the working of any component of the innate, humoral or cellular immune system of a mammal.
  • the term “immune modulator” encompasses the “immune-effector-cell enhancer” as defined herein and the “immune-suppressive-cell inhibitor” as defined herein, as well as substance that affects other components of the immune system of a mammal.
  • immune response refers to any detectable response to a particular substance (such as an antigen or immunogen) by the immune system of a host vertebrate animal, including, but not limited to, innate immune responses (e.g., activation of Toll receptor signaling cascade), cell-mediated immune responses (e.g., responses mediated by T cells, such as antigen-specific T cells, and non-specific cells of the immune system), and humoral immune responses (e.g., responses mediated by B cells, such as generation and secretion of antibodies into the plasma, lymph, and/or tissue fluids).
  • innate immune responses e.g., activation of Toll receptor signaling cascade
  • cell-mediated immune responses e.g., responses mediated by T cells, such as antigen-specific T cells, and non-specific cells of the immune system
  • humoral immune responses e.g., responses mediated by B cells, such as generation and secretion of antibodies into the plasma, lymph, and/or tissue fluids.
  • immune responses include an alteration (e.g., increase) in Toll-like receptor activation, lymphokine (e.g., cytokine (e.g., Th1 , Th2 or Th17 type cytokines) or chemokine) expression or secretion, macrophage activation, dendritic cell activation, T cell (e.g., CD4+ or CD8+ T cell) activation, NK cell activation, B cell activation (e.g., antibody generation and/or secretion), binding of an immunogen (e.g., antigen (e.g., immunogenic polypolypeptide)) to an MHC molecule, induction of a cytotoxic T lymphocyte ("CTL") response, induction of a B cell response (e.g., antibody production), and, expansion (e.g., growth of a population of cells) of cells of the immune system (e.g., T cells and B cells), and increased processing and presentation of antigen by antigen presenting cells.
  • lymphokine
  • immunogenic refers to the ability of a substance to cause, elicit, stimulate, or induce an immune response, or to improve, enhance, increase or prolong a pre-existing immune response, against a particular antigen, whether alone or when linked to a carrier, in the presence or absence of an adjuvant.
  • immunogenic PSA polypeptide refers to a polypeptide that is immunogenic against human PSA protein or against cells expressing human PSA protein.
  • immunogenic PSCA polypeptide refers to a polypeptide that is immunogenic against human PSCA protein or against cells expressing human PSCA protein.
  • immunogenic PSMA polypeptide refers to a polypeptide that is immunogenic against human PSMA protein or against cells expressing human PSMA protein.
  • immunogenic PAA polypeptide refers to an "immunogenic PSA polypeptide,” an “immunogenic PSCA polypeptide,” or an “immunogenic PSMA polypeptide” as defined herein above.
  • ISC inhibitor refers to a substance capable of reducing or suppressing the number or function of immune suppressive cells of a mammal.
  • immune suppressive cells include regulatory T cells ("T regs”), myeloid-derived suppressor cells, and tumor-associated macrophages.
  • T regs regulatory T cells
  • intradermal administration or “administered intradermal ⁇ ,” in the context of administering a substance, such as a therapeutic agent or an immune modulator, to a mammal including a human, refers to the delivery of the substance into the dermis layer of the skin of the mammal.
  • the skin of a mammal is composed of three layers - the epidermis, dermis, and subcutaneous layer.
  • the epidermis is the relatively thin, tough, outer layer of the skin. Most of the cells in the epidermis are keratinocytes.
  • the dermis the skin's next layer, is a thick layer of fibrous and elastic tissue (made mostly of collagen, elastin, and fibrillin) that gives the skin its flexibility and strength.
  • the dermis contains nerve endings, sweat glands and oil (sebaceous) glands, hair follicles, and blood vessels.
  • the dermis varies in thickness depending on the location of the skin. In humans it is about 0.3 mm on the eyelid and about 3.0 mm on the back.
  • the subcutaneous layer is made up of fat and connective tissue that houses larger blood vessels and nerves.
  • intradermal administration refers to delivery of a substance to the inside of the dermis layer.
  • subcutaneous administration ' refers to the administration of a substance into the subcutaneous layer and “topical administration” refers to the administration of a substance onto the surface of the skin.
  • local administration or “administered locally” encompasses “topical administration,” “intradermal administration,” and “subcutaneous administration,” each as defined herein above. This term also encompasses “intratumoral administration,” which refers to administration of a substance to the inside of a tumor. Local administration is intended to allow for high local concentrations around the site of administration for a period of time until systemic biodistribution has been achieved with of the administered substance, while “systemic administration” is intended for the administered substance to be absorbed into the blood and attain systemic exposure rapidly by being distributed through the circulatory system to organs or tissues throughout the body.
  • mammal refers to any animal species of the Mammalia class. Examples of mammals include: humans; non-human primates such as monkeys; laboratory animals such as rats, mice, guinea pigs; domestic animals such as cats, dogs, rabbits, cattle, sheep, goats, horses, and pigs; and captive wild animals such as lions, tigers, elephants, and the like.
  • mammalia class examples include: humans; non-human primates such as monkeys; laboratory animals such as rats, mice, guinea pigs; domestic animals such as cats, dogs, rabbits, cattle, sheep, goats, horses, and pigs; and captive wild animals such as lions, tigers, elephants, and the like.
  • membrane-bound means that after a nucleotide sequence encoding a particular polypeptide is expressed by a host cell, the expressed polypeptide is bound to, attached to, or otherwise associated with, the membrane of the cell.
  • neoplastic disorder refers to a condition in which cells proliferate at an abnormally high and uncontrolled rate, the rate exceeding and uncoordinated with that of the surrounding normal tissues. It usually results in a solid lesion or lump known as “tumor.” This term encompasses benign and malignant neoplastic disorders.
  • malignant neoplastic disorder which is used interchangeably with the term “cancer” in the present disclosure, refers to a neoplastic disorder characterized by the ability of the tumor cells to spread to other locations in the body (known as “metastasis").
  • benign neoplastic disorder refers to a neoplastic disorder in which the tumor cells lack the ability to metastasize.
  • operably linked refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner.
  • a control sequence "operably linked" to a transgene is ligated in such a way that expression of the transgene is achieved under conditions compatible with the control sequences.
  • pharmaceutically acceptable excipient refers to a substance in an immunogenic or vaccine composition, other than the active ingredients (e.g., the antigen, antigen-coding nucleic acid, immune modulator, or adjuvant) that is compatible with the active ingredients and does not cause significant untoward effect in subjects to whom it is administered.
  • active ingredients e.g., the antigen, antigen-coding nucleic acid, immune modulator, or adjuvant
  • peptide refers to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically, or biochemically modified or derivatized amino acids, and polypeptides having modified polypeptide backbones.
  • preventing refers to (a) keeping a disorder from occurring or (b) delaying the onset of a disorder or onset of symptoms of a disorder.
  • PAA prostate-associated-antigen
  • TAA tumor-associated-antigen
  • PSA PSCA
  • PSMA protein-associated-antigen
  • secreted in the context of a polypeptide means that after a nucleotide sequence encoding the polypeptide is expressed by a host cell, the expressed polypeptide is secreted outside of the host cell.
  • suboptimal dose when used to describe the amount of an immune modulator, such as a protein kinase inhibitor, refers to a dose of the immune modulator that is below the minimum amount required to produce the desired therapeutic effect for the disease being treated when the immune modulator is administered alone to a patient.
  • treating refers to abrogating a disorder, reducing the severity of a disorder, or reducing the severity or occurrence frequency of a symptom of a disorder.
  • tumor-associated antigen refers to an antigen which is specifically expressed by tumor cells or expressed at a higher frequency or density by tumor cells than by non-tumor cells of the same tissue type.
  • Tumor-associated antigens may be antigens not normally expressed by the host; they may be mutated, truncated, misfolded, or otherwise abnormal manifestations of molecules normally expressed by the host; they may be identical to molecules normally expressed but expressed at abnormally high levels; or they may be expressed in a context or milieu that is abnormal.
  • Tumor-associated antigens may be, for example, proteins or protein fragments, complex carbohydrates, gangliosides, haptens, nucleic acids, or any combination of these or other biological molecules.
  • vaccine refers to an immunogenic composition for administration to a mammal for eliciting an immune response against a particular antigen.
  • vector refers to a nucleic acid molecule capable of transporting or transferring a foreign nucleic acid molecule.
  • the foreign nucleic acid molecule is referred to as "insert” or "transgene.”
  • a vector generally consists of an insert and a larger sequence that serves as the backbone of the vector.
  • vector encompasses both expression vectors and transcription vectors.
  • expression vector refers to a vector capable of expressing the insert in the target cell. It generally contains control sequences, such as enhancer, promoter, and terminator sequences, that drive expression of the insert.
  • transcription vector refers to a vector capable of being transcribed but not translated. Transcription vectors are used to amplify their insert.
  • vectors Based on the structure or origin of vectors, major types of vectors include plasmid vectors, cosmid vectors, phage vectors such as lambda phage, viral vectors such as adenovirus (Ad) vectors, and artificial chromosomes.
  • plasmid vectors cosmid vectors
  • phage vectors such as lambda phage
  • viral vectors such as adenovirus (Ad) vectors
  • Ad adenovirus
  • the present disclosure provides a voral vector constructed from the genome of chimpanzee adenovirus ChAd68 for expression of two or more immunogenic PAA polypeptides.
  • Chimpanzee adenovirus ChAd68 is also referred in the literature as simian adenovirus 25, C68, Chad68, SAdV25, PanAd9, or Pan9.
  • the chimpanzee adenovirus ChAd68 may be referred to in this specification as "C68" and the viral vector constructed from the genome of chimpanzee adenovirus ChAd68 is refrred to as "C68 vector.”
  • the full length genomic sequence of C68 is available from Genbank (Accession Number AC_00001 1 .1 ) and is provided in SEQ ID NO:57.
  • the full length genomic sequence of C68 and location of the adenovirus genes E1 a, E1 b, E2a, E2b, E3, E4, 11 , I2, L3, L4, and L5 are also provided in US Patent 6,083,716.
  • the C68 vector provided by the present disclosure comprises (1 ) a C68 DNA sequence, and (2) a multi-antigen construct for expression of two or more immunogenic PAA polypeptides.
  • the vector may also contain non-native regulatory sequences that control the transcription and translation of the antigen products.
  • the non-native regulatory sequences refer to sequences that are not part of the C68 genome.
  • the C68 DNA sequence, multi-antigen construct, and regulatory sequences are operably linked to each other.
  • the C68 vector can be replication-competent, conditionally replication-competent, or replication-deficient.
  • a replication-competent C68 vector can replicate in typical host cells, i.e., cells typically capable of being infected by an adenovirus.
  • a replication- competent viral vector can have one or more mutations as compared to the wild-type adenovirus (e.g., one or more deletions, insertions, and/or substitutions) in the adenoviral genome that do not inhibit viral replication in host cells.
  • a conditionally- replicating C68 vector is viral vector that has been engineered to replicate under predetermined conditions.
  • replication-essential gene functions e.g., gene functions encoded by the adenoviral early regions
  • a replication-deficient C68 vector is a viral vector that requires complementation of one or more gene functions or regions of the viral genome that are required for replication, as a result of, for example, a deficiency in one or more replication-essential gene function or regions, such that the vector does not replicate in typical host cells, especially those in a human to be infected by the vector.
  • the vectors are useful for cloning or expressing the immunogenic PAA polypeptides, or for delivering the multi-antigen construct in a composition, such as a vaccine, to a host cell or to a host animal, such as a human.
  • the present disclosure provides a vector selected from the group comsisting of (i) a vector comprsing or consisting of the nucleotide sequence of SEQ ID NO:58; (ii) a vector comprsing or consisting of nucleotides 9 - 3481 1 of SEQ ID NO:58; and (iii) a vector comprsing or consisting of the nucleotide sequence of SEQ ID NO:63.
  • the C68 vector provided by the present disclosure also encompasses functional variants of the vectors specifically described or exemplified in the present disclosure.
  • a "functional variant” refers a vector that contains mutations (e.g., additions, deletions, or substitutions) relative to the sequence of a vector ("parent vector") specifically described or exemplified in the present disclosure but retains the function or property of the parent vector.
  • functional variant may comprise codon-optimized sequence corresponding to a parent vector examplified in the present disclosure.
  • C68 DNA sequence refers to a DNA sequence that is part of the C68 genomic sequence.
  • the C68 DNA sequence included in the vector is derived from C68 genomic sequence by functional deletion of one or more viral genes or genomic regions.
  • the term “functional deletion” means that a sufficient amount of the gene region of the virus is removed or otherwise changed, e.g., by mutation or modification, so that the gene region is no longer capable of producing functional products of gene expression or is otherwise performing its normal function. Deletion of an entire gene region often is not required for disruption of a replication-essential gene function. However, for the purpose of providing sufficient space in the C68 genome for one or more transgenes, removal of a majority of one or more gene regions may be desirable. While deletion of genetic material is preferred, mutation of genetic material by addition or substitution also is appropriate for disrupting gene function.
  • the C68 DNA sequence of the vector is derived from the C68 genomic sequence by functionally deleting the entire, or a sufficient portion of, the adenoviral immediate early gene E1 a and delayed early gene E1 b.
  • functional deletion may also be made to one or more other genes, such as the delayed early gene E2a, delayed early gene E3, E4, any of the late genes L1 through L5, the intermediate genes IX, and IVa2.
  • the C68 DNA sequence for use in the construction of the vector of the invention may contain deletions in E1 only. Alternatively, deletions of entire genes or portions thereof effective to destroy their biological activity may be used in any combination.
  • the C68 DNA sequence is derived from the C68 genomic sequence by functionnal deletions of the E1 genes and the E4 gene, or of the E1 , E2a and E3 genes, or of the E1 and E3 genes, or of E1 , E2a and E4 genes, with or without deletion of E3, and so on.
  • deletions may be used in combination with other mutations, such as temperature-sensitive mutations, to achieve a desired result.
  • the C68 DNA sequence is the entire C68 genome with only functional deletions in the E1 and E3 regions.
  • the functional deletion of E1 gene is accomplished by deletion of nucleotides 577-3403 of SEQ ID NO:57 or by deletion of nucleotides 456-3012 of SEQ ID NO:57
  • the functional deletion of E3 gene is accomplished by deletion of nucleotides 27125-31831 of SEQ ID NO:57 or by deletion of nucleotides 27812-31330 of SEQ ID NO:57.
  • the C68 DNA sequence included in the vector comprises nucleodtides 3013 - 2781 1 of SEQ ID NO:57.
  • the C68 DNA sequence included in the vector comprises nucleodtides 3013 - 2781 1 and 31331 - 36519 of SEQ ID NO:57.
  • the multi-antigen construct may be inserted into any deleted region of the adenovirus genome.
  • the multi-antigen construct may also be inserted into an existing gene region to disrupt the function of that region.
  • the multi- antigen construct is inserted in the place of the deleted E1 gene.
  • multi-antigen construct refers to a nucleic acid molecule or sequence that encodes two or more PAA polypeptides. Such molecules or sequences may also be referred to as “multi-antigen vaccine” or “multi-antigen plasmid” in the present disclosure.
  • a multi-antigen construct can carry two coding nucleotide sequences wherein each of the coding nucleotide sequences expresses an individual immunogenic PAA polypeptide.
  • Such a construct is also referred to as “dual antigen construct,” “dual antigen vaccine,” or “dual antigen plasmid” in this disclosure.
  • a multi-antigen construct can also carry three coding nucleotide sequences wherein each of the coding nucleotide sequences expresses an individual immunogenic PAA polypeptide.
  • Such a construct is also referred to as “triple antigen construct,” “triple antigen vaccine,” or “triple antigen plasmid” in this disclosure.
  • the individual PAA polypeptides encoded by a multi-antigen construct may be immunogenic against the same antigen, such as PSMA, PSA, or PSCA.
  • a dual antigen construct may express two different PAA antigens that are both immunogenic against PSMA.
  • the individual PAA polypeptides encoded by a multi-antigen construct may be immunogenic against different antigens, for example, a dual antigen construct may express two PAA polypeptides that are immunogenic against PSMA and PSA, respectively. It is preferred that a multi-antigen construct encodes two or more individual PAA polypeptides that are immunogenic against different antigens.
  • the multi-antigen construct encodes at least two
  • the multi-antigen construct encodes at least one immunogenic PSMA polypeptide, at least one immunogenic PSA polypeptide, and at least one immunogenic PSCA polypeptide.
  • the immunogenic PSMA polypeptide expressed by a multi-antigen construct may be cytosolic, secreted, or membrane-bound, but preferably membrane-bound.
  • the immunogenic PSMA polypeptide comprises an amino acid sequence selected from the group consisting of:
  • amino acids 4 - 739 of SEQ ID NO:5 amino acids 4 - 739 of SEQ ID NO:7;
  • the immunogenic PSA polypeptide expressed by a multi-antigen construct may be cytosolic, secreted, or membrane-bound, but preferably cytosolic.
  • the immunogenic PSA polypeptide comprises an amino acid sequence selected from the group consisting of:
  • the immunogenic PSCA polypeptide expressed by a multi-antigen construct may be the full length human PSCA protein.
  • the immunogenic PSCA polypeptide comoprises an amino acid sequence selected from the group consisting of:
  • the multi-antigen construct encodes at least one immunogenic PSA polypeptide, at least one immunogenic PSCA polypeptide, and at least one immunogenic PSMA polypeptide, wherein the immunogenic PSA polypeptide comprises the amino acid sequence of of SEQ ID NO:17 or amino acids 4 - 240 of SEQ ID NO:17, wherein the immunogenic PSCA polypeptide comprises the amino acid sequence of SEQ ID NO:21 or amino acids 2-125 of SEQ ID NO:21 , and wherein the immunogenic PSMA polypeptide comprises an amino acid sequence selected from the group consisting of:
  • the multi-antigen construct comprises a nucleotide sequence that encodes the amino acid sequence of SEQ ID NO:60 or 64.
  • the multi-antigen construct comprises: (i) a nucleotide sequence encoding an immunogenic PSA polypeptide, (ii) a nucleotide sequence encoding an immunogenic PSCA polypeptide, and (iii) a nucleotide sequence encoding an immunogenic PSMA polypeptide, wherein: (1 ) the nucleotide sequence encoding the immunogenic PSA polypeptide is selected from the group consisting of: (i) nucleotide sequence of SEQ ID NO:18; (ii) nucleotide sequence of SEQ ID NO:20; (iii) nucleotide sequence comprising nucleotides 10-720 of SEQ ID NO:18; (iv) nucleotide sequence comprising nucleotides 1 1 15-1825 of SEQ ID NO:58 or SEQ ID NO:63; (v) nucleotide sequence comprising nucleotides 1 106-1825 of SEQ ID NO:58 or SEQ ID NO:63
  • the nucleotide sequence encoding the immunogenic PSCA polypeptide is selected from the group consisting of: (i) the nucleotide sequence of SEQ ID NO:22; (ii) a nucleotide sequence comprising nucleotides 10- 375 of SEQ ID NO:22; (iii) a nucleotide sequence comprising nucleotides 1892-2257 of SEQ ID NO:58 or SEQ ID NO:63; (iv) a nucleotide sequence comprising nucleotides 1886-2257 of SEQ ID NO:58 or SEQ ID NO:63; and (v) a degerate variant of any of the nucleotide sequences provided in (i) - (iv) above; and
  • the nucleotide sequence encoding the immunogenic PSMA polypeptide is selected from the group consisting of: (i) the nucleotide sequence comprising nucleotides 43-2250 of SEQ ID NO:2; (ii) the nucleotide sequence of SEQ ID NO:4; (iii) the nucleotide sequence of SEQ ID NO:6; (iv) the nucleotide sequence of SEQ ID NO:8; (v) the nucleotide sequence of SEQ ID NO:10; (vi) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:4; (vii) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:6; (viii) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:8; (ix) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:10; (x) the nucle
  • the multi-antigen construct comprises a nucleotide sequence encoding an immunogenic PSA polypeptide, a nucleotide sequence encoding an immunogenic PSCA polypeptide, and a nucleotide sequence encoding an immunogenic PSMA polypeptide, wherein: the nucleotide sequence encoding the immunogenic PSA polypeptide comprises nucleotides 1 106-1825 of SEQ ID NO:58 or SEQ ID NO:63; the nucleotide sequence encoding the immunogenic PSCA polypeptide comprises nucleotides 1886-2257 of SEQ ID NO:58 or SEQ ID NO:62; and the nucleotide sequence encoding the immunogenic PSMA polypeptide comprises nucleotides 2324-4543 of SEQ ID NO:58 or SEQ ID NO:63.
  • intervening sequences are included between the sequences that encode the individual immunogenic PAA polypeptides (i.e., PSA, PSCA, and PSMA polypeptides). These intervening sequences enable the separate translation of the downstream immunogenic PAA polypeptide.
  • Such an intervening sequence is referred to as "separator sequence" in the specification.
  • Any sequences that can be used for the co-expression of multiple polypeptides from a single vector may be used as separator sequences in the vector provided by the present disclosure. Examples of useful separator sequences includes internal ribosomal entry sites (IRESs) and 2A peptide sequences.
  • 2A peptide and 2A peptide-like sequences are approximately 20 amino acids long with a highly conserved carboxy terminal D-V/I-EXNPGP motif ( Figure 2).
  • the sequences are rare in nature, most commonly found in viruses such as Foot-and- mouth disease virus (FMDV), Equine rhinitis A virus (ERAV), Encephalomyocarditis virus (EMCV), Porcine teschovirus (PTV), and Thosea asigna virus (TAV) (Luke, G. A., P. de Felipe, et al. (2008).
  • the ribosomal skipping acts like a cotranslational autocatalytic "cleavage" that releases upstream from downstream proteins.
  • General information regarding use of various 2A peptide sequences in vectors co-expressing multiple polypeptides may be found in Andrea L. Szymczak & Darrio AA Vignali: Development of 2A peptide-based strategies in the design of multicistronic vectors. Expert Opinion Biol. Ther. (2005)5(5) 627-638, the disclosure of which is incorporated herein by reference.
  • the incorporation of a 2A sequence between two protein antigens results in the addition of -20 amino acids onto the C-terminus of the upstream polypeptide and 1 amino acid (proline) to the N-terminus of downstream protein.
  • protease cleavage sites can be incorporated at the N terminus of the 2A cassette such that ubiquitous proteases will cleave the cassette from the upstream protein (Fang, J., S. Yi, et al. (2007). "An antibody delivery system for regulated expression of therapeutic levels of monoclonal antibodies in vivo.” Mol Ther 15(6): 1 153-1 159).
  • IRESs Internal ribosomal entry sites
  • Figure 3 Internal Ribosome Entry Site database. Nucleic Acids Res 31 (1 ): 427-428). They attract eukaryotic ribosomes to the RNA to facilitate translation of downstream open reading frames. Unlike normal cellular 7-methylguanosine cap-dependent translation, IRES-mediated translation can initiate at AUG codons far within an RNA molecule. The highly efficient process can be exploited for use in multi-cistronic expression vectors (Bochkov, Y. A. and A. C.
  • the multi-antigen construct comprises a EMCV IRES comprising nucleotides 1 -553 of SEQ ID NO:59.
  • PAA polypeptide-coding sequences on a multi-antigen construct The order of the separator sequences and the nucleotide sequences encoding the PAA polypeptides on a multi-antigen construct is shown in formula (I):
  • PAA1 -SS1 -PAA2-SS2-PAA3 (I)
  • PAA1 , PAA2, and PAA3 each is a nucleotide sequence encoding an immunogenic PSA polypeptide, a nucleotide sequence encoding immunogenic PSCA polypeptide, or a nucleotide sequence encoding immunogenic PSMA polypeptide, provided that PAA1 , PAA2, and PAA3 encode different PAA polypeptides, and (ii) SS1 and SS2 are separator sequences and can be same or different.
  • the vector comprises a multi-antigen construct of formula
  • PAA1 is a nucleotide sequence encoding an immunogenic PSA polypeptide
  • PAA2 is a nucleotide sequence encoding an immunogenic PSCA or PSMA polypeptide, (where PAA2 is nucleotide sequence encoding an immunogenic PSCA, then PAA3 is a nucleotide sequence encoding an immunogenic PSMA, or Vice Versa);
  • SS1 is a 2A-peptide sequence
  • SS2 is a 2A-peptide sequence or an IRES.
  • the multi-antigen construct has a structure selected from the group consisting of:
  • the vector comprises a multi-antigen construct having a structure of formula (I):
  • PAA1 -SS1 -PAA2-SS2-PAA3 (I)
  • PAA1 is a nucleotide sequence encoding an immunogenic PSA polypeptide and comprises nucleotides 1 1 15-1825 SEQ ID NO: 58 or comprises 1 106-1 1 14 of SEQ ID NO: 58 or 63;
  • PAA2 is a nucleotide sequence encoding an immunogenic PSCA polypeptide and comprises nucleotides 1892-2257 of SEQ ID NO: 58 or comprises 1886-2257 of
  • PAA3 is a nucleotide sequence encoding an immunogenic PSMA polypeptide and comprises nucleotides 2333-4543 SEQ ID NO: 58 or comprises 2324-4543 of SEQ ID NO: 58 or 63;
  • SS1 is a nucleotide sequence encoding T2A.
  • (v) SS2 is a nucleotide sequence encoding F2A.
  • the multi-antigen construct may also include a linker sequence positioned betyween a nucleotide sequence encoding an immunogenic PAA polypeptide (i.e, an immunogenic PSA, PSCA, or PSMA polypeptide) and a down-stream separator sequence.
  • a linker sequence is a nucleotide sequence encoding glycine-serine.
  • the multi-antigen construct comprises a nucleotide sequence that encodes an amino acid sequence of SEQ ID NO:60 or encodes an amino acid sequence of SEQ ID NO:61 .
  • the multi-antigen construct comprises a nucleotide sequence selected from the groups consisting of nucleotide sequence of SEQ ID NO:61 , nucleotide sequence of SEQ ID NO:65, nucleotide sequence of SEQ ID NO:66, and degenerate variant of any of the nucleotide sequences.
  • the vector may comprise other non-native regulatory sequences to drive the efficient expression of the encoded PAA polypeptides.
  • the regulatory sequences includes (1 ) transcription initiation, termination, promoter, and enhancer sequences; (2) efficient RNA processing signals such as splicing and polyadenylation signals; (3) sequences that stabilize cytoplasmic imRNA; (4) sequences that enhance translation efficiency (i.e., Kozak consensus sequence); (5) sequences that enhance protein stability; and (6) sequences that enhance protein secretion.
  • promoter systems that can be used in the vectors provided by the present disclosure to drive efficient expression in mammalian cells include SV40 promoter, chicken B actin promoter, human elongation factor promoter, human cytomegalovirus (CMV) promoter, simian CMV promoter, murine CMV promoter, psudorabies promoter, Rous Sarcoma Virus promoter, phosphoglycerate kinase promoter, murine leukemia virus LTR promoter, avian leukosis virus LTR promoter, mouse mammary tumor virus LTR promoter, moloney murine leukemia virus LTR promoter, plasminogen activator inhibitor promoter, CYR61 , adenovirus major late promoter, mouse metallothionein promoter, mouse phosphoenol-pyruvate carboxykinase promoter, bovine B-lactoglobulin promoter, bovine prolactin promoter, ubiquitin C promoter, and herpe
  • transcription termination signals include SV40 polyadenylation (polyA); bovine growth hormone polyA; rabbit B globin polyA; HSV thymidine kinase , glycoprotein B , and glycoprotein D; HPV E and L, and synthetic terminators.
  • polyA polyadenylation
  • bovine growth hormone polyA bovine growth hormone polyA
  • rabbit B globin polyA rabbit B globin polyA
  • HSV thymidine kinase glycoprotein B
  • glycoprotein D glycoprotein D
  • HPV E and L and synthetic terminators.
  • the C68 vectors comprise a human cytomegalovirus (CMV) promoter, optionally with the CMV enhancer, and a SV40 polyA.
  • CMV human cytomegalovirus
  • the present disclosure also provides a composition comprising a vector provided by the present disclosure (herein "vector composition').
  • vector compositions are useful for eliciting an immune response against a PAA protein in vitro or in vivo in a mammal, including a human.
  • the vector composition may comprise the vectors alone, or may further comprise an excipient.
  • the vector composition is a pharmaceutical composition, which comprises a vector provided by the present disclosure and a pharmaceutically acceptable excipient.
  • Suitable excipients for pharmaceutical compositions are known in the arts.
  • the excipients may include aqueous solutions, non aqueous solutions, suspensions, and emulsions.
  • non-aqueous excipients include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • examples of aqueous excipient include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Suitable excipients also include agents that assist in cellular uptake of the vector.
  • the pharmaceutical composition is a vaccine composition for administration to humans for inhibiting abnormal cell proliferation, providing protection against the development of cancer (used as a prophylactic), or for treatment of cancer (used as a therapeutic) associated with a PAA over-expression, or for eliciting an immune response to a particular human PAA, such as PSMA, PSA, and PSCA.
  • the vaccine composition may further comprise one or more adjuvants. Examples of adjuvants that may be included in the vaccine compositions are provided herein below.
  • the present disclosure provides methods of using the vector or composition comprising the vectors described herein above.
  • the present disclosure provides a method of eliciting an immune response against a PAA in a mammal, particularly a human, comprising administering to the mammal an effective amount of (1 ) a vector containing a multi-antigen construct, or (2) a composition comprising such vectors.
  • the present disclosure provides a method of inhibiting abnormal cell proliferation in a human, wherein the abnormal cell proliferation is associated with over-expression of a PAA.
  • the method comprises administering to the mammal an effective amount of (1 ) a vector containing a multi-antigen construct encoding two or more immunogenic PAA polypeptides, or (2) a composition comprising such vectors.
  • the method is for inhibiting abnormal cell proliferation in prostate in a human.
  • the present disclosure provides a method of inhibiting abnormal cell proliferation in prostate over-expressing PSMA.
  • the disclosure provides a method of treating prostate cancer in a human, comprising administering to the human an effective amount of a (1 ) a vector containing a multi-antigen construct or (2) a composition comprising such vectors.
  • the multi-antigen construct is a triple antigen construct that encodes an immunogenic PSMA polypeptide, an immunogenic PSA polypeptide, and an immunogenic PSCA polypeptide.
  • the vectors or vector compositions can be administered to an animal, including human, by a number of methods known in the art.
  • suitable methods include: (1 ) intramuscular, intradermal, intraepidermal, intravenous, intraarterial, subcutaneous, or intraperitoneal administration, (2) oral administration, and (3) topical application (such as ocular, intranasal, and intravaginal application).
  • One particular method of intradermal or intraepidermal administration of a nucleic acid vaccine composition involves the use of gene gun delivery technology, such the Particle Mediated Epidermal Delivery (PMEDTM) vaccine delivery device marketed by PowderMed.
  • PMEDTM Particle Mediated Epidermal Delivery
  • Another particular method for intramuscular administration of a nucleic acid vaccine is injection followed by electroporation.
  • the effective amount of the vector or vector composition to be administered in a given method can be readily determined by a person skilled in the art and will depend on a number of factors.
  • factors that may be considered in determining the effective amount include, but not limited: (1 ) the subject to be treated, including the subject's immune status and health, (2) the severity or stage of the cancer to be treated, (3) the specific immunogenic PAA polypeptides expressed, (4) the degree of protection or treatment desired, (5) the administration method and schedule, (6) formulations used, and (7) co-administration of other therapeutic agents (such as adjuvants or immune modulators).
  • the effective amounts of the vector may be in the range of 2 ⁇ g/dose - 10 mg/dose when the nucleic acid vaccine composition is formulated as an aqueous solution and administered by hypodermic needle injection or pneumatic injection, whereas only 16 ng/dose - 16 ⁇ g/dose may be required when the nucleic acid is prepared as coated gold beads and delivered using a gene gun technology.
  • the vectors or vector compositions, including vaccine compositions, provided by the present disclosure may be used together with one or more adjuvants.
  • suitable adjuvants include: (1 ) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl polypeptides or bacterial cell wall components), such as MF59TM (containing 5% Squalene, 0.5% Tween 80, and 0.5% sorbitan trioleate) and SAF (containing 10% Squalene, 0.4% Tween 80, 5% pluronic- blocked polymer L121 , and thr-MDP); (2) saponin adjuvants, such as QS21 , STIMULONTM (Cambridge Bioscience, Worcester, MA), Abisco® (Isconova, Sweden), or Iscomatrix® (Commonwealth Serum Laboratories, Australia); (3) complete Freund's Adjuvant (CFA) and incomplete Freund's Adjuvant (IFA); (4) oligonucleotides comprising CpG motifs, i.e.
  • cytosine is unmethylated (e.g., Krieg, Vaccine (2000) 19:618-622; Krieg, Curr Opin Mol Ther (2001 ) 3:15-24; WO 98/40100, WO 98/55495, WO 98/37919 and WO 98/52581 ); and (5) metal salt including aluminum salts (such as alum, aluminum phosphate, aluminum hydroxide); (12) a saponin and an oil-in-water emulsion ⁇ e.g. WO 99/1 1241 ).
  • the vectors or vector compositions provided by the present disclosure may be used together with one or more immune modulators.
  • the present disclosure provides a method of treating prostate cancer in a mammal, particularly a human, the method comprising administering to the mammal: (1 ) an effective amount of a vector, vector composition, or vaccine provided by the present invention; (2) an effective amount of at least one immune-suppressive-cell inhibitor (ISC inhibitor); and (3) an effective amount of at least one immune-effector-cell enhancer (IEC enhancer).
  • This method is also referred to as "vaccine-based immunotherapy regimen" (or "VBIR”) in the present disclosure.
  • the IEC enhancers and ISC inhibitors may be administered by any suitable methods and routes, including (1 ) systemic administration such as intravenous, intramuscular, or oral administration, and (2) local administration such intradermal and subcutaneous administration. Where appropriate or suitable, local administration is generally preferred over systemic administration. Local administration of any IEC enhancer and ISC inhibitor can be carried out at any location of the body of the mammal that is suitable for local administration of pharmaceuticals; however, it is more preferable that these immune modulators are administered locally at close proximity to the vaccine draining lymph node. Two or more specific IEC enhancers from a single class of IEC enhancers (for examples, two CTLA-antagonists) may be administered in combination with the ISC inhibitors.
  • two or more specific IEC enhancers from two or more different classes of IEC enhancers may be administered together.
  • two or more specific ISC inhibitors from a single class of ISC inhibitors may be administered in combination with the IEC enhancers.
  • two or more specific ISC inhibitors from two or more different classes of ISC inhibitors may be administered together.
  • the vectors or vector compositions may be administered simultaneously or sequentially with any or all of the immune modulators (i.e., ISC inhibitors and IEC enhancers) used. Similarly, when two or more immune modulators are used, they may be administered simultaneously or sequentially with respect to each other. In some embodiments, a vector or vector composition is administered simultaneously (e.g., in a mixture) with respect to one immune modulator, but sequentially with respect to one or more additional immune modulators. Co-administration of the vector or vector composition and the immune modulators can include cases in which the vaccine and at least one immune modulator are administered so that each is present at the administration site, such as vaccine draining lymph node, at the same time, even though the antigen and the immune modulators are not administered simultaneously.
  • the immune modulators i.e., ISC inhibitors and IEC enhancers
  • Co-administration of the vaccine and the immune modulators also can include cases in which the vaccine or the immune modulator is cleared from the administration site, but at least one cellular effect of the cleared vaccine or immune modulator persists at the administration site, such as vaccine draining lymph node, at least until one or more additional immune modulators are administered to the administration site.
  • a nucleic acid vaccine is administered in combination with a CpG
  • the vaccine and CpG may be contained in a single formulation and administered together by any suitable method.
  • the nucleic acid vaccine and CpG in a co- formulation (mixture) is administered by intramuscular injection in combination with electroporation.
  • ISC inhibitors may be used in combination with the vectors or vector compositions provided by the present invention.
  • classes of ISC inhibitors include PD-1/PD-L1 antagonists, protein kinase inhibitors, cyclooxygenase-2 (COX-2) inhibitors, phosphodiesterase type 5 (PDE5) inhibitors, and DNA crosslinkers.
  • COX-2 cyclooxygenase-2
  • PDE5 phosphodiesterase type 5
  • COX-2 inhibitors include celecoxib and rofecoxib.
  • PDE5 inhibitors examples include avanafil, lodenafil, mirodenafil, sildenafil, tadalafil, vardenafil, udenafil, and zaprinast.
  • An example of DNA crosslinkers is cyclophosphamide. Examples of specific protein kinase inhibitors are described in details below.
  • protein kinase inhibitor refers to any substance that acts as a selective or non-selective inhibitor of a protein kinase.
  • protein kinases refers to the enzymes that catalyze the transfer of the terminal phosphate of adenosine triphosphate to tyrosine, serine or threonine residues in protein substrates. Protein kinases include receptor tyrosine kinases and non-receptor tyrosine kinases.
  • receptor tyrosine kinases include EGFR (e.g., EGFR/HER1 /ErbB1 , HER2/Neu/ErbB2, HER3/ErbB3, HER4/ErbB4), INSR (insulin receptor), IGF-IR, IGF-II1 R, IRR (insulin receptor-related receptor), PDGFR (e.g., PDGFRA, PDGFRB), c-KIT/SCFR, VEGFR- 1 /FLT-1 , VEGFR-2/FLK-1 /KDR, VEGFR-3/FLT-4, FLT-3/FLK-2, CSF-1 R, FGFR 1 -4, CCK4, TRK A-C, MET, RON, EPHA 1 -8, EPHB 1 -6, AXL, MER, TYRO3, TIE, TEK, RYK, DDR 1 -2, RET, c-ROS, LTK (leukocyte tyrosine kinase), A
  • non-receptor tyrosine kinases examples include BCR-ABL, Src, Frk, Btk, Csk, Abl, Zap70, Fes/Fps, Fak, Jak, Ack, and LIMK.
  • suboptimal dose refers to the dose amount that is below the minimum effective dose when the tyrosine kinase inhibitor is administered in a monotherapy (i.e., where the protein kinase inhibitor is administered alone without any other therapeutic agents) for the target neoplastic disorder.
  • Examples of specific protein kinase inhibitors suitable for use in the vaccine- based immunotherapy regimen include lapatinib, AZD 2171 , ET18OCH 3, indirubin-3'- oxime, NSC-154020, PD 169316, quercetin, roscovitine, triciribine, ZD1839, 5- lodotubercidin, adaphostin, aloisine, alsterpaullone, aminogenistein, API-2, apigenin, arctigenin, ARRY-334543, axitinib, AY-22989, AZD 2171 , Bisindolylmaleimide IX, CCI- 779, chelerythrine, DMPQ, DRB, edelfosine, ENMD-981693, erbstatin analog, erlotinib, fasudil, gefitinib (ZD1839), H-7, H-8, H-89, HA-100,
  • the protein kinase inhibitor is a multi-kinase inhibitor, which is an inhibitor that acts on more than one specific kinase.
  • multi- kinase inhibitors include imatinib, sorafenib, lapatinib, BIRB-796, and AZD-1 152, AMG706, zactima, MP-412, sorafenib, dasatinib, lestaurtinib, XL647, XL999, lapatinib, MLN518, (also known as CT53518), PKC412, ST1571 , AEE 788, OSI-930, OSI-817, sunitinib malate, eriotinib, gefitinib, axitinib, bosutinib, temsirolismus and nilotinib.
  • the tyrosine kinase inhibitor is sunitinib, sorafenib, or a pharmaceutically acceptable salt or derivative (such as a malate or a tosylate) of sunitinib or sorafenib.
  • Sunitinib malate which is marketed by Pfizer Inc. under the trade name SUTENT, is described chemically as butanedioic acid, hydroxy-, (2S)-, compound with A/-[2- (diethylamino)ethyl]-5-[(Z)-(5-fluoro-1 ,2-dihydro-2-oxo-3H-indol-3-ylidine)methyl]-2,4- dimethyl- 7H-pyrrole-3-carboxamide (1 :1 ).
  • SUTENT Sunitinib malate, which is marketed by Pfizer Inc. under the trade name SUTENT
  • pancreatic neuroendocrine tumors for the treatment of gastrointestinal stromal tumor, advanced renal cell carcinoma, and progressive, well- differentiated pancreatic neuroendocrine tumors in patients with unresectable locally advanced or metastatic disease.
  • the recommended dose of sunitinib malate for gastrointestinal stromal tumor (GIST) and advanced renal cell carcinoma (RCC) for humans is 50 mg taken orally once daily, on a schedule of 4 weeks on treatment followed by 2 weeks off (Schedule 4/2).
  • the recommended dose of sunitinib malate for pancreatic neuroendocrine tumors (pNET) is 37.5 mg taken orally once daily.
  • sunitinib malate may be administered orally in a single dose or multiple doses.
  • sunitinib malate is delivered for two, three, four or more consecutive weekly doses followed by a "off" period of about 1 or 2 weeks, or more where no sunitinib malate is delivered.
  • the doses are delivered for about 4 weeks, with 2 weeks off.
  • the sunitinib malate is delivered for two weeks, with 1 week off. However, it may also be delivered without a "off period for the entire treatment period.
  • the effective amount of sunitinib malate administered orally to a human in the vaccine-based immunotherapy regimen is typically below 40 mg per person per dose.
  • sunitinib malate is administered orally in the range of 1 - 25 mg per person per dose. In some other embodiments, sunitinib malate is administered orally in the range of 6.25, 12.5, or 18.75 mg per person per dose. Other dosage regimens and variations are foreseeable, and will be determined through physician guidance.
  • Sorafenib tosylate which is marketed under the trade name NEXAVAR, is also a multi-kinase inhibitor. Its chemical name is 4-(4- ⁇ 3-[4-Chloro-3-(trifluoromethyl) phenyl]ureido ⁇ phenoxy)-N-methylpyrid-ine-2-carboxamide. It is approved in the U.S. for the treatment of primary kidney cancer (advanced renal cell carcinoma) and advanced primary liver cancer (hepatocellular carcinoma). The recommended daily dose is 400 mg taken orally twice daily. In the vaccine-based immunotherapy regimen provided by the present disclosure, the effective amount of sorafenib tosylate administered orally is typically below 400 mg per person per day.
  • the effective amount of sorafenib tosylate administered orally is in the range of 10 - 300 mg per person per day. In some other embodiments, the effective amount of sorafenib tosylate administered orally is between 10 - 200 mg per person per day, such as 10, 20, 60, 80, 100, 120, 140, 160, 180, or 200 mg per person per day.
  • Axitinib which is marketed under the trade name INLYTA, is a selective inhibitor of VEGF receptors 1 , 2, and 3. Its chemical name is (A/-Methyl-2-[3-((E)-2-pyridin-2-yl- vinyl)-1 -/-indazol-6-ylsulfanyl]-benzamide. It is approved for the treatment of advanced renal cell carcinoma after failure of one prior systemic therapy. The starting dose is 5 mg orally twice daily. Dose adjustments can be made based on individual safety and tolerability.
  • the effective amount of axitinib administered orally is typically below 5 mg twice daily. In some other embodiments, the effective amount of axitinib administered orally is between 1 -5 mg twice daily. In some other embodiments, the effective amount of axitinib administered orally is between 1 , 2, 3, 4, or 5 mg twice daily.
  • IEC enhancers may be used. They may be small molecules or large molecules (such as protein, polypeptide, DNA, RNA, and antibody). Examples of IEC enhancers that may be used include TNFR agonists, CTLA-4 antagonists, TLR agonists, programmed cell death protein 1 (PD-1 ) antagonists (such as anti-PD-1 antibody CT-01 1 ), and programmed cell death protein 1 ligand 1 (PD-L1 ) antagonists (such as BMS-936559), lymphocyte-activation gene 3 (LAG3) antagonists, and T cell Immunoglobulin- and mucin-domain-containing molecule -3 (TIM-3) antagonists. Examples of specific TNFR agonists, CTLA-4 antagonists, and TLR agonists are provided in details herein below.
  • TNFR agonists include agonists of OX40, 4-1 BB (such as BMS- 663513), GITR (such as TRX518), and CD40. Examples of specific CD40 agonists are described in details herein below.
  • CD40 agonists are substances that bind to a CD40 receptor on a cell and are capable of increasing one or more CD40 or CD40L associated activities.
  • CD40 "agonists” encompass CD40 "ligands”.
  • CD40 agonists include CD40 agonistic antibodies, fragments CD40 agonistic antibodies, CD40 ligands (CD40L), and fragments and derivatives of CD40L such as oligomeric (e.g., bivalent, trimeric CD40L), fusion proteins containing and variants thereof.
  • CD40 ligands for use in the present invention include any peptide, polypeptide or protein, or a nucleic acid encoding a peptide, polypeptide or protein that can bind to and activate one or more CD40 receptors on a cell.
  • Suitable CD40 ligands are described, for example, in U.S. Pat. No. 6,482,41 1 ; U.S. Pat. No.6,410,71 1 ; U.S. Pat. No. 6,391 ,637; and U.S. Pat. No. 5,981 ,724, all of which patents and application and the CD40L sequences disclosed therein are incorporated by reference in their entirety herein.
  • CD40 ligands will be preferred for use in human therapy, CD40 ligands from any species may be used in the invention.
  • a species of CD40 ligand matched to the animal being treated will be preferred.
  • the CD40 ligand is a gp39 peptide or protein oligomer, including naturally forming gp39 peptide, polypeptide or protein oligomers, as well as gp39 peptides, polypeptides, proteins (and encoding nucleic acids) that comprise an oligomerization sequence.
  • oligomers such as dimers, trimers and tetramers are preferred in certain aspects of the invention, in other aspects of the invention larger oligomeric structures are contemplated for use, so long as the oligomeric structure retains the ability to bind to and activate one or more CD40 receptor(s).
  • the CD40 agonist is an anti-CD40 antibody, or antigen-binding fragment thereof.
  • the antibody can be a human, humanized or part- human chimeric anti-CD40 antibody.
  • specific anti-CD40 monoclonal antibodies include the G28-5, mAb89, EA-5 or S2C6 monoclonal antibody, and CP870893.
  • the anti-CD40 agonist antibody is CP870893 or dacetuzumab (SGN-40).
  • CP-870,893 is a fully human agonistic CD40 monoclonal antibody (imAb) that has been investigated clinically as an anti-tumor therapy.
  • the structure and preparation of CP870,893 is disclosed in WO2003041070 (where the antibody is identified by the internal identified "21 .4.1 " ).
  • the amino acid sequences of the heavy chain and light chain of CP-870,893 are set forth in SEQ ID NO: 40 and SEQ ID NO: 41 , respectively.
  • CP870,893 was administered by intravenous infusion at doses generally in the ranges of 0.05 - 0.25 mg/kg per infusion.
  • CP-870,893 can be administered intradermally, subcutaneously, or topically. It is preferred that it is administered intradermally.
  • the effective amount of CP870893 to be administered in the regimen is generally below 0.2 mg/kg, typically in the range of 0.01 mg - 0.15 mg/kg, or 0.05 - 0.1 mg/kg.
  • Dacetuzumab also known as SGN-40 or huS2C6; CAS number 88-486-59-9 is another anti-CD40 agonist antibody that has been investigated in clinical trials for indolent lymphomas, diffuse large B cell lymphomas and Multiple Myeloma. In the clinical trials, dacetuzumab was administered intravenously at weekly doses ranging from 2 mg/kg to 16 mg/kg.
  • dacetuzumab can be administered intradermally, subcutaneously, or topically. It is preferred that it is administered intradermally.
  • the effective amount of dacetuzumab to be administered in the vaccine-based immunotherapy regimen is generally below 16 mg/kg, typically in the range of 0.2 mg - 14 mg/kg, or 0.5 -8 mg/kg, or 1 - 5 mg/kg.
  • Suitable anti-CTLA-4 antagonist agents for use in the vaccine-based immunotherapy regimen provided by the disclosure include, without limitation, anti- CTLA-4 antibodies (such as human anti-CTLA-4 antibodies, mouse anti-CTLA-4 antibodies, mammalian anti-CTLA-4 antibodies, humanized anti-CTLA-4 antibodies, monoclonal anti-CTLA-4 antibodies, polyclonal anti-CTLA-4 antibodies, chimeric anti- CTLA-4 antibodies, anti-CTLA-4 domain antibodies), fragments of anti-CTLA-4 antibodies (such as (single chain anti-CTLA-4 fragments, heavy chain anti-CTLA-4 fragments, and light chain anti-CTLA-4 fragments), and inhibitors of CTLA-4 that agonize the co-stimulatory pathway.
  • the CTLA-4 inhibitor is Ipilimumab or Tremelimumab.
  • Ipilimumab (also known as MEX-010 or MDX-101 ), marketed as YERVOY, is a human anti-human CTLA-4 antibody. Ipilimumab can also be referred to by its CAS Registry No. 477202-00-9, and is disclosed as antibody 10DI in PCT Publication No. WO01 /14424, which is incorporated herein by reference in its entirety. Examples of pharmaceutical composition comprising Ipilimumab are provided in PCT Publication No. WO2007/67959. Ipilimumab is approved in the U.S. for the treatment of unresectable or metastatic melanoma.
  • the recommended dose of Ipilimumab as monotherapy is 3 mg/kg by intravenous administration every 3 weeks for a total of 4 doses.
  • Ipilimumab is administered locally, particularly intradermally or subcutaneously.
  • the effective amount of Ipilimumab administered locally is typically in the range of 5 - 200 mg/dose per person.
  • the effective amount of Ipilimumab is in the range of 1 0 - 150 mg/dose per person per dose.
  • the effective amount of Ipilimumab is about 10, 25, 50, 75, 100, 125, 150, 175, or 200 mg/dose per person.
  • Tremelimumab (also known as CP-675,206) is a fully human lgG2 monoclonal antibody and has the CAS number 745013-59-6. Tremelimumab is disclosed as antibody 1 1 .2.1 in U.S. Patent No: 6,682,736, incorporated herein by reference in its entirety and for all purposes. The amino acid sequences of the heavy chain and light chain of Tremelimumab are set forth in SEQ IND NOs:42 and 43, respectively. Tremelimumab has been investigated in clinical trials for the treatment of various tumors, including melanoma and breast cancer; in which Tremelimumab was administered intravenously either as single dose or multiple doses every 4 or 12 weeks at the dose range of 0.01 and 15 mg/kg.
  • Tremelimumab is administered locally, particularly intradermally or subcutaneously.
  • the effective amount of Tremelimumab administered intradermally or subcutaneously is typically in the range of 5 - 200 mg/dose per person.
  • the effective amount of Tremelimumab is in the range of 10 -150 mg/dose per person per dose.
  • the effective amount of Tremelimumab is about 10, 25, 37.5, 40, 50, 75, 100, 125, 150, 175, or 200 mg/dose per person.
  • TLR Toll-like Receptor
  • TLR agonist refers to a compound that acts as an agonist of a toll-like receptor (TLR). This includes agonists of TLR1 , TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, and TLR1 1 or a combination thereof. Unless otherwise indicated, reference to a TLR agonist compound can include the compound in any pharmaceutically acceptable form, including any isomer (e.g., diastereomer or enantiomer), salt, solvate, polymorph, and the like.
  • a compound is optically active
  • reference to the compound can include each of the compound's enantiomers as well as racemic mixtures of the enantiomers.
  • a compound may be identified as an agonist of one or more particular TLRs (e.g., a TLR7 agonist, a TLR8 agonist, or a TLR7/8 agonist).
  • the TLR agonists are TLR9 agonists, particularly CpG oligonucleotides (or CpG.ODN).
  • a CpG oligonucleotide is a short nucleic acid molecule containing a cytosine followed by a guanine linked by a phosphate bond in which the pyrimidine ring of the cytosine is unmethylated.
  • a CpG motif is a pattern of bases that include an unmethylated central CpG surrounded by at least one base flanking (on the 3' and the 5' side of) the central CpG.
  • CpG oligonucleotides include both D and K oligonucleotides.
  • CpG oligonucleotide can be unmethylated or portions may be unmethylated.
  • CpG oligonucleotides useful in the methods provided by the present disclosure include those disclosed in U.S. Patent Nos. 61 94388, 6207646, 6214806, 628371 , 62391 16, and 6339068.
  • CpG oligonucleotides useful in the methods provided by the present disclosure include:
  • CpG7909 a synthetic 24mer single stranded oligonucleotide, has been extensively investigated for the treatment of cancer as a monotherapy and in combination with chemotherapeutic agents, as well as an adjuvant for vaccines against cancer and infectious diseases. It was reported that a single intravenous dose of CpG 7909 was well tolerated with no clinical effects and no significant toxicity up to 1 .05 mg/kg, while a single dose subcutaneous CpG 7909 had a maximum tolerated dose (MTD) of 0.45 mg/kg with dose limiting toxicity of myalgia and constitutional effects.
  • MTD maximum tolerated dose
  • CpG 7909 may be administered by injection into the muscle or by any other suitable methods. It is preferred that it is administered locally in proximity to the vaccine draining lymph node, particularly by intradermal or subcutaneous administration.
  • a CpG may be preferably co-formulated with the vaccine in a single formulation and administered by intramuscular injection coupled with electroporation.
  • the effective amount of CpG7909 by intramuscular, intradermal, or subcutaneous administration is typically in the range of 10 ⁇ g/dose - 10 mg/dose. In some embodiments, the effective amount of CpG7909 is in the range of 0.05 mg - 14 mg/dose. In some particular embodiments, the effective amount of CpG7909 is about 0.05, 0.1 , 0.2, 0.3, 0.4, 0.5, 05 1 mg/dose. Other CpG oligonucleotides, including CpG 24555 and CpG 10103, may be administered in similar manner and dose levels.
  • the present disclosure provides a method of enhancing the immunogenicity or therapeutic effect of a vaccine for the treatment of a neoplastic disorder in a human, comprising administering the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib, erlotinib, gefitinib, axitinib, bosutinib, temsirolismus, or nilotinib and wherein the at least one lEC enhancer is selected from a CTLA-4 inhibitor, a TLR agonist, or a CD40 agonist.
  • the at least one ISC inhibitor is protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib, erlotinib, gefitin
  • regimen comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from axitinib, sorafenib tosylate, or sunitinib malate and wherein the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab.
  • the at least one ISC inhibitor is a protein kinase inhibitor selected from axitinib, sorafenib tosylate, or sunitinib malate
  • the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab.
  • the regimen comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least two lEC enhancers, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sunitinib or axitinib and wherein the at least two lEC enhancers are Tremelimumab and a TLR agonist selected from CpG7909, CpG2455, or CpG10103.
  • the present disclosure provides a method of treating prostate cancer in a human, comprising administering to the human (1 ) an effective amount of a vaccine capable of eliciting an immune response against a human PAA, (2) an effective amount of at least one ISC inhibitor, and (3) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib, erlotinib, gefitinib, axitinib, bosutinib, temsirolismus, or nilotinib, and wherein the at least one lEC enhancer is selected from a CTLA-4 inhibitor, a TLR agonist, or a CD40 agonist.
  • the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib,
  • the method comprises administering to the human (1 ) an effective amount of a vaccine capable of eliciting an immune response against a human PAA, (2) an effective amount of at least one ISC inhibitor, and (3) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, or axitinib and wherein the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab.
  • the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, or axitinib
  • the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab.
  • the method comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least two lEC enhancers, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sunitinib or axitinib and wherein the at least two IEC enhancers are Tremelimumab and a TLR agonist selected from CpG7909, CpG2455, or CpG10103.
  • the vaccine-based immunotherapy regimen provided by the present disclosure may further comprise an additional therapeutic agent.
  • cancer therapeutic agents may be used, including chemotherapeutic agents and hormone therapeutic agents.
  • chemotherapeutic agent refers to a chemical or biological substance that can cause death of cancer cells, or interfere with growth, division, repair, and/or function of cancer cells. Examples of particular chemotherapeutic agents include: abiraterone acetate, cabazitaxel, degarelix, denosumab, docetaxel, enzalutamide, leuprolide acetate, prednisone, sipuleucel-T, and radium 223 dichloride.
  • hormone therapeutic agent refers to a chemical or biological substance that inhibits or eliminates the production of a hormone, or inhibits or counteracts the effect of a hormone on the growth and/or survival of cancer cells.
  • hormone therapeutic agents include leuprolide, goserelin, triptorelin, histrelin, bicalutamide, flutamide, and nilutamide.
  • the VBIR provided by this disclosure may also be used in combination with other therapies, including (1 ) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland, and (2) radiation treatment, in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
  • Human PSMA cytosolic antigen An immunogenic PSMA polypeptide in cytosolic form was designed to retain the immunogenic polypeptide inside the cell once it is expressed.
  • the cytoplasmic domain (amino acids 1 -19) and the transmembrane domain (amino acids 20-43) of the human PSMA were removed, resulting in a cytosolic PSMA polypeptide that consists of amino acids 44-750 (extracellular domain or ECD) of the human PSMA of SEQ ID NO: 1 .
  • the optimal Kozak sequence "MAS" may be added to the N-terminus of the polypeptide for enhancing the expression or to facilitate cloning.
  • Human PSMA secreted antigen An immunogenic PSMA polypeptide in secreted form was designed to secret the polypeptide outside of the cell once it is expressed.
  • the secreted polypeptide is made with amino acids 44-750 (ECD) of the human PSMA of SEQ ID NO:1 and the Ig Kappa secretory element that has the amino acid sequence ETDTLLLWVLLLWVPGSTGD and a two-amino acid linker (AA) in the N- terminal in order to maximize the secretion of the PSMA antigen once it is expressed.
  • Human PSMA membrane-bound antigen An immunogenic PSMA membrane-bound polypeptide was designed to stabilize the polypeptide on the cell surface. The first 14 amino acids of the human PSMA protein were removed and the resultant immunogenic polypeptide consists of amino acids 15 - 750 of the human PSMA protein of SEQ ID NO:1 .
  • the immunogenic polypeptide that consists of amino acids 15 - 750 of the native human PSMA protein of SES ID NO: 1 and share 100% sequence identity with the native human PSMA protein is also referred to as "human PSMA modified,” "hPSMA modified,” or “hPSMAmod” antigen in the present disclosure.
  • the following three immunogenic PSMA polypeptides (referred to as "shuffled PSMA modified antigens") that are variants of the human PSMA modified antigen (SEQ ID NO:9) were also generated:
  • nucleodie sequences encoding the shuffled PSMA modified antigens 1 , 2, and 3 are set forth in SEQ ID NOs: 4, 6, and 8, respectively.
  • a large scale plasmid DNA preparation (Qiagen/CsCI) was produced from a sequence confirmed clone. The quality of the plasmid DNA was confirmed by high 260/280 ratio, high super coiled/nicked DNA ratio, low endotoxin levels ( ⁇ 10U/mg DNA) and negative bio burden.
  • the expression of the PSMA cytosolic, secreted, and modified antigens was determined by FACS.
  • Mammalian 293 cells were transfected with the PJV7563 PMED vectors encoding the various immunogenic PSMA polypeptides. Three days later, the 293 cells were stained with mouse anti-PSMA antibody, followed with a fluorescent conjugated (FITC) rat anti-mouse secondary antibody. The results are presented tin Table 2. The data were reported as mean fluorescent intensity (MFI) over negative controls, confirmed that human PSMA modified antigen is expressed on the cell surface.
  • MFI mean fluorescent intensity
  • immunogenic PSA polypeptides in the three forms were also designed based on the human PSA sequence.
  • An immunogenic PSA polypeptide in cytosolic form which consists of amino acids 25-261 of the native human PSA, is constructed by deleting the secretory signal and the pro domain (amino acids 1 -24).
  • the amino acid sequence of this cytosolic immunogenic PSA polypeptide is provided in SEQ ID NO: 17.
  • the secreted form of the PSA polypeptide is the native full length human PSA (amino acids 1 -261 ).
  • An immunogenic PSA polypeptide in membrane-bound form is constructed by linking the immunogenic PSA polypeptide cytosolic form (amino acids 25-261 of the native human PSA) to the human PSMA transmembrane domain (amino acids 15-54 of the human PSMA).
  • HLA A2 Pasteur mice or HLA A24 mice were immunized with DNA expressing the various PSA antigens using PMED provided in Example 3A in a prime/boost/boost regimen with two week intervals between each vaccination as described in Example 1 .
  • the antigen specific T and B cell responses were measured 7 days after the last immunization in an interferon-gamma (IFNy) ELISPOT assay and sandwich ELISA.
  • IFNy interferon-gamma
  • ELISpot data shown in Table 3 indicates that immunogenic PSA polypeptides in both cytosolic and membrane-bound forms are capable of inducing T cells that recognize human tumor cells transduced with adenovirus to express the cytosolic PSA antigen (SKmel5-Ad-PSA) but not cells transduced with adenovirus to express eGFP (SKmel5-Ad-eGFP). These two antigens also elicited response to PSA protein. The PSA secreted antigen failed to induce T cells to both SKmel5-Ad-PSA or PSA protein. SFC>50 is considered positive.
  • plasmids comprising a multi-antigen construct using different strategies are described. These plasmids share the same general plasmid backbone as pPJV7563. Unless otherwise specified, the genes included in the multi-antigen constructs encode (1 ) an immunogenic PSMA polypeptide of SEQ ID NO:9, (2) an immunogenic PSCA polypeptide comprising amino acids 2-125 of SEQ ID NO:21 , and (3) an immunogenic PSA polypeptide of SEQ ID NO:17.
  • Plasmid 460 (PSMA/PSCA Dual promoter). Plasmid 460 was constructed using the techniques of site-directed mutagenesis, PCR, and restriction fragment insertion. First, a Kpn I restriction site was introduced upstream of the CMV promoter in plasmid 5259 using site-directed mutagenesis with MD5 and MD6 primers according to manufacturer's protocol (Quickchange kit, Agilent Technologies, Santa Clara, CA). Second, an expression cassette consisting of a minimal CMV promoter, human PSMA, and rabbit B globulin transcription terminator was amplified by PCR from plasmid 5166 using primers that carried Kpn I restriction sites (MD7 and MD8). The PCR amplicon was digested with Kpn I and inserted into the newly introduced Kpn I site of calf intestinal alkaline phosphatase (CIP)- treated plasmid 5259.
  • CIP calf intestinal alkaline phosphatase
  • Plasmid 451 (PSMA-T2A-PSCA). Plasmid 451 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding human PSMA amino acids 15-750 was amplified by PCR using plasmid 5166 as a template with primers 1 19 and 1 17. The gene encoding full-length human PSCA was amplified by PCR using plasmid 5259 as a template with primers 1 18 and 120. PCR resulted in the addition of overlapping TAV 2A (T2A) sequences at the 3' end of PSMA and 5' end of PSCA. The amplicons were mixed together and amplified by PCR with primers 1 19 and 120.
  • TAV 2A TAV 2A
  • PSMA-T2A-PSCA amplicon was digested with Nhe I and Bgl II and inserted into similarly digested plasmid 5166.
  • a glycine-serine linker was included between PSMA and the T2A cassette to promote high cleavage efficiency.
  • Plasmid 454 (PSCA-F2A-PSMA). Plasmid 454 was created using the techniques of PCR and restriction fragment exchange. First, the gene encoding full-length human PSCA was amplified by PCR using plasmid 5259 as a template with primers 42 and 132. The amplicon was digested with BamH I and inserted into similarly digested, CIP-treated plasmid 5300. A glycine-serine linker was included between PSCA and the FMDV 2A (F2A) cassette to promote high cleavage efficiency.
  • F2A FMDV 2A
  • Plasmid 5300 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers MD1 and MD2. The gene encoding human PSMA amino acids 15-750 was amplified by PCR from plasmid 5166 with primers MD3 and MD4. PCR resulted in the addition of overlapping F2A sequences at the 3' end of PSA and 5' end of PSMA. The amplicons were mixed together and extended by PCR. The PSA-F2A-PSMA amplicon was digested with Nhe I and Bgl II and inserted into similarly digested plasmid pPJV7563.
  • Plasmid 449 (PSMA-mlRES-PSCA). Plasmid 449 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding full length human PSCA was amplified by PCR from plasmid 5259 with primers 124 and 123. The minimal EMCV IRES was amplified by PCR from pShuttle- IRES with primers 101 and 125. The overlapping amplicons were mixed together and amplified by PCR with primers 101 and 123. The IRES-PSCA amplicon was digested with Bgl II and BamH I and inserted into Bgl ll-digested, CIP-treated plasmid 5166. In order to fix a spontaneous mutation within the IRES, the IRES containing Avr II to Kpn I sequence was replaced with an equivalent fragment from pShuttle-IRES.
  • Plasmid 603 (PSCA-plRES-PSMA). Plasmid 603 was constructed using the techniques of PCR and seamless cloning. The gene encoding full length human PSCA attached at its 3'end to a preferred EMCV IRES was amplified from plasmid 455 by PCR with primers SD546 and SD547. The gene encoding human PSMA amino acids 15-750 was amplified by PCR from plasmid 5166 using primers SD548 and SD550. The two overlapping PCR amplicons were inserted into Nhe I and Bgl ll-digested pPJV7563 by seamless cloning according to manufacturer's instructions (Invitrogen, Carlsbad, CA).
  • Plasmid 455 (PSCA-mlRES-PSA). Plasmid 455 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding human PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers 1 15 and 1 14. The minimal EMCV IRES was amplified by PCR from pShuttle-IRES with primers 101 and 1 16. The overlapping amplicons were mixed together and amplified by PCR with primers 101 and 1 14. The IRES-PSA amplicon was digested with Bgl II and BamH I and inserted into Bgl ll-digested, CIP-treated plasmid 5259. In order to fix a spontaneous mutation within this clone, the Bgl II to BstE II sequence was replaced with an equivalent fragment from a fresh overlapping PCR reaction.
  • a number of dual antigen plasmids including PSA-F2A-PSMA, PSMA-mlRES-PSCA, PSMA-T2A-PSCA, PSA-T2A-PSCA, PSCA-F2A-PSMA, PSCA- plRES-PSMA, and PSMA-mlRES-PSA, were selected for incorporation in various combinations into triple antigen plasmid vectors.
  • the plasmid vectors were based on the parental pPJV7563 plasmid backbone.
  • Four plasmid vectors (plasmids 456, 457, 458, and 459) utilized a single full CMV promoter with a rabbit B globulin transcription terminator to drive expression of all three antigens.
  • Plasmids 846 and 850 Two other plasmid vectors (plasmids 846 and 850) incorporated a dual promoter strategy in combination with either an IRES or 2A to drive expression of the three antigens. Plasmids with multiple 2A cassettes were engineered to carry different cassettes to minimize the likelihood of recombination between the first and second cassette during plasmid/vector amplification. Antigen expression was demonstrated by flow cytometry (FIGS. 7A and 7B) and western blotting (FIGS. 8A and 8B). Plasmid 456 (PSA-F2A-PSMA-mlRES-PSCA). Plasmid 456 was constructed by restriction fragment exchange. Plasmid 5300 was digested with Nhe I and Hpa I and the ⁇ 1 .8 kb insert was ligated into similarly digested plasmid 449.
  • Plasmid 457 (PSA-F2A-PSMA-T2A-PSCA). Plasmid 457 was constructed by restriction fragment exchange. Plasmid 5300 was digested with Nhe I and Hpa I and the ⁇ 1 .8 kb insert was ligated into similarly digested plasmid 451 .
  • Plasmid 458 (PSA-T2A-PSCA-F2A-PSMA). Plasmid 458 was constructed using the techniques of PCR and restriction fragment exchange. The gene encoding human PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers 1 19 and 139, resulting in the addition of a T2A sequence and Nhe I restriction site at the 3' end. The amplicon was digested with Nhe I and inserted into similarly digested plasmid 454.
  • Plasmid 459 (PSCA-F2A-PSMA-mlRES-PSA). Plasmid 459 was constructed by restriction fragment exchange. Plasmid 454 was digested with Nhe I and Bgl II and the PSCA-F2A-PSMA containing insert was ligated into similarly digested plasmid 455.
  • Plasmid 846 (CBA-PSA, CMV-PSCA-plRES-PSMA). Plasmid 846 was constructed using the techniques of PCR and seamless cloning. First, an expression cassette was synthesized that consisted of 1 ) the promoter and 5' untranslated region from the chicken beta actin (CBA) gene, 2) a hybrid chicken beta actin / rabbit beta globin intron, 3) the gene encoding human PSA amino acids 25-261 , and 4) the bovine growth hormone terminator. This PSA expression cassette was amplified by PCR from plasmid 796 with primers 3SallCBA and 5SallBGH.
  • the amplicon was cloned into the Sail site of plasmid 603 using a GeneArt Seamless Cloning and Assembly Kit (Invitrogen, Carlsbad, CA). Upon delivery of this plasmid into a cell, PSA expression will be driven off the CBA promoter while PSCA and PSMA expression will be driven off the CMV promoter.
  • Plasmid 850 (CBA-PSA, CMV-PSCA-F2A-PSMA). Plasmid 850 was constructed using the techniques of PCR and seamless cloning. First, the CBA promoter-driven PSA expression cassette was amplified by PCR from plasmid 796 with primers 3SallCBA and 5SallBGH. The amplicon was cloned into the Sail site of plasmid 454 using GeneArt Seamless Cloning. Upon delivery of this plasmid into a cell, PSA expression will be driven off the CBA promoter while PSCA and PSMA expression will be driven off the CMV promoter. Plasmid 916 ( (PSA - T2A-PSCA-F2A -PSMA ).
  • Plasmid 916 was constructed using the techniques of PCR and Gibson cloning. The genes encoding the three PAA polypeptides were amplified by PCR and ligated into the Nhe I / Bgl II sites of pPJV7563 by Gibson cloning techniques. The complete nucleotide sequence of Plasmid 916 is set forth in SEQ ID NO:62. Plasmid 458 and Plasmid 916 encode the same amino acid sequence that comprises the three immunogenic PAA polypeptides, which amino acid sequence is set forth in SEQ ID NO:60. The nucleotide sequence in Plasmid 916 that encodes the amino acid sequence comprising the three PAA polypeptides is codon- optimized and is also set forth in SEQ ID NO:61 .
  • EXAMPLE 3C TRIPLE ANTIGEN ADENOVIRUS VECTORS General Strategy.
  • viral vectors can be engineered to deliver multiple prostate cancer antigens.
  • the three multi-antigen expression strategies described above for multi-antigen constructs - dual promoters, 2A peptides, and internal ribosome entry sites - were incorporated in various combinations to create triple antigen adenovirus vectors. Briefly, the multi-antigen expression cassettes were cloned into a pShuttle-CMV plasmid modified to carry two copies of the tetracycline operator sequence (TetO2).
  • Recombinant adenovirus serotype 5 vectors were created using the AdEasy Vector System according to manufacturer's protocols (Agilent Technologies, Inc., Santa Clara, CA). Viruses were amplified in HEK293 cells and purified by double cesium chloride banding according to standard protocols. Prior to in vivo studies, viral stocks were thoroughly characterized for viral particle concentration, infectivity titer, sterility, endotoxin, genomic and transgene integrity, transgene identity and expression.
  • Ad-733 is the viral equivalent of plasmid 457. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include two different 2A sequences.
  • Ad-734 is the viral equivalent of plasmid 458. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include two different 2A sequences.
  • Ad-735 is the viral equivalent of plasmid 459. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include a 2A sequence and an IRES.
  • Ad-796 is the viral equivalent of plasmid 846. Expression of PSA is driven off the chicken beta actin promoter while PSCA and PSMA expression is driven off the CMV-TetO2 promoter. Multi-antigen expression strategies include two promoters and an IRES.
  • Ad-809 is the viral equivalent of plasmid 850.
  • Expression of PSA is driven off the chicken beta actin promoter while PSCA and PSMA expression is driven off the CMV-TetO2 promoter.
  • Multi-antigen expression strategies include two promoters and a 2A sequence.
  • mice per each group were daily orally dosed with either vehicle or sunitinib malate at 20 mg/kg starting at day 10 post tumor implant until day 64.
  • Vaccination with DNA constructs that either encode no antigen (control vaccine) or a rat Her-2 antigen of SEQ Id NO: 54 (cancer vaccine) as adenovirus vectors initiated on day 13 subsequently followed by two weekly immunizations, two biweekly immunizations, and seven weekly immunizations of respective antigens (HBV antigens or rHer-2) by DNA.
  • mice (closed circle and open triangle) that were treated with anti-murine CTLA-4 monoclonal antibody were intraperitoneal ⁇ injected with 250 ⁇ g of the antibody on day 20, 27, 41 , 55, 62, 69, 76, 83, 90, and 97 right after the PMED injections.
  • Figure 4 shows the Kaplan-Meier survival curve of the groups of mice from a representative study evaluating the anti-tumor efficacy of sunitinib and anti- murine CTLA-4 monoclonal antibody (clone 9D9) in combination with a cancer vaccine. Increased survival time was observed in mice treated with Sutent with control vaccine (open circle), anti-murine CTLA-4 monoclonal antibody (open triangle) or cancer vaccine (closed triangle). A further increase of survival was observed in mice treated with Sutent and cancer vaccine in combination with anti-murine CTLA-4 (closed circle). P values were calculated by log-rank test.
  • the immune modulators CpG7909 (PF-03512676) and anti-CD40 monoclonal agonistic antibody, were administered locally by intradermal injections in proximity to the vaccine draining inguinal lymph node subsequently after the PMED actuations.
  • Antigen specific T cell responses were measured by IFNy ELISPOT or intracellular cytokine staining assay according to the procedure described below.
  • the rHer-2 specific polyfunctional (multi-cytokine positive) T cell immune responses were measured from splenocytes or PBMCs isolated from individual animals by ICS assay. Typically 1 e6 splenocytes were incubated with Brefeldin A at 1 ⁇ g/ml and peptide stimulant (rHer-2 specific CD8 p66, rHer-2 specific CD4 p169 or irrelevant HBV p87) at 10 ⁇ g/ml for 5hr at 37°C in a 5% CO 2 incubator. After the stimulation, the splenocytes were washed and blocked with FcD block (anti-mouse CD16/CD32) for 10 min.
  • FcD block anti-mouse CD16/CD32
  • the total number of antigen specific single, double or triple cytokine positive T cells per total spleen of each animal is calculated by subtracting the rHer-2 specific responses to the irrelevant peptide HBV from the vaccine specific responses and normalized to the total number of splenocytes isolated from the spleen.
  • Figure 5 shows the IFNy ELISPOT results from groups of mice from a representative study evaluating the magnitude of antigen specific T cell responses induced by the rHER2 vaccine when given with the immune modulators as indicated.
  • the antigen specific immune responses were measured by IFNy ELISPOT assay from 5e5 splenocytes mixed with control or rHer-2 specific p66 peptides at 1 0 ⁇ g/ml concentration, 7 days after the PMED actuation.
  • the number of total IFNy secreting cells from splenocytes containing1 e5 CD8 T cells was calculated from the ELISPOT results from individual animals and the % of CD8 T cells in splenocytes and mean and standard error of mean of each group are plotted.
  • both CpG7909 and the anti-CD40 monoclonal antibody significantly enhanced the magnitude of antigen specific immune responses induced by rHer-2 DNA compared to mice that received control antibodies.
  • PBS PMED group
  • 50Dg of CpG 7909 PMED+CpG group
  • an ICS assay was performed on the splenocytes isolated from each individual mice to detect antigen specific polyfunctional CD8 or CD4 T cells that secrete IFNy, TNFD and/ or IL-2.
  • a significant increase in rHer-2 specific multi-cytokine positive CD8 and CD4 T cell responses were detected from mice treated with the local delivery of CpG 7909 compared to PBS.
  • An increase in the single cytokine positive CD8 population was observed in the animals that received local delivery of CpG7909 administration compared to PBS.
  • FIGS 8 and 9 show the results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-CD40 monoclonal antibody on the quality of the vaccine induced immune responses by intracellular cytokine staining assay. Briefly, each animal was immunized twice by DNA plasmid expression constructs encoding rHER2 antigen sequences (SEQ ID NO:54) delivered by PMED with a 4week interval.
  • mice in each group were given 100 Dg of intradermal injections of either isotype IgG control (PMED with IgG) or anti-CD40 monoclonal antibody (PMED with aCD40) in proximity to the right side vaccine draining inguinal node, one day after the first immunization was administered by PMED. Seven days after the last PMED, an ICS assay was performed on the splenocytes isolated from each individual mice to detect rHer-2 specific polyfunctional CD8 or CD4 T cells that secrete IFND , TNFD and/ or IL-2.
  • Anti-tumor efficacy of anti-cancer vaccine in combination with low dose sunitinib was investigated in BALB/neuT mice with spontaneous mammary pad tumors.
  • EXAMPLE 7 ENHANCEMENT OF VACCINE-INDUCED IMMUNE RESPONSES BY LOCAL ADMINISTRATION OF CPG
  • the immune enhancement of local administration of CpG (PF-03512676) on the immune responses induced by a human PSMA nucleic acid provided by the invention was investigated in a monkey study, in which the immune response was assessed by measuring PSMA specific T cell responses using an IFNy ELISPOT assay.
  • Animal Treatment and Sample Collection Six groups of Chinese cynomolgus macaques, six (#1 to 6) per each test group, were immunized with a plasmid DNA encoding the human PSMA modified antigen (the polypeptide of SEQ ID NO:9) delivered by electroporation. Briefly, all animals received bilateral intramuscular injections of 5 mg of plasmid DNA followed by electroporation (DNA EP) on day 0.
  • DNA EP electroporation
  • group 2 received bilateral intramuscular injections of 2 mg of CpG mixed with 1 mg Alum in proximity to the DNA injection sites.
  • Groups 3 and 4 received bilateral intramuscular injections of 2 mg of CpG delivered without alum in proximity to the DNA injection sites either on day 0 or day 3, respectively.
  • Group 5 received 2 mg of bilateral intradermal injections of CpG delivered in proximity to the vaccine draining inguinal nodes on day 3.
  • Group 6 received bilateral injections of 200 Dg of CpG mixed with the DNA solution which was co-electroporated into the muscle on day 0.
  • IFNy ELISPOT Assay Procedure Peripheral blood samples were collected from each animal fifteen days after the DNA immunization. Peripheral blood mononuclear cells (PBMCs) were isolated from the blood samples and were subjected to an IFNy ELISPOT assay to measure the PSMA specific T cell responses. Briefly, 4e5 PBMCs from individual animals were plated per well with pools of PSMA specific peptides or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFNy ELISPOT plates. The composition of each of the PSMA specific peptide pool is provided in Table 24A.
  • the plates were incubated for 16 hrs at 37°C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction.
  • the number of IFNy spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates.
  • Table 6 shows the result of a representative IFNy ELISPOT assay that evaluates and compares the IFNy T cell responses induced by the vaccine without (group 1 ) or with CpG (PF-03512676) given locally by intramuscular (groups 2, 3, 4, and 5) or intradermal injections (group 6).
  • the reported PSMA specific response was calculated by subtracting the average number of the SFC to the nonspecific control peptides (human HER2 peptide pool) from the average number of SFC to the PSMA peptide pools and normalized to the SFC observed with 1 e6 PBMCs. ⁇ indicates that the count is not accurate because the numbers of spots were too numerous to count. ND indicates not determined.
  • the PSMA specific IFNy T cell responses were detected to multiple PSMA specific peptide pools in the absence of CpG (PF-03512676) in all six animals (group 1 ).
  • the total responses to the PSMA peptides measured were modestly higher in a few animals that additionally received CpG (PF-03512676) either by intramuscular (group 4: 3/6) or intradermal (group 5: 2/6) injections 3 days after DNA electroporation.
  • group 4 3/6
  • intradermal group 5: 2/6
  • PSMA specific IFNy T cell responses induced by the DNA vaccine without (Group 1 ) or with CpG (Groups 2, 3, 4, 5 and 6) is measured by IFNy ELISPOT assay from PBMCs, 15 days after DNA electroporation
  • RESPONSES BY LOCAL ADMINISTRATION OF ANTI-CTLA-4 ANTIBODY The effect of low dose subcutaneous administration of anti-CTLA-4 monoclonal antibody (CP-675, 206) on the immune responses induced by a rhesus PSMA nucleic acid was investigated in a monkey study, in which the immune response was assessed by measuring PSMA specific T cell responses using an IFNy ELISPOT assay.
  • the rhesus PSMA nucleic acid used in the study has the sequence as set forth in SEQ ID NO: 56) and encodes an immunogenic PSMA polypeptide of SEQ ID NO: 55.
  • peripheral blood mononuclear cells were isolated from each animal and were subjected to an IFNy ELISPOT assay to measure the rhesus PSMA specific T cell responses.
  • PBMCs peripheral blood mononuclear cells
  • IFNy ELISPOT assay to measure the rhesus PSMA specific T cell responses.
  • 4e5 PBMCs from individual animals were plated per well with pools of rhesus PSMA specific peptides (P1 , P2, P3 or R1 +R2 defined in Table 24A) or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFN ⁇ ELISPOT plates. The plates were incubated for 16 hrs at 37 °C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction.
  • the number of IFN/ spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates. The average of the duplicates from the background adjusted SFC of the rhesus PSMA specific peptide pools was normalized to the response in 1 e6 PBMCs. The individual and sum responses to the peptide pools from each individual animal are presented in Table 29.
  • IFNy ELISPOT Assay Procedure A capture antibody specific to IFNy (D BD Bioscience, #51 -2525kc) is coated onto a polyvinylidene fluoride (PVDF) membrane in a microplate overnight at 4°C. The plate is blocked with serum/protein to prevent nonspecific binding to the antibody. After blocking, effector cells (such as splenocytes isolated from immunized mice or PBMCs isolated from rhesus macaques) and targets (such as PSMA peptides from peptide library, target cells pulsed with antigen specific peptides or tumor cells expressing the relevant antigens) are added to the wells and incubated overnight at 37°C in a 5% CO 2 incubator.
  • effector cells such as splenocytes isolated from immunized mice or PBMCs isolated from rhesus macaques
  • targets such as PSMA peptides from peptide library, target cells pulsed with antigen specific peptides or tumor cells expressing the relevant
  • Cytokine secreted by effector cells are captured by the coating antibody on the surface of the PVDF membrane. After removing the cells and culture media, 100 ⁇ of a biotinylated polyclonal anti- humanlFNy antibody was added to each of the wells for detection. The spots are visualized by adding streptavidin-horseradish peroxidase and the precipitate substrate, 3-amino-9-ethylcarbazole (AEC), to yield a red color spot as per manufacturer's (Mabtech) protocol. Each spot represents a single cytokine producing T cell.
  • AEC 3-amino-9-ethylcarbazole
  • Table 7 shows the results of a representative IFNy ELISPOT assay that compares the T cell responses induced by the vaccine without (group 1 ) or with (groups 2-4) anti-CTLA-4 monoclonal antibody (CP-675, 206) given locally by subcutaneous injections in proximity to the vaccine draining lymph node.
  • MDSC Myeloid Derived Suppressor Cells
  • TUBO cells (1 x10 6 ) were implanted into the flanks of 5 BALB/neuT mice, and left for approx. 20-30 days until tumor volume reached between 1000-1500mm 3 . Mice were then sacrificed, spleens removed and the MDSC enriched splenocytes recovered. Splenocytes were labeled for 10 minutes with 5 ⁇ CFSE, washed with PBS and counted. Labeled cells were subsequently resuspended at 5x10 7 splenocytes/ml in PBS solution and adoptively transferred via an i.v. tail vein injection into na ' ive BALB/c recipient mice.
  • the recipient mice began bi-daily dosing with vehicle or sunitinib malate (Sutent) at 5 mg/kg, 10 mg/kg and 20 mg/kg.
  • Sutent vehicle or sunitinib malate
  • recipient mice continued to receive bi-daily dosing of Vehicle or sunitinib for two further days, after which point the mice were sacrificed, spleens removed, splenocytes recovered and processed for phenotypic analysis.
  • Splenocytes were counted and resuspended at 5x10 6 cells/ml in FACS staining buffer (PBS, 0.2% (w/v) bovine serum albumin, and 0.02% (w/v) Sodium Azide).
  • FACS staining buffer PBS, 0.2% (w/v) bovine serum albumin, and 0.02% (w/v) Sodium Azide.
  • 2.5x10 6 cells were first incubated with anti-bodies to CD16/CD32, 10 minutes at 4 Q C, to block Fc receptors and minimize non-specific binding. Splenocytes were then stained for 20 minutes at 4 Q C with appropriate fluorophore conjugated antibodies (Biolegend) to murine cell surface markers.
  • T cells For T cells (anti-CD3 (Pacific Blue), clone 17A2) and for MDSC (anti-GR-1 (APC), clone RB6- 8C5 and anti-CD1 1 b (PerCp Cy5.5), clone M1 /70).
  • a live/dead stain was also included. Following antibody incubation, stained splenocytes were washed with 2mls of FACS buffer, pelleted by centrifugation and resuspended in 0.2ml of FACS buffer prior to data acquisition on a BD CANTO II flow cytometer.
  • Statistical significance was determined by one-way ANOVA using the Dunnett's multiple comparison test, comparing the Sunitinib dosed groups against the Omg/kg (vehicle) group.
  • triple antigen vaccine constructs (either in the form of adenovirus vector or DNA plasmid) expressing three antigens PSMA, PSCA and PSA provided by the invention to elicit specific T cell responses to all three encoded antigens in nonhuman primates.
  • T cell immunogenicity of five adenovirus vectors each expressing three antigens (PSMA, PSCA and PSA; Ad-733, Ad-734, Ad-735, Ad- 796 and Ad-809) provided by the invention were compared to the mix of three adenovirus vectors each only expressing a single antigen (PSMA, PSA or PSCA), 9 days post prime.
  • PBMCs peripheral blood mononuclear cells
  • the monkeys received DNA (Group 1 : PSMA, plasmid 5166; Group 2: PSA, plasmid 5297; Group 3: PSCA, plasmid 5259; Group 4: mix of PSMA, PSA and PSCA, plasmids 5166, 5259 and 5297; Group 4: plasmid 457; Group 6: plasmid 458; Group 7: plasmid 459; Group 8: plasmid 796 and Group 9: plasmid 809) boost vaccinations delivered by electroporation.
  • each animal received a total 5mg of plasmid DNA provided by the invention which delivers the same expression cassette encoded in the adenovirus used in the prime.
  • PBMCs peripheral blood mononuclear cells
  • IFNy ELISPOT assay 4e5 PBMCs from individual animals were plated per well with PSMA specific peptide pools P1 , P2, P3 or H1 and H2 (Table 9A), PSA specific pool 1 or 2 (Table 9B), PSCA specific pool (Table 10) or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFNy ELISPOT plates. The plates were incubated for 16 hrs at 37 °C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction. The number of IFNy spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates.
  • PSMA specific peptide pools P1 , P2, P3 or H1 and H2
  • Table 9B PSA specific pool 1 or 2
  • PSCA specific pool Table 10
  • nonspecific control peptides human HER2 peptide pool
  • the average of the duplicates from the background adjusted SFC of the antigen specific peptide pools was normalized to the response in 1 e6 PBMCs.
  • the antigen specific responses in the tables present the sum of the responses to the corresponding antigen specific peptides or peptide pools.
  • Table 1 1 represents a study that evaluates the T cell immunogenicity of five different adenoviruses each expressing all three antigens in comparison to the mixture of three adenoviruses each expressing a single antigen in Indian rhesus macaques by IFNy ELISPOT.
  • the majority of animals that only received Ad-PSMA (group 1 ) injections induced specific responses to PSMA but not to PSA or PSCA (Student's T-test, P ⁇ 0.03.
  • the animals that only received injections of Ad-PSA (group 2) induced specific responses to PSA but not to PSMA or PSCA (Student's T-test, P ⁇ 0.02).
  • Table 12 shows the IFNy ELISPOT results represents a study that evaluates the immunogenicity of the five different triple antigen expression cassettes provided in the invention delivered by an adenovirus prime in combination with anti-CTLA-4 followed by an electroporation boost of the corresponding plasmid DNA.
  • the immune responses are compared to the mix of three constructs expressing a single antigen delivered similarly by an adenovirus prime with anti-CTLA-4 and DNA electroporation boost immunizations.
  • PSA peptide pools the amino acid position and sequence of fifteen amino acid peptides overlapping by thirteen amino acids from PSA peptide library is shown.
  • PSA peptide pool 1 PSA peptide pool 2 amino acid no.
  • PSA peptide sequence amino acid no.
  • PSCA peptide pool The amino acid position and sequence of fifteen amino acid peptides overlapping by thirteen amino acids from PSCA peptide library is shown.
  • Table 1 1 IFNy T cell responses induced by the single antigen (Group 1 : Ad-PSMA; Group 2: Ad-PSA; Group 3: Ad-PSCA; Group 4: mix of Ad-PSMA, Ad-PSA and Ad- PSCA) or triple antigen expressing adenovirus vectors (Group 4: Ad-733; Group 6: Ad- 734; Group 7: Ad-735; Group 8: Ad-796 and Group 9: Ad-809) after adenovirus prime with anti-CTLA-4 analyzed by ELISPOT assay.
  • IFNy T cell responses induced by the single antigen (Group 1 : PSMA; Group 2: PSA; Group 3: PSCA; Group 4: mix of PSMA, PSA and PSCA) or triple antigen expressing vectors (Groups 5 - 9) after adenovirus prime with anti-CTLA-4 and DNA electroporation boost immunizations analyzed by ELISPOT assay.
  • EXAMPLE 1 1 . CONSTRUCTION OF C68 VECTORS 1 1 A. Vector AdC68-734 Construciton
  • AdC68-734 is a replication incompetent adenovirus vector based upon the chimpanzee adenovirus C68 that encodes three immunogenic PAA polypeptides - an immunogenic PSA polypeptide, immunogenic PSCA polypeptide, and immunogenic PSMA polypeptide.
  • the vector sequence was designed in silico. First, the baseline full length C68 sequence was obtained from Genbank (Definition: Simian adenovirus 25, complete genome; accession number AC_00001 1 .1 ). Five point mutations described in the literature were introduced into the sequence. (Roshorm, Y., M. G. Cottingham, et al. (2012).
  • the expression cassette included the following components: (A) Cytomegalovirus (CMV) immediate early enhancer/promoter, (B) Tet operator (binding site for the tetracycline repressor), (C) the multi-antigen construct comprising (1 ) nucleotide sequence encoding amino acids 25 through 261 of the human PSA, (2) Cis acting hydrolase element encoding a glycine- serine linker and Thosea asigna virus 2A peptide (T2A), (3) nucleotide sequence encoding amino acids 2 through 123 of the human PSCA, ( 4) Cis acting hydrolase element encoding a glycine-serine linker and Foot and Mouth Disease Virus 2A peptide (F2A), and (5) nucleotide sequence encoding amino acids 15 through 750 the human PSMA, and (D) SV40 polyA transcription termination signal.
  • CMV Cytomegalovirus
  • Tet operator binding site for the tetracycline re
  • Pad restriction sites were inserted at each end of the viral genome to facilitate the release of the genome from the parent Bacmid. Nucleotides from the Pad restriction sites are removed during viral propagation and, therefore, are not incorporated into the genome of the vector product itself.
  • a nucleotid sequence of the entire vector AdC68-734, including the Pad restriction sites, is set forth in SEQ ID NO:58.
  • the multi-antigen construct (PSA-T2A-PSCA-F2A-PSMA) incorporated in vector AdC68-734 (as well as in Plasmid 458) is also set forth in SEQ ID NO:61 .
  • the amino acid sequence encoded by the multi-agtigen construct of SEQ ID NO:61 is set forth in SEq ID NO:60.
  • the components of vector AdC68-734 are provided in Table 13.
  • the 34,819 base-pair sequence was biochemically synthesized in a multi-stage process utilizing in vitro oligo synthesis and subsequent recombination-mediated intermediate assembly in E. coli and yeast.
  • the viral genome was ultimately inserted into a bacterial artificial chromosome (pCC1 BAC-LCyeast-TRP Trunc) for propagation.
  • Next generation sequencing (MiSeq technology) was performed at multiple steps in the production process, including the final Bacmid 17.3.3.22 lot that was used to create the viral seed stock.
  • Viral seed stock was generated by digesting Bacmid 17.3.3.22 with Pad to release the AdC68-734 genome from the BAC backbone.
  • the linearized nucleic acid was transfected into an E1 complimenting adherent HEK293 cell line and upon visible cytopathic effects and adenovirus foci formation, cultures were harvested by multiple rounds of freezing/thawing to release virus from the cells. Viruses were amplified and purified by standard techniques. The genetic organization of Bacmid 17.3.3.22 is provided in Figure 1 1 .
  • Additional triple antigen C68 vectors were constructed in a similar fashion to AdC68-734. Some of the additional vectors involve functional deletions in the C68 genome that are slightly different from those in Vector AdC68-734, while others incorporate different multi-antigen constructs. Based on these examples and other description of the presentdisclosure, a person skilled in the art would be able construct additional vectors from C68 for expressing vrious multi-antigen constructs, all of which are within the scope of the present invention.
  • Vector AdC68X-734 was constructed from C68 by functional deletion of the E1 and E3 regions of the C68 genome through deletions of nucleotides 577-3403 (E1 region) and 27125- 31831 (E2 region) of the C68 genome of SEQ ID NO:57 and by insertion of the triple antigen construct (PSA-T2A-PSCA-F2A-PSMA) of SEQ ID NO:61 in the deleted E1 region.
  • Vector AdC68W-734 is identical to Vector vector AdC68-734 except that AdC68W-734 contains one or more mutitions in the C68 NDA sequence.
  • Vectors AdC68X-733 and AdC68X-735 were created by replacing the triple antige-construct incorporated in the AdC68X-734 vector with the triple antigen construct of SEQ ID NOs:65 and 66, respectively.
  • the multi-antigen construct incorporated in vector AdC68X-733 i.e, PSA-F2A-PSMA-T2A-PSCA
  • the multi-antigen construct incorporated in vector AdC68X-735 i.e., PSCA-F2A-PSMA-m I RES-PSA
  • PSCA-F2A-PSMA-m I RES-PSA is the same as that in Plasmid 459.
  • AdC68-734 Various research grade lots of AdC68-734 were produced and tested for productivity. Bacmid was digested with Pad to release the vector genome from the BAC backbone and the linearized nucleic acid was transfected into E1 complimenting adherent HEK293 cell lines. When extensive cytopathic effects and adenovirus foci were visible, cultures were harvested by multiple rounds of freezing/thawing to release virus from the cells. Viruses from these Passage 0 (P0) cultures were amplified at least one additional passage in tissue culture flasks and then used as seed stocks for research scale production runs (-0.5 to 3e13 total viral particles per lot). In total, 1 1 production runs were executed (five in HEK293 suspension cells and six in HEK293 adherent cells). The average specific productivity was 15,000 +/- 6,000 viral particles purified per initial infected cell, with a viral particle:infectious unit ratio of 55. Research scale productivities are summarized in Table 14.
  • a head-to head comparison of the CD8 IFNy responses induced by various triple antigen AdC68 vectors was performed.
  • IFNy CD8+ T cell responses in the mice were measured by collecting the spleens from each animal on day 13 post immunization. Splenocytes were isolated and subjected to an IFNy ELISPOT assay to measure the PSMA, PSCA, and PSA- specific T cell responses.
  • splenocytes from immunized animals were cultured in the presence of individual human PSMA, PSCA, or PSA-specific peptides at 10 ⁇ g/ml.
  • the 15-mer peptides were previously defined to contain CD8+ T cell epitopes to each prostate antigen.
  • Splenocytes cultured with medium alone served as a control. Each condition was performed in triplicate. The plates were incubated for 20h at 37°C and 5% CO 2 , washed, and developed after incubation as per the manufacturer's instructions. The number of IFNy SFC was counted by a CTL reader. The results show the average number of PSMA, PSCA, and PSA-specific SFCs with the medium alone background values subtracted, and normalized to 1 x10 6 splenocytes.
  • AdC68 vectors induced immune responses to all three antigens but to different magnitude.
  • the response to PSMA by the AdC68 vectors was similar to Ad5.
  • the response to PSCA by the three AdC68 vectors was similar or lower than the response induced by Ad5 while the response to PSA was lower with Ad68-735 compared to all of the vectors tested.
  • AdC68-809 induced similar or better responses to all three antigens compared to AdC68-734, AdC68-735 or Ad5. Resutls are presented in Table 15.
  • NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 2 OF SEQ ID NO:5
  • NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF THE MEMBRANE-BOUND PSA ANTIGEN OF SEQ ID NO:19
  • NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF THE FULL LENGTH HUMAN PSCA OF SEQ ID NO: 21
  • NUCLEOTIDE SEQUENCE OF PLASMID 5166
  • NUCLEOTIDE SEQUENCE OF PLASMID 5259
  • NUCLEOTIDE SEQUENCE OF PLASMID 5297
  • NUCLEOTIDE SEQUENCE OF PLASMID 460
  • NUCLEOTIDE SEQUENCE OF PLASMID 451
  • NUCLEOTIDE SEQUENCE OF PLASMID 454
  • NUCLEOTIDE SEQUENCE OF PLASMID 5300
  • NUCLEOTIDE SEQUENCE OF PLASMID 449
  • NUCLEOTIDE SEQUENCE OF PLASMID 603
  • NUCLEOTIDE SEQUENCE OF PLASMID 455
  • NUCLEOTIDE SEQUENCE OF PLASMID 456
  • NUCLEOTIDE SEQUENCE OF PLASMID 457
  • NUCLEOTIDE SEQUENCE OF PLASMID 458
  • NUCLEOTIDE SEQUENCE OF PLASMID 459
  • SEQ ID NO:39 Nucleic acid sequence encoding the Her-2 antigen amino acid sequence of SEQ ID NO: 38
  • SEQ ID NO:40 Amino acid sequence of heavy chain of the anti-CD40 antibody CP870,893:
  • SEQ ID NO:42 Acid sequence of the heavy chain of the anti-CTLA-4 antibody Tremelimumab
  • SEQ ID NO:48 Amino acid sequence of HBV core antigen SEQ ID NO:49. Amino acid sequence of HBV surface antigen
  • SEQ ID NO:51 Amino acid sequence of rat Her-2 p66 peptide (H-2d T cell epitope)
  • SEQ ID NO:52 Amino acid sequence of rat Her-2 p169 peptide (H-2d T cell epitope)
  • SEQ ID NO:57 Complete Genome of Simian Adenovirus 25 (C68)
  • SEQ ID NO: 60 Amino Acid Sequence Comprising an Immunogenic PSA, PSCA, and PSMA Polypeptide (Encoded by by Plasmid 916 and Vectors AdC68- 734 and AdC68W-734)
  • SEQ ID N0:61 Nucleotide Sequence Encoding the Amino Acid Sequence of SEQ ID NO:60.
  • SEQ ID NO:65 Nucleotide Sequence Encoding the Amino Acid Sequence of SEQ ID NO:64
  • SEQ ID NO:66 Nucleotide Sequence of the Multi-antigen Construct (PSCA- F2A-PSMA-mlRES-PSA) Incorporated in Plasmid 459 and Vector AdC68X-735

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Microbiology (AREA)
  • Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Endocrinology (AREA)
  • Virology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present disclosure provides (a) vectors comprising a multi-antigen construct encoding two, three, or more immunogenic PAA polypeptides; (b) compositions comprising the vectors, (c) methods relating to uses of the vectors and compositions for eliciting an immune response or for treating prostate cancers.

Description

VECTORS FOR EXPRESSION OF PROSTATE-ASSOCIATED ANTIGENS
REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Application No. 61/898,966 filed November 1 , 2013, which is incorporated herein by reference in its entirety.
REFERENCE TO SEQUENCE LISTING
This application is being filed along with a sequence listing in electronic format. The sequence listing is provided as a file in .txt format entitled "PC72055A_FF_SEQ_LISTING_ST25.txt", created on October 6, 2014 and having a size of 429 KB. The sequence listing contained in the .txt file is part of the specification and is herein incorporated by reference in its entirety.
FIELD OF THE INVENTION
The present invention relates generally to immunotherapy and specifically to vaccines and methods for treating or preventing neoplastic disorders.
BACKGROUND OF THE INVENTION
Prostate cancer is the second most commonly diagnosed cancer and the fourth leading cause of cancer-related death in men in the developed countries worldwide. Various prostate-associated antigens (PAA), such as prostate-specific antigen (PSA), prostate-specific membrane antigen (PSMA), and prostate stem cell antigen (PSCA) have been shown to be overexpressed by prostate cancer cells as compared to normal counterparts. These antigens, therefore, represent possible targets for inducing specific immune responses against cancers expressing the antigens via the use of vaccine- based immunotherapy. (See e.g. Marrari, A., M. lero, et al. (2007). "Vaccination therapy in prostate cancer." Cancer Immunol Immunother 56(4): 429-45)
PSCA is a 123-amino acid membrane protein. The native full length human PSCA consists of amino acids 1 and 4-125 of SEQ ID NO:21 (wihtout the alanine and serine residues at the second and third position respectively). PSCA has high tissue specificity and is expressed on more than 85% of prostate cancer specimens, with expression levels increasing with higher Gleason scores and androgen independence. It is expressed in 80-100% of bone metastasis of prostate cancer patients.
PSA is a kallikrein-like serine protease that is produced exclusively by the columnar epithelial cells lining the acini and ducts of the prostate gland. PSA imRNA is translated as an inactive 261 -amino acid preproPSA precursor. PreproPSA has 24 additional residues that constitute the pre-region (the signal polypeptide) and the propolypeptide. Release of the propolypeptide results in the 237- amino acid, mature extracellular form, which is enzymatically active. The full length sequence of the native human PSA consists of amino acids 4-263 of SEQ ID NO: 15. PSA is organ-specific and, as a result, it is produced by the epithelial cells of benign prostatic hyperplastic (BPH) tissue, primary prostate cancer tissue, and metastatic prostate cancer tissue.
PSMA, also known as Folate hydrolase 1 (FOLH1 ), is composed of 750 amino acids. The amino acid sequence of the full length human PSMA is provided in SEQ ID NO:1 . PSMA includes a cytoplasmic domain (amino acids 1 -19), a transmembrane domain (amino acids 20-43), and an extracellular domain (amino acids 44-750). PSMA was found to be expressed in prostate cancer cells it at 1000-fold higher levels than normal tissues. It is abundantly expressed on neovasculature of a variety of other solid tumors such as colon, breast, liver, bladder, pancreas, lung, renal cancers as well as melanoma and sarcomas. Thus, PSMA is considered a target not only specific for prostate cancer cells but also a pan-carcinoma target for other cancers.
While a large number of tumor-associated antigens have been identified and many of these antigens have been explored as protein-based or DNA-based vaccines for the treatment or prevention of cancers, most clinical trials so far have failed to produce a therapeutic product. One of the challenges in developing cancer vaccines resides in the fact that the cancer antigens are usually self-derived and, therefore, poorly immunogenic because the immune system is self-regulated not to recognize self- proteins. Accordingly, a need exists for a method to enhance the immunogenicity or therapeutic effect of cancer vaccines.
Numerous approaches have been explored for enhancing the immunogenicity or enhancing anti-tumor efficacy of cancer vaccines. One of such approach involves the use of various immune modulators, such as TLR agonists, TNFR agonists, CTLA-4 inhibitors, and protein kinase inhibitors.
Toll-like receptors (TLRs) are type 1 membrane receptors that are expressed on hematopoietic and non-hematopoietic cells. At least 1 1 members have been identified in the TLR family. These receptors are characterized by their capacity to recognize pathogen-associated molecular patterns (PAMP) expressed by pathogenic organisms. These receptors in the innate immune systems exert control over the polarity of the ensuing acquired immune response. Among the TLRs, TLR9 has been extensively investigated for its functions in immune responses. Stimulation of the TLR9 receptor directs antigen-presenting cells (APCs) towards priming potent, ΊΉ1 -dominated T-cell responses, by increasing the production of pro-inflammatory cytokines and the presentation of co-stimulatory molecules to T cells. CpG oligonucleotides, ligands for TLR9, were found to be a class of potent immunostimulatory factors. CpG therapy has been tested against a wide variety of tumor models in mice, and has consistently been shown to promote tumor inhibition or regression.
Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4) is a member of the immunoglobulin superfamily and is expressed on the surface of Helper T cells. CTLA-4 is a negative regulator of CD28 dependent T cell activation, and acts as an inhibitory checkpoint for the adaptive immune response. Similar to the T-cell costimulatory protein CD28, CTLA- 4 binds to CD80 and CD86 on antigen-presenting cells. CTLA-4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Human antibodies against human CTLA-4 have been described as immunostimulation modulators in a number of disease conditions, such as treating or preventing viral and bacterial infection and for treating cancer (WO 01 /14424 and WO 00/37504). Various preclinical studies have shown that CTLA-4 blockade by monoclonal antibodies enhances the host immune response against immunogenic tumors, and can even reject established tumors. Two fully human anti-human CTLA-4 monoclonal antibodies (imAbs), ipilimumab (MDX- 010) and Tremelimumab (also known as CP-675206), have been investigated in clinical trials in the treatment of various types of solid tumors.
The tumor necrosis factor (TNF) superfamily is a group of cytokines that engage specific cognate cell surface receptors, the TNF receptor (TNFR) superfamily. Members of the tumor necrosis factor superfamily act through ligand-mediated trimerization, causing recruitment of several intracellular adaptors to activate multiple signal transduction pathways, such as apoptosis, NF-kB pathway, JNK pathway, as well as immune and inflammatory responses. Examples of the TNF superfamily include CD40 ligands, OX40 ligands, 4-1 BB ligands, CD27, CD30 ligand (CD153), TNF- alpha, TNF- beta, RANK ligands, LT- alpha, LT- beta, GITR ligands, and LIGHT. The TNFR superfamily includes, for example, CD40, OX40, 4-1 BB, CD70 (CD27 ligand), CD30, TNFR2, RANK, LT- beta R, HVEM, GITR, TROY, and RELT. Among the TNF members, CD40 agonists, including various CD40 agonistic antibodies, such as the fully human agonist CD40 monoclonal antibody CP870893, have been extensively explored for usage in therapies. Protein kinases are a family of enzymes that catalyze the phosphorylation of specific residues in proteins. A number of kinase inhibitors have been investigated in clinical investigation for use in anti-cancer therapies, which includes, for example, MK0457, VX-680, ZD6474, MLN8054, AZD2171 , SNS-032, PTK787/ZK222584, Sorafenib (BAY43-9006), SU5416, SU6668 AMG706, Zactima (ZD6474), MP-412, Dasatinib, CEP-701 , (Lestaurtinib), XL647, XL999, Tykerb, (Lapatinib), MLN518, (formerly known as CT53518), PKC412, ST1571 , AMN107, AEE 788, OSI-930, OSI-817, Sunitinib malate (Sutent; SU1 1248), Vatalanib (PTK787/ZK 222584), SNS-032, SNS- 314 and Axitinib (AG-013736). Gefitinib and Erlotinib are two orally available EGFR- TKIs.
SUMMARY OF THE INVENTION
The present disclosure relates to vectors constructed from chimpanzee adenovirus ChAd68 genomic sequences for expression of two or more immunogenic PAA polypeptides. The vector comprises (1 ) a C68 DNA sequence, (2) a multi-antigen construct for expression of two or more immunogenic PAA polypeptides, and (3) regulatory sequences that control the transcription and translation of the antigen products (i.e., the immunogenic PAA polypeptides). The C68 DNA sequence included in the vector is derived from C68 genomic sequence by functional deletion of one or more viral genes but is sufficient for production of an infectious viral particle. In a particular embodiment, the C68 DNA sequence used in the vector is the entire C68 genome with only functional deletions in the E1 and E3 regions.
The multi-antigen construct carried by the vector comprises nucleotide sequences encoding two or more immunogenic PAA polypeptides selected from immunogenic PSMA polypeptide, immunogenic PSA polypeptide, and immunogenic PSCA polypeptide. In some embodiments, the multi-antigen construct carried by the vector comprises (1 ) a nucleotide sequence encoding at least one immunogenic PSMA polypeptide, (2) a nucleotide sequence encoding at least one immunogenic PSA polypeptide, and (3) a nucleotide sequence encoding at least one immunogenic PSCA polypeptide. The multi-antigen constructs may also include separator sequences that enable expression of separate PAA polypeptides encoded by the construct. Examples of separator sequences include 2A peptide sequences and IRESs. In some embodiments, the vector comprises a multi-antigen construct having one of the following structures: (1 ) PSA-F2A-PSMA-mlRES-PSCA;
(2) PSA-F2A-PSMA-T2A-PSCA;
(3) PSA-T2A-PSCA-F2A-PSMA; and
(4) PSCA-F2A-PSMA-mlRES-PSA.
In some embodiments, the nucleotide sequence encoding the immunogenic PSA polypeptide comprises nucleotides 1 1 15-1825 of SEQ ID NO:58 or comprises nucleotides 1 106-1825 of SEQ ID NO:58, the nucleotide sequence encoding the immunogenic PSCA polypeptide comprises nucleotides 1892-2257 of SEQ ID NO:58 or comprises nucleotides 1886-2257 of SEQ ID NO:58, and the nucleotide sequence encoding the immunogenic PSMA polypeptide comprises nucleotides 2333-4543 of SEQ ID NO:58 or comprises nucleotides 2324-4543 of SEQ ID NO:58. In some specific embodiments, the multi-antigen construct comprises nucleotide sequence selected from the group consisting of SEQ ID NOs:33, 34, 35, and 36. In a particular embodiment, the multi-antigen construct comprises a nucleotide sequence that encodes a polypeptide sequence of SEQ ID NO:60. In another particular embodiment, the multi-antigen construct comprises a nucleotide sequence of SEQ ID NO:61 .
The present disclosure also provides compositions comprising the vectors. In some embodiments, the composition is an immunogenic composition useful for eliciting an immune response against a PAA in a mammal, such as a mouse, dog, monkey, or human. In some embodiments, the composition is a vaccine composition useful for immunization of a mammal, such as a human, for inhibiting abnormal cell proliferation, for providing protection against the development of cancer (used as a prophylactic), or for treatment of disorders (used as a therapeutic) associated with PAA over-expression, such as cancer, particularly prostate cancer.
The present disclosure further relates to methods of using the vectors or compositions for eliciting an immune response against a PAA, or for treating cancers, such as prostate cancers, in a mammal, particularly a human. In some embodiments, the vectors or compositions, including vaccine compositions, are administered to the mammal, particularly human, in combination with one or more immune modulators that enhance the immunogenicity or effect of the vectors or compositions. In some particular embodiments, the method involves co-administration of a vaccine provided by the present invention in combination with at least one immune-suppressive-cell inhibitor and at least one immune-effector-cell enhancer. BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 . Schematic illustration of PJV7563 vector.
FIG. 2. Amino acid alignment of five viral 2A cassettes. The skipped glycine- proline bonds are indicated by asterisks.
FIG. 3. Sequence of the preferred EMCV IRES. The translation initiation site is indicated by the asterisk. The minimal IRES element excludes the underlined first 5 codons of the EMCV L protein.
FIG. 4. Graph showing the Kaplan-Meier survival curves of the groups of mice from a representative study evaluating the effect of sunitinib malate (Sutent) and an anti- murine CTLA-4 monoclonal antibody (clone 9D9) on the anti-tumor efficacy of a cancer vaccine (vaccine) in subcutaneous TUBO tumor bearing BALB/neuT mice.
FIG. 5. Graph depicting the IFND ELISPOT results from a representative study evaluating the effect of CpG7909 and an anti-CD40 antibody (Bioxcell #BE0016-2) on the antigen specific T cell responses induced by a cancer vaccine (rHER2).
FIG. 6. Graphs depicting results of a representative study that evaluates the immunomodulatory activity of CpG7909 on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD8 T cells were measured. (* indicates P<0.05 by Student's T-test).
FIG. 7. Graphs depicting results of a representative study that evaluates the immunomodulatory activity of CpG7909 on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD4 T cells (FIG. 7) were measured. (* indicates P<0.05 by Student's T-test).
FIG. 8. Graphs depicting results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-murine CD40 monoclonal antibody on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD8 T cells were measured, (indicates P<0.05 by Student's T-test)
FIG. 9. Graphs depicting results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-murine CD40 monoclonal antibody on the quality of the immune responses induced by a cancer vaccine (PMED) using intracellular cytokine staining assay, in which cytokine positive CD4 T cells were measured, (indicates P<0.05 by Student's T-test) FIG. 10. Graph showing the Kaplan-Meier survival curves of the groups of mice from a representative study that evaluates the effect of low dose sunitinib malate (Sutent) on the anti-tumor efficacy of a cancer vaccine in spontaneous mammary tumor bearing BALB/neuT mice.
FIG. 1 1 . Graph showing the genomic organization of the AdC68-734 vector.
CMV Enh/pro = human cytomegalovirus immediate early enhancer and promoter;
tet op = tetracycline operator; T2A = Thosea asigna virus 2A; F2A = Foot and Mouth Disease Virus 2A; SV40 pA = Simian Virus 40 polyadenylation signal; LITR = left inverted terminal repeat; RITR = right inverted terminal repeat.
FIG. 12. Dot plots showing expression of PSMA and PSCA on the surface of
A549 cells transduced with triple antigen expressing AdC68 vectors by flow cytometry.
FIG. 13. Western blot from lysates of A549 infected by AdC68 vectors.
DETAILED DESCRIPTION OF THE INVENTION
A. DEFINITIONS
The term "adjuvant" refers to a substance that is capable of enhancing, accelerating, or prolonging an immune response elicited by a vaccine immunogen.
The term "agonist" refers to a substance which promotes (induces, causes, enhances or increases) the activity of another molecule or a receptor. The term agonist encompasses substances which bind receptor (e.g., an antibody, a homolog of a natural ligand from another species) and substances which promote receptor function without binding thereto (e.g., by activating an associated protein).
The term "antagonist" or "inhibitor" refers to a substance that partially or fully blocks, inhibits, or neutralizes a biological activity of another molecule or receptor.
The term "co-administration" refers to administration of two or more agents to the same subject during a treatment period. The two or more agents may be encompassed in a single formulation and thus be administered simultaneously. Alternatively, the two or more agents may be in separate physical formulations and administered separately, either sequentially or simultaneously, to the subject. The term "administered simultaneously" or "simultaneous administration" means that the administration of the first agent and that of a second agent overlap in time with each other, while the term "administered sequentially" or "sequential administration" means that the administration of the first agent and that of a second agent does not overlap in time with each other. The term "cytosolic" means that, after a nucleotide sequence encoding a particular polypeptide is expressed by a host cell, the expressed polypeptide is retained inside the host cell.
The terms "degenerate variant" refers to a nucleotide sequence that has substitutions of bases as compared to a reference nucleotide sequence but, due to degeneracy of the genetic code, encodes the same amino acid sequence as the reference nucleotide sequence.
The term "effective amount" refers to an amount administered to a mammal that is sufficient to cause a desired effect in the mammal.
The term "fragment" of a given polypeptide refers to a polypeptide that is shorter than the given polypeptide and shares 100% identity with the sequence of the given polypeptide.
The term "identical" or percent "identity," in the context of two or more nucleic acid or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence.
The term "immune-effector-cell enhancer" or "IEC enhancer" refers to a substance capable of increasing or enhancing the number, quality, or function of one or more types of immune effector cells of a mammal. Examples of immune effector cells include cytolytic CD8 T cells, CD40 T cells, NK cells, and B cells.
The term "immune modulator" refers to a substance capable of altering (e.g., inhibiting, decreasing, increasing, enhancing or stimulating) the working of any component of the innate, humoral or cellular immune system of a mammal. Thus, the term "immune modulator" encompasses the "immune-effector-cell enhancer" as defined herein and the "immune-suppressive-cell inhibitor" as defined herein, as well as substance that affects other components of the immune system of a mammal.
The term "immune response" refers to any detectable response to a particular substance (such as an antigen or immunogen) by the immune system of a host vertebrate animal, including, but not limited to, innate immune responses (e.g., activation of Toll receptor signaling cascade), cell-mediated immune responses (e.g., responses mediated by T cells, such as antigen-specific T cells, and non-specific cells of the immune system), and humoral immune responses (e.g., responses mediated by B cells, such as generation and secretion of antibodies into the plasma, lymph, and/or tissue fluids). Examples of immune responses include an alteration (e.g., increase) in Toll-like receptor activation, lymphokine (e.g., cytokine (e.g., Th1 , Th2 or Th17 type cytokines) or chemokine) expression or secretion, macrophage activation, dendritic cell activation, T cell (e.g., CD4+ or CD8+ T cell) activation, NK cell activation, B cell activation (e.g., antibody generation and/or secretion), binding of an immunogen (e.g., antigen (e.g., immunogenic polypolypeptide)) to an MHC molecule, induction of a cytotoxic T lymphocyte ("CTL") response, induction of a B cell response (e.g., antibody production), and, expansion (e.g., growth of a population of cells) of cells of the immune system (e.g., T cells and B cells), and increased processing and presentation of antigen by antigen presenting cells. The term "immune response" also encompasses any detectable response to a particular substance (such as an antigen or immunogen) by one or more components of the immune system of a vertebrate animal in vitro.
The term "immunogenic" refers to the ability of a substance to cause, elicit, stimulate, or induce an immune response, or to improve, enhance, increase or prolong a pre-existing immune response, against a particular antigen, whether alone or when linked to a carrier, in the presence or absence of an adjuvant.
The term "immunogenic PSA polypeptide" refers to a polypeptide that is immunogenic against human PSA protein or against cells expressing human PSA protein.
The term "immunogenic PSCA polypeptide" refers to a polypeptide that is immunogenic against human PSCA protein or against cells expressing human PSCA protein.
The term "immunogenic PSMA polypeptide" refers to a polypeptide that is immunogenic against human PSMA protein or against cells expressing human PSMA protein.
The term "immunogenic PAA polypeptide" refers to an "immunogenic PSA polypeptide," an "immunogenic PSCA polypeptide," or an "immunogenic PSMA polypeptide" as defined herein above.
The term "immune-suppressive-cell inhibitor" or "ISC inhibitor" refers to a substance capable of reducing or suppressing the number or function of immune suppressive cells of a mammal. Examples of immune suppressive cells include regulatory T cells ("T regs"), myeloid-derived suppressor cells, and tumor-associated macrophages. The term "intradermal administration," or "administered intradermal^," in the context of administering a substance, such as a therapeutic agent or an immune modulator, to a mammal including a human, refers to the delivery of the substance into the dermis layer of the skin of the mammal. The skin of a mammal is composed of three layers - the epidermis, dermis, and subcutaneous layer. The epidermis is the relatively thin, tough, outer layer of the skin. Most of the cells in the epidermis are keratinocytes. The dermis, the skin's next layer, is a thick layer of fibrous and elastic tissue (made mostly of collagen, elastin, and fibrillin) that gives the skin its flexibility and strength. The dermis contains nerve endings, sweat glands and oil (sebaceous) glands, hair follicles, and blood vessels. The dermis varies in thickness depending on the location of the skin. In humans it is about 0.3 mm on the eyelid and about 3.0 mm on the back. The subcutaneous layer is made up of fat and connective tissue that houses larger blood vessels and nerves. The thickness of this layer varies throughout the body and from person to person. The term "intradermal administration" refers to delivery of a substance to the inside of the dermis layer. In contrast, "subcutaneous administration'" refers to the administration of a substance into the subcutaneous layer and "topical administration" refers to the administration of a substance onto the surface of the skin.
The term "local administration" or "administered locally" encompasses "topical administration," "intradermal administration," and "subcutaneous administration," each as defined herein above. This term also encompasses "intratumoral administration," which refers to administration of a substance to the inside of a tumor. Local administration is intended to allow for high local concentrations around the site of administration for a period of time until systemic biodistribution has been achieved with of the administered substance, while "systemic administration" is intended for the administered substance to be absorbed into the blood and attain systemic exposure rapidly by being distributed through the circulatory system to organs or tissues throughout the body.
The term "mammal" refers to any animal species of the Mammalia class. Examples of mammals include: humans; non-human primates such as monkeys; laboratory animals such as rats, mice, guinea pigs; domestic animals such as cats, dogs, rabbits, cattle, sheep, goats, horses, and pigs; and captive wild animals such as lions, tigers, elephants, and the like. The term "membrane-bound" means that after a nucleotide sequence encoding a particular polypeptide is expressed by a host cell, the expressed polypeptide is bound to, attached to, or otherwise associated with, the membrane of the cell.
The term "neoplastic disorder" refers to a condition in which cells proliferate at an abnormally high and uncontrolled rate, the rate exceeding and uncoordinated with that of the surrounding normal tissues. It usually results in a solid lesion or lump known as "tumor." This term encompasses benign and malignant neoplastic disorders. The term "malignant neoplastic disorder", which is used interchangeably with the term "cancer" in the present disclosure, refers to a neoplastic disorder characterized by the ability of the tumor cells to spread to other locations in the body (known as "metastasis"). The term "benign neoplastic disorder" refers to a neoplastic disorder in which the tumor cells lack the ability to metastasize.
The term "operably linked" refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. A control sequence "operably linked" to a transgene is ligated in such a way that expression of the transgene is achieved under conditions compatible with the control sequences.
The term "pharmaceutically acceptable excipient" refers to a substance in an immunogenic or vaccine composition, other than the active ingredients (e.g., the antigen, antigen-coding nucleic acid, immune modulator, or adjuvant) that is compatible with the active ingredients and does not cause significant untoward effect in subjects to whom it is administered.
The terms "peptide," "polypeptide," and "protein" are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically, or biochemically modified or derivatized amino acids, and polypeptides having modified polypeptide backbones.
The term "preventing" or "prevent" refers to (a) keeping a disorder from occurring or (b) delaying the onset of a disorder or onset of symptoms of a disorder.
The term "prostate-associated-antigen" (or PAA) refers to the TAA (as defined herein) that is specifically expressed on prostate tumor cells or expressed at a higher frequency or density by tumor cells than by non-tumor cells of the same tissue type. Examples of PAA include PSA, PSCA, and PSMA. The term "secreted" in the context of a polypeptide means that after a nucleotide sequence encoding the polypeptide is expressed by a host cell, the expressed polypeptide is secreted outside of the host cell.
The term "suboptimal dose" when used to describe the amount of an immune modulator, such as a protein kinase inhibitor, refers to a dose of the immune modulator that is below the minimum amount required to produce the desired therapeutic effect for the disease being treated when the immune modulator is administered alone to a patient.
The term "treating," "treatment," or "treat" refers to abrogating a disorder, reducing the severity of a disorder, or reducing the severity or occurrence frequency of a symptom of a disorder.
The term "tumor-associated antigen" or "TAA" refers to an antigen which is specifically expressed by tumor cells or expressed at a higher frequency or density by tumor cells than by non-tumor cells of the same tissue type. Tumor-associated antigens may be antigens not normally expressed by the host; they may be mutated, truncated, misfolded, or otherwise abnormal manifestations of molecules normally expressed by the host; they may be identical to molecules normally expressed but expressed at abnormally high levels; or they may be expressed in a context or milieu that is abnormal. Tumor-associated antigens may be, for example, proteins or protein fragments, complex carbohydrates, gangliosides, haptens, nucleic acids, or any combination of these or other biological molecules.
The term "vaccine" refers to an immunogenic composition for administration to a mammal for eliciting an immune response against a particular antigen.
The term "vector" refers to a nucleic acid molecule capable of transporting or transferring a foreign nucleic acid molecule. The foreign nucleic acid molecule is referred to as "insert" or "transgene." A vector generally consists of an insert and a larger sequence that serves as the backbone of the vector. The term "vector" encompasses both expression vectors and transcription vectors. The term "expression vector" refers to a vector capable of expressing the insert in the target cell. It generally contains control sequences, such as enhancer, promoter, and terminator sequences, that drive expression of the insert. The term "transcription vector" refers to a vector capable of being transcribed but not translated. Transcription vectors are used to amplify their insert. Based on the structure or origin of vectors, major types of vectors include plasmid vectors, cosmid vectors, phage vectors such as lambda phage, viral vectors such as adenovirus (Ad) vectors, and artificial chromosomes.
B. VECTORS CONTAINING A MULTI-ANTIGEN CONSTRUCT
In one aspect, the present disclosure provides a voral vector constructed from the genome of chimpanzee adenovirus ChAd68 for expression of two or more immunogenic PAA polypeptides. Chimpanzee adenovirus ChAd68 is also referred in the literature as simian adenovirus 25, C68, Chad68, SAdV25, PanAd9, or Pan9. For convenience, the chimpanzee adenovirus ChAd68 may be referred to in this specification as "C68" and the viral vector constructed from the genome of chimpanzee adenovirus ChAd68 is refrred to as "C68 vector." The full length genomic sequence of C68 is available from Genbank (Accession Number AC_00001 1 .1 ) and is provided in SEQ ID NO:57. In addition, the full length genomic sequence of C68 and location of the adenovirus genes E1 a, E1 b, E2a, E2b, E3, E4, 11 , I2, L3, L4, and L5 are also provided in US Patent 6,083,716.
The C68 vector provided by the present disclosure comprises (1 ) a C68 DNA sequence, and (2) a multi-antigen construct for expression of two or more immunogenic PAA polypeptides. The vector may also contain non-native regulatory sequences that control the transcription and translation of the antigen products. The non-native regulatory sequences refer to sequences that are not part of the C68 genome. The C68 DNA sequence, multi-antigen construct, and regulatory sequences are operably linked to each other.
The C68 vector can be replication-competent, conditionally replication-competent, or replication-deficient. A replication-competent C68 vector can replicate in typical host cells, i.e., cells typically capable of being infected by an adenovirus. A replication- competent viral vector can have one or more mutations as compared to the wild-type adenovirus (e.g., one or more deletions, insertions, and/or substitutions) in the adenoviral genome that do not inhibit viral replication in host cells. A conditionally- replicating C68 vector is viral vector that has been engineered to replicate under predetermined conditions. For example, replication-essential gene functions, e.g., gene functions encoded by the adenoviral early regions, can be operably linked to an inducible, repressible, or tissue-specific transcription control sequence, e.g., promoter. A replication-deficient C68 vector is a viral vector that requires complementation of one or more gene functions or regions of the viral genome that are required for replication, as a result of, for example, a deficiency in one or more replication-essential gene function or regions, such that the vector does not replicate in typical host cells, especially those in a human to be infected by the vector.
The vectors are useful for cloning or expressing the immunogenic PAA polypeptides, or for delivering the multi-antigen construct in a composition, such as a vaccine, to a host cell or to a host animal, such as a human. In some particular embodiments, the present disclosure provides a vector selected from the group comsisting of (i) a vector comprsing or consisting of the nucleotide sequence of SEQ ID NO:58; (ii) a vector comprsing or consisting of nucleotides 9 - 3481 1 of SEQ ID NO:58; and (iii) a vector comprsing or consisting of the nucleotide sequence of SEQ ID NO:63.
The C68 vector provided by the present disclosure also encompasses functional variants of the vectors specifically described or exemplified in the present disclosure. A "functional variant" refers a vector that contains mutations (e.g., additions, deletions, or substitutions) relative to the sequence of a vector ("parent vector") specifically described or exemplified in the present disclosure but retains the function or property of the parent vector. For example, functional variant may comprise codon-optimized sequence corresponding to a parent vector examplified in the present disclosure.
B1 . The C68 DNA Sequence
The term "C68 DNA sequence" refers to a DNA sequence that is part of the C68 genomic sequence. The C68 DNA sequence included in the vector is derived from C68 genomic sequence by functional deletion of one or more viral genes or genomic regions. The term "functional deletion" means that a sufficient amount of the gene region of the virus is removed or otherwise changed, e.g., by mutation or modification, so that the gene region is no longer capable of producing functional products of gene expression or is otherwise performing its normal function. Deletion of an entire gene region often is not required for disruption of a replication-essential gene function. However, for the purpose of providing sufficient space in the C68 genome for one or more transgenes, removal of a majority of one or more gene regions may be desirable. While deletion of genetic material is preferred, mutation of genetic material by addition or substitution also is appropriate for disrupting gene function.
In some embodiments, the C68 DNA sequence of the vector is derived from the C68 genomic sequence by functionally deleting the entire, or a sufficient portion of, the adenoviral immediate early gene E1 a and delayed early gene E1 b. In other embodiments, in addition to the functional deletion of E1 a and E1 b, functional deletion may also be made to one or more other genes, such as the delayed early gene E2a, delayed early gene E3, E4, any of the late genes L1 through L5, the intermediate genes IX, and IVa2. Thus, the C68 DNA sequence for use in the construction of the vector of the invention may contain deletions in E1 only. Alternatively, deletions of entire genes or portions thereof effective to destroy their biological activity may be used in any combination. For example, in one exemplary vector, the C68 DNA sequence is derived from the C68 genomic sequence by functinal deletions of the E1 genes and the E4 gene, or of the E1 , E2a and E3 genes, or of the E1 and E3 genes, or of E1 , E2a and E4 genes, with or without deletion of E3, and so on. In addition, such deletions may be used in combination with other mutations, such as temperature-sensitive mutations, to achieve a desired result. In a particular embodiment, the C68 DNA sequence is the entire C68 genome with only functional deletions in the E1 and E3 regions.
In some particular embodiments, the functional deletion of E1 gene is accomplished by deletion of nucleotides 577-3403 of SEQ ID NO:57 or by deletion of nucleotides 456-3012 of SEQ ID NO:57, and the functional deletion of E3 gene is accomplished by deletion of nucleotides 27125-31831 of SEQ ID NO:57 or by deletion of nucleotides 27812-31330 of SEQ ID NO:57. In other particular embodiments, the C68 DNA sequence included in the vector comprises nucleodtides 3013 - 2781 1 of SEQ ID NO:57. In still other particular embodiments, the C68 DNA sequence included in the vector comprises nucleodtides 3013 - 2781 1 and 31331 - 36519 of SEQ ID NO:57.
The multi-antigen construct may be inserted into any deleted region of the adenovirus genome. The multi-antigen construct may also be inserted into an existing gene region to disrupt the function of that region. In some embodiments, the multi- antigen construct is inserted in the place of the deleted E1 gene.
B2. The Multi-antigen Constructs
The term "multi-antigen construct" refers to a nucleic acid molecule or sequence that encodes two or more PAA polypeptides. Such molecules or sequences may also be referred to as "multi-antigen vaccine" or "multi-antigen plasmid" in the present disclosure. A multi-antigen construct can carry two coding nucleotide sequences wherein each of the coding nucleotide sequences expresses an individual immunogenic PAA polypeptide. Such a construct is also referred to as "dual antigen construct," "dual antigen vaccine," or "dual antigen plasmid" in this disclosure. A multi-antigen construct can also carry three coding nucleotide sequences wherein each of the coding nucleotide sequences expresses an individual immunogenic PAA polypeptide. Such a construct is also referred to as "triple antigen construct," "triple antigen vaccine," or "triple antigen plasmid" in this disclosure. The individual PAA polypeptides encoded by a multi-antigen construct may be immunogenic against the same antigen, such as PSMA, PSA, or PSCA. For example, a dual antigen construct may express two different PAA antigens that are both immunogenic against PSMA. The individual PAA polypeptides encoded by a multi-antigen construct may be immunogenic against different antigens, for example, a dual antigen construct may express two PAA polypeptides that are immunogenic against PSMA and PSA, respectively. It is preferred that a multi-antigen construct encodes two or more individual PAA polypeptides that are immunogenic against different antigens.
In some embodiments, the multi-antigen construct encodes at least two
immunogenic PAA polypeptides in any one of the following combinations:
1 ) an immunogenic PSMA polypeptide and an immunogenic PSA polypeptide;
2) an immunogenic PSMA polypeptide and an immunogenic PSCA polypeptide; and
3) an immunogenic PSA polypeptide and an immunogenic PSCA polypeptide. In some particular embodiments, the multi-antigen construct encodes at least one immunogenic PSMA polypeptide, at least one immunogenic PSA polypeptide, and at least one immunogenic PSCA polypeptide.
The immunogenic PSMA polypeptide expressed by a multi-antigen construct may be cytosolic, secreted, or membrane-bound, but preferably membrane-bound. In some embodiments, the immunogenic PSMA polypeptide comprises an amino acid sequence selected from the group consisting of:
1 ) the amino acid sequence of SEQ ID NO:1 ,
2) amino acids 15-750 of SEQ ID NO:1 ;
3) the amino acid sequence of SEQ ID NO:3;
4) the amino acid sequence of SEQ ID NO:5;
5) the amino acid sequence of SEQ ID NO:7;
6) amino acids 4 - 739 of SEQ ID NO:3;
7) amino acids 4 - 739 of SEQ ID NO:5; 8) amino acids 4 - 739 of SEQ ID NO:7;
9) the amino acid sequence of SEQ ID NO:9; and
10) amino acids 4 - 739 of SEQ ID NO:9.
The immunogenic PSA polypeptide expressed by a multi-antigen construct may be cytosolic, secreted, or membrane-bound, but preferably cytosolic. In some embodiments, the immunogenic PSA polypeptide comprises an amino acid sequence selected from the group consisting of:
1 ) amino acids 27-263 of SEQ ID NO: 15;
2) the amino acid sequence of SEQ ID NO:17; and
3) amino acids 4 - 240 of SEQ ID NO:17.
The immunogenic PSCA polypeptide expressed by a multi-antigen construct may be the full length human PSCA protein. In some embodiments, the immunogenic PSCA polypeptide comoprises an amino acid sequence selected from the group consisting of:
1 ) the amino acid sequence of SEQ ID NO:21 ;
2) amino acids 2-125 of SEQ ID NO;21 ; and
3) amino acids 4-125 ofSEQ ID NO:21 .
In some other embodiments, the multi-antigen construct encodes at least one immunogenic PSA polypeptide, at least one immunogenic PSCA polypeptide, and at least one immunogenic PSMA polypeptide, wherein the immunogenic PSA polypeptide comprises the amino acid sequence of of SEQ ID NO:17 or amino acids 4 - 240 of SEQ ID NO:17, wherein the immunogenic PSCA polypeptide comprises the amino acid sequence of SEQ ID NO:21 or amino acids 2-125 of SEQ ID NO:21 , and wherein the immunogenic PSMA polypeptide comprises an amino acid sequence selected from the group consisting of:
1 ) amino acids 15-750 of SEQ ID NO: 1 ;
2) amino acids 4 - 739 of SEQ ID NO:9; and
3) the amino acid sequence of SEQ ID NO: 9.
In some particular embodiments, the multi-antigen construct comprises a nucleotide sequence that encodes the amino acid sequence of SEQ ID NO:60 or 64.
In some particular embodiments, the multi-antigen construct comprises: (i) a nucleotide sequence encoding an immunogenic PSA polypeptide, (ii) a nucleotide sequence encoding an immunogenic PSCA polypeptide, and (iii) a nucleotide sequence encoding an immunogenic PSMA polypeptide, wherein: (1 ) the nucleotide sequence encoding the immunogenic PSA polypeptide is selected from the group consisting of: (i) nucleotide sequence of SEQ ID NO:18; (ii) nucleotide sequence of SEQ ID NO:20; (iii) nucleotide sequence comprising nucleotides 10-720 of SEQ ID NO:18; (iv) nucleotide sequence comprising nucleotides 1 1 15-1825 of SEQ ID NO:58 or SEQ ID NO:63; (v) nucleotide sequence comprising nucleotides 1 106-1825 of SEQ ID NO:58 or SEQ ID NO:63; and (vi) a degerate variant of any of the nucleotide sequences provided in (i) - (v) above.
(2) the nucleotide sequence encoding the immunogenic PSCA polypeptide is selected from the group consisting of: (i) the nucleotide sequence of SEQ ID NO:22; (ii) a nucleotide sequence comprising nucleotides 10- 375 of SEQ ID NO:22; (iii) a nucleotide sequence comprising nucleotides 1892-2257 of SEQ ID NO:58 or SEQ ID NO:63; (iv) a nucleotide sequence comprising nucleotides 1886-2257 of SEQ ID NO:58 or SEQ ID NO:63; and (v) a degerate variant of any of the nucleotide sequences provided in (i) - (iv) above; and
(3) the nucleotide sequence encoding the immunogenic PSMA polypeptide is selected from the group consisting of: (i) the nucleotide sequence comprising nucleotides 43-2250 of SEQ ID NO:2; (ii) the nucleotide sequence of SEQ ID NO:4; (iii) the nucleotide sequence of SEQ ID NO:6; (iv) the nucleotide sequence of SEQ ID NO:8; (v) the nucleotide sequence of SEQ ID NO:10; (vi) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:4; (vii) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:6; (viii) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:8; (ix) a nucleotide sequence comprising nucleotides 10-2217 of SEQ ID NO:10; (x) the nucleotide sequence comprising nucleotides 2333-4543 of SEQ ID NO:58 or SEQ ID NO:63; (xi) the nucleotide sequence comprising nucleotides 2324-4543 of SEQ ID NO:58 or SEQ ID NO:63; and (xii) a degerate variant of any of the nucleotide sequences provided in (i) - (xi) above.
In another specific embodiment, the multi-antigen construct comprises a nucleotide sequence encoding an immunogenic PSA polypeptide, a nucleotide sequence encoding an immunogenic PSCA polypeptide, and a nucleotide sequence encoding an immunogenic PSMA polypeptide, wherein: the nucleotide sequence encoding the immunogenic PSA polypeptide comprises nucleotides 1 106-1825 of SEQ ID NO:58 or SEQ ID NO:63; the nucleotide sequence encoding the immunogenic PSCA polypeptide comprises nucleotides 1886-2257 of SEQ ID NO:58 or SEQ ID NO:62; and the nucleotide sequence encoding the immunogenic PSMA polypeptide comprises nucleotides 2324-4543 of SEQ ID NO:58 or SEQ ID NO:63.
In order to enable expression of separate immunogenic PAA polypeptides from a single multi-antigen construct carried by the vector, intervening sequences are included between the sequences that encode the individual immunogenic PAA polypeptides (i.e., PSA, PSCA, and PSMA polypeptides). These intervening sequences enable the separate translation of the downstream immunogenic PAA polypeptide. Such an intervening sequence is referred to as "separator sequence" in the specification. Any sequences that can be used for the co-expression of multiple polypeptides from a single vector may be used as separator sequences in the vector provided by the present disclosure. Examples of useful separator sequences includes internal ribosomal entry sites (IRESs) and 2A peptide sequences.
2A peptide and 2A peptide-like sequences, also referred to as cleavage cassettes or CHYSELs (cis-acting hydrolase elements), are approximately 20 amino acids long with a highly conserved carboxy terminal D-V/I-EXNPGP motif (Figure 2). The sequences are rare in nature, most commonly found in viruses such as Foot-and- mouth disease virus (FMDV), Equine rhinitis A virus (ERAV), Encephalomyocarditis virus (EMCV), Porcine teschovirus (PTV), and Thosea asigna virus (TAV) (Luke, G. A., P. de Felipe, et al. (2008). "Occurrence, function and evolutionary origins of '2A-like' sequences in virus genomes." J Gen Virol 89(Pt 4): 1036-1042). With a 2A-based multi- antigen expression strategy, genes encoding multiple target antigens are linked together in a single open reading frame, separated by 2A sequences. The entire open reading frame is cloned into a vector with a single promoter and terminator. Upon delivery of the constructs to a host cell, imRNA encoding the multiple antigens is transcribed and translated as a single polyprotein. During translation of the 2A sequences, ribosomes skip the bond between the C-terminal glycine and proline. The ribosomal skipping acts like a cotranslational autocatalytic "cleavage" that releases upstream from downstream proteins. General information regarding use of various 2A peptide sequences in vectors co-expressing multiple polypeptides may be found in Andrea L. Szymczak & Darrio AA Vignali: Development of 2A peptide-based strategies in the design of multicistronic vectors. Expert Opinion Biol. Ther. (2005)5(5) 627-638, the disclosure of which is incorporated herein by reference. The incorporation of a 2A sequence between two protein antigens results in the addition of -20 amino acids onto the C-terminus of the upstream polypeptide and 1 amino acid (proline) to the N-terminus of downstream protein. In an adaptation of this methodology, protease cleavage sites can be incorporated at the N terminus of the 2A cassette such that ubiquitous proteases will cleave the cassette from the upstream protein (Fang, J., S. Yi, et al. (2007). "An antibody delivery system for regulated expression of therapeutic levels of monoclonal antibodies in vivo." Mol Ther 15(6): 1 153-1 159).
Examples of specific 2A-peptide sequences that may be used in the present invention are disclosed in Andrea L. Szymczak & Darrio AA Vignali: Development of 2A peptide-based strategies in the design of multicistronic vectors. Expert Opinion Biol. Ther. (2005)5(5) 627-638, and are provided in Table 1 .
Table 1 . 2A-peptide Sequences
Figure imgf000022_0001
Internal ribosomal entry sites (IRESs) are RNA elements (Figure 3) found in the 5' untranslated regions of certain RNA molecules (Bonnal, S., C. Boutonnet, et al. (2003). "IRESdb: the Internal Ribosome Entry Site database." Nucleic Acids Res 31 (1 ): 427-428). They attract eukaryotic ribosomes to the RNA to facilitate translation of downstream open reading frames. Unlike normal cellular 7-methylguanosine cap- dependent translation, IRES-mediated translation can initiate at AUG codons far within an RNA molecule. The highly efficient process can be exploited for use in multi-cistronic expression vectors (Bochkov, Y. A. and A. C. Palmenberg (2006). "Translational efficiency of EMCV IRES in bicistronic vectors is dependent upon IRES sequence and gene location." Biotechniques 41 (3): 283-284, 286, 288). Sequence of a preferred EMCV IRES (pIRES) is provided in Figure 3 and SEQ ID NO:59. The minimal EMCV IRES (mIRES) excludes the underlined first five codons of the EMCV L protein as shown in Figure 3. Typically, two transgenes are inserted into a vector between a promoter and transcription terminator as two separate open reading frames separated by an IRES. Upon delivery of the constructs to a host cell, a single long transcript encoding both transgenes will be transcribed. The first ORF will be translated in the traditional cap-dependent manner, terminating at a stop codon upstream of the IRES. The second ORF will be translated in a cap-independent manner using the IRES. In this way, two independent proteins can be produced from a single mRNA transcribed from a vector with a single expression cassette. In some embodiments, the multi-antigen construct comprises a EMCV IRES comprising nucleotides 1 -553 of SEQ ID NO:59.
Typically, only one separator sequence is needed between two immunogenic
PAA polypeptide-coding sequences on a multi-antigen construct. The order of the separator sequences and the nucleotide sequences encoding the PAA polypeptides on a multi-antigen construct is shown in formula (I):
PAA1 -SS1 -PAA2-SS2-PAA3 (I)
Wherein: (i) PAA1 , PAA2, and PAA3 each is a nucleotide sequence encoding an immunogenic PSA polypeptide, a nucleotide sequence encoding immunogenic PSCA polypeptide, or a nucleotide sequence encoding immunogenic PSMA polypeptide, provided that PAA1 , PAA2, and PAA3 encode different PAA polypeptides, and (ii) SS1 and SS2 are separator sequences and can be same or different.
In some embodiments, the vector comprises a multi-antigen construct of formula
(I) wherein:
(i) PAA1 is a nucleotide sequence encoding an immunogenic PSA polypeptide; (ii) PAA2 is a nucleotide sequence encoding an immunogenic PSCA or PSMA polypeptide, (where PAA2 is nucleotide sequence encoding an immunogenic PSCA, then PAA3 is a nucleotide sequence encoding an immunogenic PSMA, or Vice Versa);
(iii) SS1 is a 2A-peptide sequence; and
(iv) SS2 is a 2A-peptide sequence or an IRES.
In some particular embodiments, the multi-antigen construct has a structure selected from the group consisting of:
(1 ) PSA-F2A-PSMA-mlRES-PSCA;
(2) PSA-F2A-PSMA-T2A-PSCA;
(3) PSA-T2A-PSCA-F2A-PSMA; and
(4) PSCA-F2A-PSMA-mlRES-PSA
In a specific embodiment, the vector comprises a multi-antigen construct having a structure of formula (I):
PAA1 -SS1 -PAA2-SS2-PAA3 (I)
wherein:
(i) PAA1 is a nucleotide sequence encoding an immunogenic PSA polypeptide and comprises nucleotides 1 1 15-1825 SEQ ID NO: 58 or comprises 1 106-1 1 14 of SEQ ID NO: 58 or 63;
(ii) PAA2 is a nucleotide sequence encoding an immunogenic PSCA polypeptide and comprises nucleotides 1892-2257 of SEQ ID NO: 58 or comprises 1886-2257 of
SEQ ID NO: 58 or 63;
(iii) PAA3 is a nucleotide sequence encoding an immunogenic PSMA polypeptide and comprises nucleotides 2333-4543 SEQ ID NO: 58 or comprises 2324-4543 of SEQ ID NO: 58 or 63;
(iv) SS1 is a nucleotide sequence encoding T2A; and
(v) SS2 is a nucleotide sequence encoding F2A.
The multi-antigen construct may also include a linker sequence positioned betyween a nucleotide sequence encoding an immunogenic PAA polypeptide (i.e, an immunogenic PSA, PSCA, or PSMA polypeptide) and a down-stream separator sequence. One example of such a linker sequence is a nucleotide sequence encoding glycine-serine.
In some particular embodiments, the multi-antigen construct comprises a nucleotide sequence that encodes an amino acid sequence of SEQ ID NO:60 or encodes an amino acid sequence of SEQ ID NO:61 . In a particular embodiment, the multi-antigen construct comprises a nucleotide sequence selected from the groups consisting of nucleotide sequence of SEQ ID NO:61 , nucleotide sequence of SEQ ID NO:65, nucleotide sequence of SEQ ID NO:66, and degenerate variant of any of the nucleotide sequences.
B3. Regulatory Sequences
In addition to the separator sequences and linker sequences described herein above, the vector may comprise other non-native regulatory sequences to drive the efficient expression of the encoded PAA polypeptides. Examples of the regulatory sequences includes (1 ) transcription initiation, termination, promoter, and enhancer sequences; (2) efficient RNA processing signals such as splicing and polyadenylation signals; (3) sequences that stabilize cytoplasmic imRNA; (4) sequences that enhance translation efficiency (i.e., Kozak consensus sequence); (5) sequences that enhance protein stability; and (6) sequences that enhance protein secretion. Examples of promoter systems that can be used in the vectors provided by the present disclosure to drive efficient expression in mammalian cells include SV40 promoter, chicken B actin promoter, human elongation factor promoter, human cytomegalovirus (CMV) promoter, simian CMV promoter, murine CMV promoter, psudorabies promoter, Rous Sarcoma Virus promoter, phosphoglycerate kinase promoter, murine leukemia virus LTR promoter, avian leukosis virus LTR promoter, mouse mammary tumor virus LTR promoter, moloney murine leukemia virus LTR promoter, plasminogen activator inhibitor promoter, CYR61 , adenovirus major late promoter, mouse metallothionein promoter, mouse phosphoenol-pyruvate carboxykinase promoter, bovine B-lactoglobulin promoter, bovine prolactin promoter, ubiquitin C promoter, and herpes simplex virus thymidine kinase promoter. Examples of transcription termination signals include SV40 polyadenylation (polyA); bovine growth hormone polyA; rabbit B globin polyA; HSV thymidine kinase , glycoprotein B , and glycoprotein D; HPV E and L, and synthetic terminators.
In some embodiments, the C68 vectors comprise a human cytomegalovirus (CMV) promoter, optionally with the CMV enhancer, and a SV40 polyA.
C. COMPOSITIONS COMPRISING A VECTOR CARRYING A MULTI-ANTIGEN CONSTRUCT (VECTOR COMPOSITIONS) The present disclosure also provides a composition comprising a vector provided by the present disclosure (herein "vector composition'). The vector compositions are useful for eliciting an immune response against a PAA protein in vitro or in vivo in a mammal, including a human. The vector composition may comprise the vectors alone, or may further comprise an excipient.
In some embodiments, the vector composition is a pharmaceutical composition, which comprises a vector provided by the present disclosure and a pharmaceutically acceptable excipient. Suitable excipients for pharmaceutical compositions are known in the arts. The excipients may include aqueous solutions, non aqueous solutions, suspensions, and emulsions. Examples of non-aqueous excipients include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Examples of aqueous excipient include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Suitable excipients also include agents that assist in cellular uptake of the vector.
In some embodiments, the pharmaceutical composition is a vaccine composition for administration to humans for inhibiting abnormal cell proliferation, providing protection against the development of cancer (used as a prophylactic), or for treatment of cancer (used as a therapeutic) associated with a PAA over-expression, or for eliciting an immune response to a particular human PAA, such as PSMA, PSA, and PSCA. The vaccine composition may further comprise one or more adjuvants. Examples of adjuvants that may be included in the vaccine compositions are provided herein below.
D. USES OF THE VECTORS AND VECTOR COMPOSITIONS
In other aspects, the present disclosure provides methods of using the vector or composition comprising the vectors described herein above.
In one aspect, the present disclosure provides a method of eliciting an immune response against a PAA in a mammal, particularly a human, comprising administering to the mammal an effective amount of (1 ) a vector containing a multi-antigen construct, or (2) a composition comprising such vectors.
In another aspect, the present disclosure provides a method of inhibiting abnormal cell proliferation in a human, wherein the abnormal cell proliferation is associated with over-expression of a PAA. The method comprises administering to the mammal an effective amount of (1 ) a vector containing a multi-antigen construct encoding two or more immunogenic PAA polypeptides, or (2) a composition comprising such vectors. In some embodiments, the method is for inhibiting abnormal cell proliferation in prostate in a human. In a particular embodiment, the present disclosure provides a method of inhibiting abnormal cell proliferation in prostate over-expressing PSMA. In some embodiments, the disclosure provides a method of treating prostate cancer in a human, comprising administering to the human an effective amount of a (1 ) a vector containing a multi-antigen construct or (2) a composition comprising such vectors. In a preferred embodiment, the multi-antigen construct is a triple antigen construct that encodes an immunogenic PSMA polypeptide, an immunogenic PSA polypeptide, and an immunogenic PSCA polypeptide.
The vectors or vector compositions can be administered to an animal, including human, by a number of methods known in the art. Examples of suitable methods include: (1 ) intramuscular, intradermal, intraepidermal, intravenous, intraarterial, subcutaneous, or intraperitoneal administration, (2) oral administration, and (3) topical application (such as ocular, intranasal, and intravaginal application). One particular method of intradermal or intraepidermal administration of a nucleic acid vaccine composition involves the use of gene gun delivery technology, such the Particle Mediated Epidermal Delivery (PMED™) vaccine delivery device marketed by PowderMed. Another particular method for intramuscular administration of a nucleic acid vaccine is injection followed by electroporation.
The effective amount of the vector or vector composition to be administered in a given method can be readily determined by a person skilled in the art and will depend on a number of factors. In a method of treating cancer, such as prostate cancer, factors that may be considered in determining the effective amount include, but not limited: (1 ) the subject to be treated, including the subject's immune status and health, (2) the severity or stage of the cancer to be treated, (3) the specific immunogenic PAA polypeptides expressed, (4) the degree of protection or treatment desired, (5) the administration method and schedule, (6) formulations used, and (7) co-administration of other therapeutic agents (such as adjuvants or immune modulators). For example, the effective amounts of the vector may be in the range of 2 μg/dose - 10 mg/dose when the nucleic acid vaccine composition is formulated as an aqueous solution and administered by hypodermic needle injection or pneumatic injection, whereas only 16 ng/dose - 16 μg/dose may be required when the nucleic acid is prepared as coated gold beads and delivered using a gene gun technology. The vectors or vector compositions, including vaccine compositions, provided by the present disclosure may be used together with one or more adjuvants. Examples of suitable adjuvants include: (1 ) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl polypeptides or bacterial cell wall components), such as MF59™ (containing 5% Squalene, 0.5% Tween 80, and 0.5% sorbitan trioleate) and SAF (containing 10% Squalene, 0.4% Tween 80, 5% pluronic- blocked polymer L121 , and thr-MDP); (2) saponin adjuvants, such as QS21 , STIMULON™ (Cambridge Bioscience, Worcester, MA), Abisco® (Isconova, Sweden), or Iscomatrix® (Commonwealth Serum Laboratories, Australia); (3) complete Freund's Adjuvant (CFA) and incomplete Freund's Adjuvant (IFA); (4) oligonucleotides comprising CpG motifs, i.e. containing at least one CG dinucleotide, where the cytosine is unmethylated (e.g., Krieg, Vaccine (2000) 19:618-622; Krieg, Curr Opin Mol Ther (2001 ) 3:15-24; WO 98/40100, WO 98/55495, WO 98/37919 and WO 98/52581 ); and (5) metal salt including aluminum salts (such as alum, aluminum phosphate, aluminum hydroxide); (12) a saponin and an oil-in-water emulsion {e.g. WO 99/1 1241 ).
The vectors or vector compositions provided by the present disclosure may be used together with one or more immune modulators. In a further aspect, the present disclosure provides a method of treating prostate cancer in a mammal, particularly a human, the method comprising administering to the mammal: (1 ) an effective amount of a vector, vector composition, or vaccine provided by the present invention; (2) an effective amount of at least one immune-suppressive-cell inhibitor (ISC inhibitor); and (3) an effective amount of at least one immune-effector-cell enhancer (IEC enhancer). This method is also referred to as "vaccine-based immunotherapy regimen" (or "VBIR") in the present disclosure.
The IEC enhancers and ISC inhibitors may be administered by any suitable methods and routes, including (1 ) systemic administration such as intravenous, intramuscular, or oral administration, and (2) local administration such intradermal and subcutaneous administration. Where appropriate or suitable, local administration is generally preferred over systemic administration. Local administration of any IEC enhancer and ISC inhibitor can be carried out at any location of the body of the mammal that is suitable for local administration of pharmaceuticals; however, it is more preferable that these immune modulators are administered locally at close proximity to the vaccine draining lymph node. Two or more specific IEC enhancers from a single class of IEC enhancers (for examples, two CTLA-antagonists) may be administered in combination with the ISC inhibitors. In addition, two or more specific IEC enhancers from two or more different classes of IEC enhancers (for example, one CTLA-4 antagonist and one TLR agonist, or one CTLA-4 antagonist and one PD-1 antagonist) may be administered together. Similarly, two or more specific ISC inhibitors from a single class of ISC inhibitors (for examples, two or more protein kinase inhibitors) may be administered in combination with the IEC enhancers. In addition, two or more specific ISC inhibitors from two or more different classes of ISC inhibitors (for example, one protein kinase inhibitor and one COX-2 inhibitor) may be administered together.
The vectors or vector compositions may be administered simultaneously or sequentially with any or all of the immune modulators (i.e., ISC inhibitors and IEC enhancers) used. Similarly, when two or more immune modulators are used, they may be administered simultaneously or sequentially with respect to each other. In some embodiments, a vector or vector composition is administered simultaneously (e.g., in a mixture) with respect to one immune modulator, but sequentially with respect to one or more additional immune modulators. Co-administration of the vector or vector composition and the immune modulators can include cases in which the vaccine and at least one immune modulator are administered so that each is present at the administration site, such as vaccine draining lymph node, at the same time, even though the antigen and the immune modulators are not administered simultaneously. Co-administration of the vaccine and the immune modulators also can include cases in which the vaccine or the immune modulator is cleared from the administration site, but at least one cellular effect of the cleared vaccine or immune modulator persists at the administration site, such as vaccine draining lymph node, at least until one or more additional immune modulators are administered to the administration site. In cases where a nucleic acid vaccine is administered in combination with a CpG, the vaccine and CpG may be contained in a single formulation and administered together by any suitable method. In some embodiments, the nucleic acid vaccine and CpG in a co- formulation (mixture) is administered by intramuscular injection in combination with electroporation.
Any ISC inhibitors may be used in combination with the vectors or vector compositions provided by the present invention. Examples of classes of ISC inhibitors include PD-1/PD-L1 antagonists, protein kinase inhibitors, cyclooxygenase-2 (COX-2) inhibitors, phosphodiesterase type 5 (PDE5) inhibitors, and DNA crosslinkers. Examples PD-1 /PD-L1 antagonists include anti-PD-1 and PD-L1 monoclonal antibodies Examples of COX-2 inhibitors include celecoxib and rofecoxib. Examples of PDE5 inhibitors include avanafil, lodenafil, mirodenafil, sildenafil, tadalafil, vardenafil, udenafil, and zaprinast. An example of DNA crosslinkers is cyclophosphamide. Examples of specific protein kinase inhibitors are described in details below.
The term "protein kinase inhibitor" refers to any substance that acts as a selective or non-selective inhibitor of a protein kinase. The term "protein kinases" refers to the enzymes that catalyze the transfer of the terminal phosphate of adenosine triphosphate to tyrosine, serine or threonine residues in protein substrates. Protein kinases include receptor tyrosine kinases and non-receptor tyrosine kinases. Examples of receptor tyrosine kinases include EGFR (e.g., EGFR/HER1 /ErbB1 , HER2/Neu/ErbB2, HER3/ErbB3, HER4/ErbB4), INSR (insulin receptor), IGF-IR, IGF-II1 R, IRR (insulin receptor-related receptor), PDGFR (e.g., PDGFRA, PDGFRB), c-KIT/SCFR, VEGFR- 1 /FLT-1 , VEGFR-2/FLK-1 /KDR, VEGFR-3/FLT-4, FLT-3/FLK-2, CSF-1 R, FGFR 1 -4, CCK4, TRK A-C, MET, RON, EPHA 1 -8, EPHB 1 -6, AXL, MER, TYRO3, TIE, TEK, RYK, DDR 1 -2, RET, c-ROS, LTK (leukocyte tyrosine kinase), ALK (anaplastic lymphoma kinase), ROR 1 -2, MUSK, AATYK 1 -3, and RTK 106. Examples of non-receptor tyrosine kinases include BCR-ABL, Src, Frk, Btk, Csk, Abl, Zap70, Fes/Fps, Fak, Jak, Ack, and LIMK. In the vaccine-based immunotherapy regimen provided by the present disclosure, the protein kinase inhibitors are administered to the mammal at a suboptimal dose. The term "suboptimal dose" refers to the dose amount that is below the minimum effective dose when the tyrosine kinase inhibitor is administered in a monotherapy (i.e., where the protein kinase inhibitor is administered alone without any other therapeutic agents) for the target neoplastic disorder.
Examples of specific protein kinase inhibitors suitable for use in the vaccine- based immunotherapy regimen include lapatinib, AZD 2171 , ET18OCH 3, indirubin-3'- oxime, NSC-154020, PD 169316, quercetin, roscovitine, triciribine, ZD1839, 5- lodotubercidin, adaphostin, aloisine, alsterpaullone, aminogenistein, API-2, apigenin, arctigenin, ARRY-334543, axitinib, AY-22989, AZD 2171 , Bisindolylmaleimide IX, CCI- 779, chelerythrine, DMPQ, DRB, edelfosine, ENMD-981693, erbstatin analog, erlotinib, fasudil, gefitinib (ZD1839), H-7, H-8, H-89, HA-100, HA-1004, HA-1077, HA-1 100, hydroxyfasudil, kenpaullone, KN-62, KY12420, LFM-A13, luteolin, LY294002, LY- 294002, mallotoxin, ML-9, MLN608, NSC-226080, NSC-231634, NSC-664704, NSC- 680410, NU6102, olomoucine, oxindole I, PD 153035, PD 98059, phloridzin, piceatannol, picropodophyllin, PKI, PP1 , PP2, PTK787/ZK222584, PTK787/ZK-222584, purvalanol A, rapamune, rapamycin, Ro 31 -8220, rottlerin, SB202190, SB203580, sirolimus, SL327, SP600125, staurosporine, STI-571 , SU1498, SU4312, SU5416, semaxanib, SU6656, SU6668, syk inhibitor, TBB, TCN, tyrphostin AG 1024, tyrphostin AG 490, tyrphostin AG 825, tyrphostin AG 957, U0126, W-7, wortmannin, Y-27632, zactima, ZM 252868, gefitinib, sunitinib malate, eriotinib, lapatinib, canertinib, semaxinib, vatalanib, sorafenib, imatinib, dasatinib, leflunomide, vandetanib, and nilotinib.
In some embodiments, the protein kinase inhibitor is a multi-kinase inhibitor, which is an inhibitor that acts on more than one specific kinase. Examples of multi- kinase inhibitors include imatinib, sorafenib, lapatinib, BIRB-796, and AZD-1 152, AMG706, zactima, MP-412, sorafenib, dasatinib, lestaurtinib, XL647, XL999, lapatinib, MLN518, (also known as CT53518), PKC412, ST1571 , AEE 788, OSI-930, OSI-817, sunitinib malate, eriotinib, gefitinib, axitinib, bosutinib, temsirolismus and nilotinib. In some particular embodiments, the tyrosine kinase inhibitor is sunitinib, sorafenib, or a pharmaceutically acceptable salt or derivative (such as a malate or a tosylate) of sunitinib or sorafenib.
Sunitinib malate, which is marketed by Pfizer Inc. under the trade name SUTENT, is described chemically as butanedioic acid, hydroxy-, (2S)-, compound with A/-[2- (diethylamino)ethyl]-5-[(Z)-(5-fluoro-1 ,2-dihydro-2-oxo-3H-indol-3-ylidine)methyl]-2,4- dimethyl- 7H-pyrrole-3-carboxamide (1 :1 ). The compound, its synthesis, and particular polymorphs are described in U.S. Pat. No. 6,573,293, U.S. Patent Publication Nos. 2003-0229229, 2003-0069298 and 2005-0059824, and in J. M. Manley, M. J. Kalman, B. G. Conway, C. C. Ball, J. L Havens and R. Vaidyanathan, "Early Amidation Approach to 3-[(4-amido)pyrrol-2-yl]-2-indolinones," J. Org. Chew. 68, 6447-6450 (2003). Formulations of sunitinib and its L-malate salt are described in PCT Publication No. WO 2004/024127. Sunitinib malate has been approved in the U.S. for the treatment of gastrointestinal stromal tumor, advanced renal cell carcinoma, and progressive, well- differentiated pancreatic neuroendocrine tumors in patients with unresectable locally advanced or metastatic disease. The recommended dose of sunitinib malate for gastrointestinal stromal tumor (GIST) and advanced renal cell carcinoma (RCC) for humans is 50 mg taken orally once daily, on a schedule of 4 weeks on treatment followed by 2 weeks off (Schedule 4/2). The recommended dose of sunitinib malate for pancreatic neuroendocrine tumors (pNET) is 37.5 mg taken orally once daily.
In the vaccine-based immunotherapy regimen, sunitinib malate may be administered orally in a single dose or multiple doses. Typically, sunitinib malate is delivered for two, three, four or more consecutive weekly doses followed by a "off" period of about 1 or 2 weeks, or more where no sunitinib malate is delivered. In one embodiment, the doses are delivered for about 4 weeks, with 2 weeks off. In another embodiment, the sunitinib malate is delivered for two weeks, with 1 week off. However, it may also be delivered without a "off period for the entire treatment period. The effective amount of sunitinib malate administered orally to a human in the vaccine-based immunotherapy regimen is typically below 40 mg per person per dose. For example, it may be administered orally at 37.5, 31 .25, 25, 18.75, 12.5, 6.25 mg per person per day. In some embodiments, sunitinib malate is administered orally in the range of 1 - 25 mg per person per dose. In some other embodiments, sunitinib malate is administered orally in the range of 6.25, 12.5, or 18.75 mg per person per dose. Other dosage regimens and variations are foreseeable, and will be determined through physician guidance.
Sorafenib tosylate, which is marketed under the trade name NEXAVAR, is also a multi-kinase inhibitor. Its chemical name is 4-(4-{3-[4-Chloro-3-(trifluoromethyl) phenyl]ureido}phenoxy)-N-methylpyrid-ine-2-carboxamide. It is approved in the U.S. for the treatment of primary kidney cancer (advanced renal cell carcinoma) and advanced primary liver cancer (hepatocellular carcinoma). The recommended daily dose is 400 mg taken orally twice daily. In the vaccine-based immunotherapy regimen provided by the present disclosure, the effective amount of sorafenib tosylate administered orally is typically below 400 mg per person per day. In some embodiments, the effective amount of sorafenib tosylate administered orally is in the range of 10 - 300 mg per person per day. In some other embodiments, the effective amount of sorafenib tosylate administered orally is between 10 - 200 mg per person per day, such as 10, 20, 60, 80, 100, 120, 140, 160, 180, or 200 mg per person per day.
Axitinib, which is marketed under the trade name INLYTA, is a selective inhibitor of VEGF receptors 1 , 2, and 3. Its chemical name is (A/-Methyl-2-[3-((E)-2-pyridin-2-yl- vinyl)-1 -/-indazol-6-ylsulfanyl]-benzamide. It is approved for the treatment of advanced renal cell carcinoma after failure of one prior systemic therapy. The starting dose is 5 mg orally twice daily. Dose adjustments can be made based on individual safety and tolerability. In the vaccine-based immunotherapy regimen provided by the present disclosure, the effective amount of axitinib administered orally is typically below 5 mg twice daily. In some other embodiments, the effective amount of axitinib administered orally is between 1 -5 mg twice daily. In some other embodiments, the effective amount of axitinib administered orally is between 1 , 2, 3, 4, or 5 mg twice daily.
In the vaccine-based immunotherapy regimens any IEC enhancers may be used. They may be small molecules or large molecules (such as protein, polypeptide, DNA, RNA, and antibody). Examples of IEC enhancers that may be used include TNFR agonists, CTLA-4 antagonists, TLR agonists, programmed cell death protein 1 (PD-1 ) antagonists (such as anti-PD-1 antibody CT-01 1 ), and programmed cell death protein 1 ligand 1 (PD-L1 ) antagonists (such as BMS-936559), lymphocyte-activation gene 3 (LAG3) antagonists, and T cell Immunoglobulin- and mucin-domain-containing molecule -3 (TIM-3) antagonists. Examples of specific TNFR agonists, CTLA-4 antagonists, and TLR agonists are provided in details herein below.
TNFR Agonists.
Examples of TNFR agonists include agonists of OX40, 4-1 BB (such as BMS- 663513), GITR (such as TRX518), and CD40. Examples of specific CD40 agonists are described in details herein below.
CD40 agonists are substances that bind to a CD40 receptor on a cell and are capable of increasing one or more CD40 or CD40L associated activities. Thus, CD40 "agonists" encompass CD40 "ligands".
Examples of CD40 agonists include CD40 agonistic antibodies, fragments CD40 agonistic antibodies, CD40 ligands (CD40L), and fragments and derivatives of CD40L such as oligomeric (e.g., bivalent, trimeric CD40L), fusion proteins containing and variants thereof.
CD40 ligands for use in the present invention include any peptide, polypeptide or protein, or a nucleic acid encoding a peptide, polypeptide or protein that can bind to and activate one or more CD40 receptors on a cell. Suitable CD40 ligands are described, for example, in U.S. Pat. No. 6,482,41 1 ; U.S. Pat. No.6,410,71 1 ; U.S. Pat. No. 6,391 ,637; and U.S. Pat. No. 5,981 ,724, all of which patents and application and the CD40L sequences disclosed therein are incorporated by reference in their entirety herein. Although human CD40 ligands will be preferred for use in human therapy, CD40 ligands from any species may be used in the invention. For use in other animal species, such as in veterinary embodiments, a species of CD40 ligand matched to the animal being treated will be preferred. In certain embodiments, the CD40 ligand is a gp39 peptide or protein oligomer, including naturally forming gp39 peptide, polypeptide or protein oligomers, as well as gp39 peptides, polypeptides, proteins (and encoding nucleic acids) that comprise an oligomerization sequence. While oligomers such as dimers, trimers and tetramers are preferred in certain aspects of the invention, in other aspects of the invention larger oligomeric structures are contemplated for use, so long as the oligomeric structure retains the ability to bind to and activate one or more CD40 receptor(s).
In certain other embodiments, the CD40 agonist is an anti-CD40 antibody, or antigen-binding fragment thereof. The antibody can be a human, humanized or part- human chimeric anti-CD40 antibody. Examples of specific anti-CD40 monoclonal antibodies include the G28-5, mAb89, EA-5 or S2C6 monoclonal antibody, and CP870893. In a particular embodiment, the anti-CD40 agonist antibody is CP870893 or dacetuzumab (SGN-40).
CP-870,893 is a fully human agonistic CD40 monoclonal antibody (imAb) that has been investigated clinically as an anti-tumor therapy. The structure and preparation of CP870,893 is disclosed in WO2003041070 (where the antibody is identified by the internal identified "21 .4.1 " ). The amino acid sequences of the heavy chain and light chain of CP-870,893 are set forth in SEQ ID NO: 40 and SEQ ID NO: 41 , respectively. In clinical trials, CP870,893 was administered by intravenous infusion at doses generally in the ranges of 0.05 - 0.25 mg/kg per infusion. In a phase I clinical study, the maximum tolerated dose (MTD) of CP-870893 was estimated to be 0.2 mg/kg and the dose- limiting toxicities included grade 3 CRS and grade 3 urticaria. [Jens Ruter et al.: Immune modulation with weekly dosing of an agonist CD40 antibody in a phase I study of patients with advanced solid tumors. [Cancer Biology & Therapy 10:10, 983-993; November 15, 2010.]. In the vaccine-based immunotherapy regimen provided by the present disclosure, CP-870,893 can be administered intradermally, subcutaneously, or topically. It is preferred that it is administered intradermally. The effective amount of CP870893 to be administered in the regimen is generally below 0.2 mg/kg, typically in the range of 0.01 mg - 0.15 mg/kg, or 0.05 - 0.1 mg/kg. Dacetuzumab (also known as SGN-40 or huS2C6; CAS number 88-486-59-9) is another anti-CD40 agonist antibody that has been investigated in clinical trials for indolent lymphomas, diffuse large B cell lymphomas and Multiple Myeloma. In the clinical trials, dacetuzumab was administered intravenously at weekly doses ranging from 2 mg/kg to 16 mg/kg. In the vaccine-based immunotherapy regimen provided by the present disclosure, dacetuzumab can be administered intradermally, subcutaneously, or topically. It is preferred that it is administered intradermally. The effective amount of dacetuzumab to be administered in the vaccine-based immunotherapy regimen is generally below 16 mg/kg, typically in the range of 0.2 mg - 14 mg/kg, or 0.5 -8 mg/kg, or 1 - 5 mg/kg.
CTLA-4 Inhibitors.
Suitable anti-CTLA-4 antagonist agents for use in the vaccine-based immunotherapy regimen provided by the disclosure include, without limitation, anti- CTLA-4 antibodies (such as human anti-CTLA-4 antibodies, mouse anti-CTLA-4 antibodies, mammalian anti-CTLA-4 antibodies, humanized anti-CTLA-4 antibodies, monoclonal anti-CTLA-4 antibodies, polyclonal anti-CTLA-4 antibodies, chimeric anti- CTLA-4 antibodies, anti-CTLA-4 domain antibodies), fragments of anti-CTLA-4 antibodies (such as (single chain anti-CTLA-4 fragments, heavy chain anti-CTLA-4 fragments, and light chain anti-CTLA-4 fragments), and inhibitors of CTLA-4 that agonize the co-stimulatory pathway. In some embodiments, the CTLA-4 inhibitor is Ipilimumab or Tremelimumab.
Ipilimumab (also known as MEX-010 or MDX-101 ), marketed as YERVOY, is a human anti-human CTLA-4 antibody. Ipilimumab can also be referred to by its CAS Registry No. 477202-00-9, and is disclosed as antibody 10DI in PCT Publication No. WO01 /14424, which is incorporated herein by reference in its entirety. Examples of pharmaceutical composition comprising Ipilimumab are provided in PCT Publication No. WO2007/67959. Ipilimumab is approved in the U.S. for the treatment of unresectable or metastatic melanoma. The recommended dose of Ipilimumab as monotherapy is 3 mg/kg by intravenous administration every 3 weeks for a total of 4 doses. In the methods provided by the present invention, Ipilimumab is administered locally, particularly intradermally or subcutaneously. The effective amount of Ipilimumab administered locally is typically in the range of 5 - 200 mg/dose per person. In some embodiments, the effective amount of Ipilimumab is in the range of 1 0 - 150 mg/dose per person per dose. In some particular embodiments, the effective amount of Ipilimumab is about 10, 25, 50, 75, 100, 125, 150, 175, or 200 mg/dose per person.
Tremelimumab (also known as CP-675,206) is a fully human lgG2 monoclonal antibody and has the CAS number 745013-59-6. Tremelimumab is disclosed as antibody 1 1 .2.1 in U.S. Patent No: 6,682,736, incorporated herein by reference in its entirety and for all purposes. The amino acid sequences of the heavy chain and light chain of Tremelimumab are set forth in SEQ IND NOs:42 and 43, respectively. Tremelimumab has been investigated in clinical trials for the treatment of various tumors, including melanoma and breast cancer; in which Tremelimumab was administered intravenously either as single dose or multiple doses every 4 or 12 weeks at the dose range of 0.01 and 15 mg/kg. In the regimens provided by the present invention, Tremelimumab is administered locally, particularly intradermally or subcutaneously. The effective amount of Tremelimumab administered intradermally or subcutaneously is typically in the range of 5 - 200 mg/dose per person. In some embodiments, the effective amount of Tremelimumab is in the range of 10 -150 mg/dose per person per dose. In some particular embodiments, the effective amount of Tremelimumab is about 10, 25, 37.5, 40, 50, 75, 100, 125, 150, 175, or 200 mg/dose per person.
Toll-like Receptor (TLR) Agonists.
The term "toll-like receptor agonist" or "TLR agonist" refers to a compound that acts as an agonist of a toll-like receptor (TLR). This includes agonists of TLR1 , TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, and TLR1 1 or a combination thereof. Unless otherwise indicated, reference to a TLR agonist compound can include the compound in any pharmaceutically acceptable form, including any isomer (e.g., diastereomer or enantiomer), salt, solvate, polymorph, and the like. In particular, if a compound is optically active, reference to the compound can include each of the compound's enantiomers as well as racemic mixtures of the enantiomers. Also, a compound may be identified as an agonist of one or more particular TLRs (e.g., a TLR7 agonist, a TLR8 agonist, or a TLR7/8 agonist).
In some embodiments, the TLR agonists are TLR9 agonists, particularly CpG oligonucleotides (or CpG.ODN). A CpG oligonucleotide is a short nucleic acid molecule containing a cytosine followed by a guanine linked by a phosphate bond in which the pyrimidine ring of the cytosine is unmethylated. A CpG motif is a pattern of bases that include an unmethylated central CpG surrounded by at least one base flanking (on the 3' and the 5' side of) the central CpG. CpG oligonucleotides include both D and K oligonucleotides. The entire CpG oligonucleotide can be unmethylated or portions may be unmethylated. Examples of CpG oligonucleotides useful in the methods provided by the present disclosure include those disclosed in U.S. Patent Nos. 61 94388, 6207646, 6214806, 628371 , 62391 16, and 6339068.
Examples of particular CpG oligonucleotides useful in the methods provided by the present disclosure include:
5' TCGTCGTTTTGTCGTTTTGTCGTT3' (CpG 7909);
5' TCGTCGTTTTTCGGTGCTTTT3' (CpG 24555); and
5' TCGTCGTTTTTCGGTCGTTTT3' (CpG 10103) .
CpG7909, a synthetic 24mer single stranded oligonucleotide, has been extensively investigated for the treatment of cancer as a monotherapy and in combination with chemotherapeutic agents, as well as an adjuvant for vaccines against cancer and infectious diseases. It was reported that a single intravenous dose of CpG 7909 was well tolerated with no clinical effects and no significant toxicity up to 1 .05 mg/kg, while a single dose subcutaneous CpG 7909 had a maximum tolerated dose (MTD) of 0.45 mg/kg with dose limiting toxicity of myalgia and constitutional effects. [See Zent, Clive S, et al: Phase I clinical trial of CpG 7909 (PF-03512676) in patients with previously treated chronic lymphocytic leukemia. Leukemia and Lymphoma, 53(2):21 1 -217(7)(2012)]. In the regimens provided by the present disclosure, CpG7909 may be administered by injection into the muscle or by any other suitable methods. It is preferred that it is administered locally in proximity to the vaccine draining lymph node, particularly by intradermal or subcutaneous administration. For use with a nucleic acid vaccine, such as a DNA vaccine, a CpG may be preferably co-formulated with the vaccine in a single formulation and administered by intramuscular injection coupled with electroporation. The effective amount of CpG7909 by intramuscular, intradermal, or subcutaneous administration is typically in the range of 10 μg/dose - 10 mg/dose. In some embodiments, the effective amount of CpG7909 is in the range of 0.05 mg - 14 mg/dose. In some particular embodiments, the effective amount of CpG7909 is about 0.05, 0.1 , 0.2, 0.3, 0.4, 0.5, 05 1 mg/dose. Other CpG oligonucleotides, including CpG 24555 and CpG 10103, may be administered in similar manner and dose levels.
In some particular embodiments, the present disclosure provides a method of enhancing the immunogenicity or therapeutic effect of a vaccine for the treatment of a neoplastic disorder in a human, comprising administering the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib, erlotinib, gefitinib, axitinib, bosutinib, temsirolismus, or nilotinib and wherein the at least one lEC enhancer is selected from a CTLA-4 inhibitor, a TLR agonist, or a CD40 agonist. In some preferred embodiments, regimen comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from axitinib, sorafenib tosylate, or sunitinib malate and wherein the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab. In some further preferred embodiments, the regimen comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least two lEC enhancers, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sunitinib or axitinib and wherein the at least two lEC enhancers are Tremelimumab and a TLR agonist selected from CpG7909, CpG2455, or CpG10103.
In some other embodiments, the present disclosure provides a method of treating prostate cancer in a human, comprising administering to the human (1 ) an effective amount of a vaccine capable of eliciting an immune response against a human PAA, (2) an effective amount of at least one ISC inhibitor, and (3) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, axitinib, erlotinib, gefitinib, axitinib, bosutinib, temsirolismus, or nilotinib, and wherein the at least one lEC enhancer is selected from a CTLA-4 inhibitor, a TLR agonist, or a CD40 agonist. In some preferred embodiments, the method comprises administering to the human (1 ) an effective amount of a vaccine capable of eliciting an immune response against a human PAA, (2) an effective amount of at least one ISC inhibitor, and (3) an effective amount of at least one lEC enhancer, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sorafenib tosylate, sunitinib malate, or axitinib and wherein the at least one lEC enhancer is a CTLA-4 inhibitor selected from Ipilimumab or Tremelimumab.
In some further specific embodiments, the method comprises administering to the human (1 ) an effective amount of at least one ISC inhibitor and (2) an effective amount of at least two lEC enhancers, wherein the at least one ISC inhibitor is a protein kinase inhibitor selected from sunitinib or axitinib and wherein the at least two IEC enhancers are Tremelimumab and a TLR agonist selected from CpG7909, CpG2455, or CpG10103.
Additional therapeutic agents.
The vaccine-based immunotherapy regimen provided by the present disclosure may further comprise an additional therapeutic agent. A wide variety of cancer therapeutic agents may be used, including chemotherapeutic agents and hormone therapeutic agents. The term "chemotherapeutic agent" refers to a chemical or biological substance that can cause death of cancer cells, or interfere with growth, division, repair, and/or function of cancer cells. Examples of particular chemotherapeutic agents include: abiraterone acetate, cabazitaxel, degarelix, denosumab, docetaxel, enzalutamide, leuprolide acetate, prednisone, sipuleucel-T, and radium 223 dichloride. The term "hormone therapeutic agent" refers to a chemical or biological substance that inhibits or eliminates the production of a hormone, or inhibits or counteracts the effect of a hormone on the growth and/or survival of cancer cells. Examples of particular hormone therapeutic agents include leuprolide, goserelin, triptorelin, histrelin, bicalutamide, flutamide, and nilutamide. The VBIR provided by this disclosure may also be used in combination with other therapies, including (1 ) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland, and (2) radiation treatment, in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
E. EXAMPLES
The following examples are provided to illustrate certain embodiments of the invention. They should not be construed to limit the scope of the invention in any way. From the above discussion and these examples, one skilled in the art can ascertain the essential characteristics of the invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usage and conditions.
EXAMPLE 1 . ANTIGENS IN CYTOSOLIC, SECRETED, AND MEMBRANE- BOUND FORMATS DERIVED FROM THE HUMAN PSMA PROTEIN
1A. Design of Immunogenic PSMA Polypeptides DNA constructs encoding immunogenic PSMA polypeptides in cytosolic, secreted, and modified formats were constructed based on the native human PSMA protein sequence and tested for their ability to induce anti-tumor effector immune responses. The structure and preparation of each of the human PSMA antigen formats are provided as follows.
1A 1. Human PSMA cytosolic antigen. An immunogenic PSMA polypeptide in cytosolic form was designed to retain the immunogenic polypeptide inside the cell once it is expressed. The cytoplasmic domain (amino acids 1 -19) and the transmembrane domain (amino acids 20-43) of the human PSMA were removed, resulting in a cytosolic PSMA polypeptide that consists of amino acids 44-750 (extracellular domain or ECD) of the human PSMA of SEQ ID NO: 1 . The optimal Kozak sequence "MAS" may be added to the N-terminus of the polypeptide for enhancing the expression or to facilitate cloning.
1A2. Human PSMA secreted antigen. An immunogenic PSMA polypeptide in secreted form was designed to secret the polypeptide outside of the cell once it is expressed. The secreted polypeptide is made with amino acids 44-750 (ECD) of the human PSMA of SEQ ID NO:1 and the Ig Kappa secretory element that has the amino acid sequence ETDTLLLWVLLLWVPGSTGD and a two-amino acid linker (AA) in the N- terminal in order to maximize the secretion of the PSMA antigen once it is expressed.
1A3. Human PSMA membrane-bound antigen. An immunogenic PSMA membrane-bound polypeptide was designed to stabilize the polypeptide on the cell surface. The first 14 amino acids of the human PSMA protein were removed and the resultant immunogenic polypeptide consists of amino acids 15 - 750 of the human PSMA protein of SEQ ID NO:1 . The immunogenic polypeptide that consists of amino acids 15 - 750 of the native human PSMA protein of SES ID NO: 1 and share 100% sequence identity with the native human PSMA protein is also referred to as "human PSMA modified," "hPSMA modified," or "hPSMAmod" antigen in the present disclosure. The following three immunogenic PSMA polypeptides (referred to as "shuffled PSMA modified antigens") that are variants of the human PSMA modified antigen (SEQ ID NO:9) were also generated:
(1 ) shuffled PSMA modified antigen 1 having the amino acid sequence of SEQ ID
NO:3;
(2) shuffled PSMA modified antigen 2 having the amino acid sequence of SEQ ID NO:5; and (3) shuffled PSMA modified antigen 3 having the amino acid sequence of SEQ ID
NO:7.
The nucleodie sequences encoding the shuffled PSMA modified antigens 1 , 2, and 3 are set forth in SEQ ID NOs: 4, 6, and 8, respectively.
IB. Preparation of DNA Plasmids for Expressing the PSMA antigens
DNA constructs encoding the PSMA cytosolic, PSMA secreted, and PSMA modified antigens were cloned individually into PJV7563 vector that was suitable for in vivo testing in animals (Figure 1 ). Both strands of the DNA in the PJV7563 vectors were sequenced to confirm the design integrity.
A large scale plasmid DNA preparation (Qiagen/CsCI) was produced from a sequence confirmed clone. The quality of the plasmid DNA was confirmed by high 260/280 ratio, high super coiled/nicked DNA ratio, low endotoxin levels (< 10U/mg DNA) and negative bio burden.
IC. Expression of PSMA constructs in mammalian cells
The expression of the PSMA cytosolic, secreted, and modified antigens was determined by FACS. Mammalian 293 cells were transfected with the PJV7563 PMED vectors encoding the various immunogenic PSMA polypeptides. Three days later, the 293 cells were stained with mouse anti-PSMA antibody, followed with a fluorescent conjugated (FITC) rat anti-mouse secondary antibody. The results are presented tin Table 2. The data were reported as mean fluorescent intensity (MFI) over negative controls, confirmed that human PSMA modified antigen is expressed on the cell surface.
Table 2. Expression of Human PSMA Modified antigen on Cell Surface
Figure imgf000041_0001
EXAMPLE 2. DESIGN OF VARIOUS IMMUNOGENIC PSA POLYPEPTIDES 3A. Construction of Immunogenic PSA Polypeptides
Similar to what was described in Example 1 for the three different immunogenic PSMA polypeptide forms (e.g., the cytosolic, membrane-bound, and secreted forms), immunogenic PSA polypeptides in the three forms were also designed based on the human PSA sequence. An immunogenic PSA polypeptide in cytosolic form, which consists of amino acids 25-261 of the native human PSA, is constructed by deleting the secretory signal and the pro domain (amino acids 1 -24). The amino acid sequence of this cytosolic immunogenic PSA polypeptide is provided in SEQ ID NO: 17. The secreted form of the PSA polypeptide is the native full length human PSA (amino acids 1 -261 ). An immunogenic PSA polypeptide in membrane-bound form is constructed by linking the immunogenic PSA polypeptide cytosolic form (amino acids 25-261 of the native human PSA) to the human PSMA transmembrane domain (amino acids 15-54 of the human PSMA).
3B. Immune responses in Pasteur and HLA A24 mice
Study design. Eight to 10 week old HLA A2 Pasteur mice or HLA A24 mice were immunized with DNA expressing the various PSA antigens using PMED provided in Example 3A in a prime/boost/boost regimen with two week intervals between each vaccination as described in Example 1 . The antigen specific T and B cell responses were measured 7 days after the last immunization in an interferon-gamma (IFNy) ELISPOT assay and sandwich ELISA.
ELISpot data shown in Table 3 indicates that immunogenic PSA polypeptides in both cytosolic and membrane-bound forms are capable of inducing T cells that recognize human tumor cells transduced with adenovirus to express the cytosolic PSA antigen (SKmel5-Ad-PSA) but not cells transduced with adenovirus to express eGFP (SKmel5-Ad-eGFP). These two antigens also elicited response to PSA protein. The PSA secreted antigen failed to induce T cells to both SKmel5-Ad-PSA or PSA protein. SFC>50 is considered positive.
Table 3. The induction of T cell responses by PSA antigens in Pasteur mice to PSA+ HLA A2.1 + SKmel5 human cancer cells
HLA A2.1 + human IFN-Y SFC/1x10° splenocytes (SD)
cancer cells or PSA membrane-
PSA cytosolic PSA secreted protein bound
SKmel5-Ad-eGFP 7.7 (9.6) 1 .2 (1 .4) 2.9 (2.7)
SKmel5-Ad-PSA 1 12.0 (169.3) 546.1 (379.6) 18.7 (18.5)
PSA protein 108.8 (161 .0) 536.9 (380.9) 20.6 (21 ) Table 4. The induction of anti-PSA antibody response
as measured by a sandwich ELISA assay
Figure imgf000043_0001
Data in Table 4 demonstrates that immunogenic PSA polypeptides in both secreted and membrane-bound forms are capable of inducing anti-PSA antibody responses.
EXAMPLE 3. CONSTRUCTION OF MULTI-ANTIGEN VACCINE CONSTRUCTS
In this Example, constructions of plasmids comprising a multi-antigen construct using different strategies are described. These plasmids share the same general plasmid backbone as pPJV7563. Unless otherwise specified, the genes included in the multi-antigen constructs encode (1 ) an immunogenic PSMA polypeptide of SEQ ID NO:9, (2) an immunogenic PSCA polypeptide comprising amino acids 2-125 of SEQ ID NO:21 , and (3) an immunogenic PSA polypeptide of SEQ ID NO:17.
EXAMPLE 3A. PLASMIDS COMPRISING A DUAL ANTIGEN CONSTRUCT
3A 1. Construction of Plasmid utilizing multiple promoters
Plasmid 460 (PSMA/PSCA Dual promoter). Plasmid 460 was constructed using the techniques of site-directed mutagenesis, PCR, and restriction fragment insertion. First, a Kpn I restriction site was introduced upstream of the CMV promoter in plasmid 5259 using site-directed mutagenesis with MD5 and MD6 primers according to manufacturer's protocol (Quickchange kit, Agilent Technologies, Santa Clara, CA). Second, an expression cassette consisting of a minimal CMV promoter, human PSMA, and rabbit B globulin transcription terminator was amplified by PCR from plasmid 5166 using primers that carried Kpn I restriction sites (MD7 and MD8). The PCR amplicon was digested with Kpn I and inserted into the newly introduced Kpn I site of calf intestinal alkaline phosphatase (CIP)- treated plasmid 5259.
3A2. Construction of dual antigen constructs utilizing 2A peptides Plasmid 451 (PSMA-T2A-PSCA). Plasmid 451 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding human PSMA amino acids 15-750 was amplified by PCR using plasmid 5166 as a template with primers 1 19 and 1 17. The gene encoding full-length human PSCA was amplified by PCR using plasmid 5259 as a template with primers 1 18 and 120. PCR resulted in the addition of overlapping TAV 2A (T2A) sequences at the 3' end of PSMA and 5' end of PSCA. The amplicons were mixed together and amplified by PCR with primers 1 19 and 120. The PSMA-T2A-PSCA amplicon was digested with Nhe I and Bgl II and inserted into similarly digested plasmid 5166. A glycine-serine linker was included between PSMA and the T2A cassette to promote high cleavage efficiency.
Plasmid 454 (PSCA-F2A-PSMA). Plasmid 454 was created using the techniques of PCR and restriction fragment exchange. First, the gene encoding full-length human PSCA was amplified by PCR using plasmid 5259 as a template with primers 42 and 132. The amplicon was digested with BamH I and inserted into similarly digested, CIP-treated plasmid 5300. A glycine-serine linker was included between PSCA and the FMDV 2A (F2A) cassette to promote high cleavage efficiency.
Plasmid 5300 (PSA-F2A-PSMA) Plasmid 5300 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers MD1 and MD2. The gene encoding human PSMA amino acids 15-750 was amplified by PCR from plasmid 5166 with primers MD3 and MD4. PCR resulted in the addition of overlapping F2A sequences at the 3' end of PSA and 5' end of PSMA. The amplicons were mixed together and extended by PCR. The PSA-F2A-PSMA amplicon was digested with Nhe I and Bgl II and inserted into similarly digested plasmid pPJV7563.
3A3. Dual antigen constructs utilizing internal ribosomal entry sites
Plasmid 449 (PSMA-mlRES-PSCA). Plasmid 449 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding full length human PSCA was amplified by PCR from plasmid 5259 with primers 124 and 123. The minimal EMCV IRES was amplified by PCR from pShuttle- IRES with primers 101 and 125. The overlapping amplicons were mixed together and amplified by PCR with primers 101 and 123. The IRES-PSCA amplicon was digested with Bgl II and BamH I and inserted into Bgl ll-digested, CIP-treated plasmid 5166. In order to fix a spontaneous mutation within the IRES, the IRES containing Avr II to Kpn I sequence was replaced with an equivalent fragment from pShuttle-IRES.
Plasmid 603 (PSCA-plRES-PSMA). Plasmid 603 was constructed using the techniques of PCR and seamless cloning. The gene encoding full length human PSCA attached at its 3'end to a preferred EMCV IRES was amplified from plasmid 455 by PCR with primers SD546 and SD547. The gene encoding human PSMA amino acids 15-750 was amplified by PCR from plasmid 5166 using primers SD548 and SD550. The two overlapping PCR amplicons were inserted into Nhe I and Bgl ll-digested pPJV7563 by seamless cloning according to manufacturer's instructions (Invitrogen, Carlsbad, CA).
Plasmid 455 (PSCA-mlRES-PSA). Plasmid 455 was constructed using the techniques of overlapping PCR and restriction fragment exchange. First, the gene encoding human PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers 1 15 and 1 14. The minimal EMCV IRES was amplified by PCR from pShuttle-IRES with primers 101 and 1 16. The overlapping amplicons were mixed together and amplified by PCR with primers 101 and 1 14. The IRES-PSA amplicon was digested with Bgl II and BamH I and inserted into Bgl ll-digested, CIP-treated plasmid 5259. In order to fix a spontaneous mutation within this clone, the Bgl II to BstE II sequence was replaced with an equivalent fragment from a fresh overlapping PCR reaction.
EXAMPLE 3B. PLASMIDS COMPRISING A TRIPLE ANTIGEN CONSTRUCT
General Strategy. A number of dual antigen plasmids, including PSA-F2A-PSMA, PSMA-mlRES-PSCA, PSMA-T2A-PSCA, PSA-T2A-PSCA, PSCA-F2A-PSMA, PSCA- plRES-PSMA, and PSMA-mlRES-PSA, were selected for incorporation in various combinations into triple antigen plasmid vectors. In all cases, the plasmid vectors were based on the parental pPJV7563 plasmid backbone. Four plasmid vectors (plasmids 456, 457, 458, and 459) utilized a single full CMV promoter with a rabbit B globulin transcription terminator to drive expression of all three antigens. Two other plasmid vectors (plasmids 846 and 850) incorporated a dual promoter strategy in combination with either an IRES or 2A to drive expression of the three antigens. Plasmids with multiple 2A cassettes were engineered to carry different cassettes to minimize the likelihood of recombination between the first and second cassette during plasmid/vector amplification. Antigen expression was demonstrated by flow cytometry (FIGS. 7A and 7B) and western blotting (FIGS. 8A and 8B). Plasmid 456 (PSA-F2A-PSMA-mlRES-PSCA). Plasmid 456 was constructed by restriction fragment exchange. Plasmid 5300 was digested with Nhe I and Hpa I and the ~1 .8 kb insert was ligated into similarly digested plasmid 449.
Plasmid 457 (PSA-F2A-PSMA-T2A-PSCA). Plasmid 457 was constructed by restriction fragment exchange. Plasmid 5300 was digested with Nhe I and Hpa I and the ~1 .8 kb insert was ligated into similarly digested plasmid 451 .
Plasmid 458 (PSA-T2A-PSCA-F2A-PSMA). Plasmid 458 was constructed using the techniques of PCR and restriction fragment exchange. The gene encoding human PSA amino acids 25-261 was amplified by PCR from plasmid 5297 with primers 1 19 and 139, resulting in the addition of a T2A sequence and Nhe I restriction site at the 3' end. The amplicon was digested with Nhe I and inserted into similarly digested plasmid 454.
Plasmid 459 (PSCA-F2A-PSMA-mlRES-PSA). Plasmid 459 was constructed by restriction fragment exchange. Plasmid 454 was digested with Nhe I and Bgl II and the PSCA-F2A-PSMA containing insert was ligated into similarly digested plasmid 455.
Plasmid 846 (CBA-PSA, CMV-PSCA-plRES-PSMA). Plasmid 846 was constructed using the techniques of PCR and seamless cloning. First, an expression cassette was synthesized that consisted of 1 ) the promoter and 5' untranslated region from the chicken beta actin (CBA) gene, 2) a hybrid chicken beta actin / rabbit beta globin intron, 3) the gene encoding human PSA amino acids 25-261 , and 4) the bovine growth hormone terminator. This PSA expression cassette was amplified by PCR from plasmid 796 with primers 3SallCBA and 5SallBGH. The amplicon was cloned into the Sail site of plasmid 603 using a GeneArt Seamless Cloning and Assembly Kit (Invitrogen, Carlsbad, CA). Upon delivery of this plasmid into a cell, PSA expression will be driven off the CBA promoter while PSCA and PSMA expression will be driven off the CMV promoter.
Plasmid 850 (CBA-PSA, CMV-PSCA-F2A-PSMA). Plasmid 850 was constructed using the techniques of PCR and seamless cloning. First, the CBA promoter-driven PSA expression cassette was amplified by PCR from plasmid 796 with primers 3SallCBA and 5SallBGH. The amplicon was cloned into the Sail site of plasmid 454 using GeneArt Seamless Cloning. Upon delivery of this plasmid into a cell, PSA expression will be driven off the CBA promoter while PSCA and PSMA expression will be driven off the CMV promoter. Plasmid 916 ( (PSA - T2A-PSCA-F2A -PSMA ). Plasmid 916 was constructed using the techniques of PCR and Gibson cloning. The genes encoding the three PAA polypeptides were amplified by PCR and ligated into the Nhe I / Bgl II sites of pPJV7563 by Gibson cloning techniques. The complete nucleotide sequence of Plasmid 916 is set forth in SEQ ID NO:62. Plasmid 458 and Plasmid 916 encode the same amino acid sequence that comprises the three immunogenic PAA polypeptides, which amino acid sequence is set forth in SEQ ID NO:60. The nucleotide sequence in Plasmid 916 that encodes the amino acid sequence comprising the three PAA polypeptides is codon- optimized and is also set forth in SEQ ID NO:61 .
Table 21 . List of Primers Used in the Construction of the Multi-antigen Plasmids
Primer Sequence (5' to 3') Strand
42 CGTTGACGCAAATGGGCGGTAGG Sense
101 TCAGAGATCTGACCCCCTAACGTTACTGGC Sense
1 14 TATAGGATCCTCAGGGGTTGGCCACGATG Antisense
GAAAAACACGATGATAATATGGCCAGCATTGTGGGAG
1 15 Sense
GCTGGGAGTG
CC AC AATG CTG G CC ATATT ATC ATCGTGTTTTTC A AAG
1 16 Antisense
GAAAACCACGTCC
CATCTCCACAGGTCAATAATGAACCCCTACCTTCGGAT
1 17 Antisense
CCGGCTACTTCACTCAAAGTC
GTTCATTATTGACCTGTGGAGATGTCGAAGAAAACCCA
1 18 Sense
GGACCCGCAAGCAAGGCTGTGCTGCTTGCCCTG
1 19 TTGCCTCTCACATCTCGTCAATCTCCGCGAGGAC Sense
120 GATCTTTTGTACAATATGATCTTGTGGCAATGTCCC Antisense
123 TATAGGATCCCTATAGCTGGCCGGGTCC Antisense
CACGATGATAATATGGCCAGCAAGGCTGTGCTGCTTG
124 Sense
CC
C AC AG CCTTG CTG G CC AT ATT ATC ATCGTGTTTTTC AAA
125 Antisense
GGAAAACCACGTCC
132 TATAGGATCCTAGCTGGCCGGGTCCCCAGAG Antisense
ATATGCTAGCGGGTCCTGGGTTTTCTTCGACATCTCCA
139 Antisense
CAGGTCAATAATGAACCCCTACCTTCGGATCCGGGG TTGGCCACGATGGTGTCC
SD546 CTGTGACGAACATGGCTAGCAAGG Sense
SD547 ATTATCATCGTGTTTTTCAAAGGAAAACC Antisense
AAACACGATGATAATATGGCCACAACCATGGCGCGCC
SD548 Sense
GCCCGC
SD550 TTTTGTTAGGGCCCAGATCTTTAGGC Antisense
MD1 GACGAACATGGCTAGCATTGTGGGAGGCTG Sense
CCACATCGCCTGCCAGTTTCAGCAGATCAAAGTTCAGG
MD2 Antisense
GTCTGGGATCCGGGGTTGGCCACGATGGTGTC
GATCTGCTGAAACTGGCAGGCGATGTGGAAAGCAACC
MD3 Sense
CAGGCCCAATGGCAAGCGCGCGCCGCCCGCGCTG
MD4 GTTAGGGCCCAGATCTTTAGGCTACTTCACTCAAAGTC Antisense
CTTGTATTACTGTTTATGTAAGCAGACAGGGTACCAAT
MD5 Sense
ATTG G CTATTG G CC ATTG C ATAC
GT ATG C AATG G CC AATAG CC AAT ATTG GTACCCTGTCT
MD6 Antisense
G CTT AC AT AA AC AGT AAT AC AAG
CATGCATGGGTACCAATCTTCCGAGTGAGAGACACAAA
MD7 Sense
AAATTCC
GATCGATCGGTACCCTGCAGGTCGAGCACCAAAATCA
MD8 Antisense
ACGGG
5SallB GTTTATGTAAGCAGACAGGTCGACCCATAGAGCCCAC
Antisense GH CGCATCCCCAGC
3SallC TGGCCAATAGCCAATATTGTCGACTGGGTCGAGGTGA
Sense
BA GCCCCACGTTCTG
EXAMPLE 3C. TRIPLE ANTIGEN ADENOVIRUS VECTORS General Strategy. As with DNA plasmids, viral vectors can be engineered to deliver multiple prostate cancer antigens. The three multi-antigen expression strategies described above for multi-antigen constructs - dual promoters, 2A peptides, and internal ribosome entry sites - were incorporated in various combinations to create triple antigen adenovirus vectors. Briefly, the multi-antigen expression cassettes were cloned into a pShuttle-CMV plasmid modified to carry two copies of the tetracycline operator sequence (TetO2). Recombinant adenovirus serotype 5 vectors were created using the AdEasy Vector System according to manufacturer's protocols (Agilent Technologies, Inc., Santa Clara, CA). Viruses were amplified in HEK293 cells and purified by double cesium chloride banding according to standard protocols. Prior to in vivo studies, viral stocks were thoroughly characterized for viral particle concentration, infectivity titer, sterility, endotoxin, genomic and transgene integrity, transgene identity and expression.
Adenovirus-733 (PSA-F2A-PSMA-T2A-PSCA). Ad-733 is the viral equivalent of plasmid 457. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include two different 2A sequences.
Adenovirus-734 (PSA-T2A-PSCA-F2A-PSMA). Ad-734 is the viral equivalent of plasmid 458. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include two different 2A sequences.
Adenovirus-735 (PSCA-F2A-PSMA-mlRES-PSA). Ad-735 is the viral equivalent of plasmid 459. Expression of the three antigens is driven off a single CMV promoter with a tetracycline operator for repressing transgene expression during large scale production in Tet repressor expressing HEK293 lines. Multi-antigen expression strategies include a 2A sequence and an IRES.
Adenovirus-796 (CBA-PSA, CMV-PSCA-plRES-PSMA). Ad-796 is the viral equivalent of plasmid 846. Expression of PSA is driven off the chicken beta actin promoter while PSCA and PSMA expression is driven off the CMV-TetO2 promoter. Multi-antigen expression strategies include two promoters and an IRES.
Adenovirus-809 (CBA-PSA, CMV-PSCA-F2A-PSMA). Ad-809 is the viral equivalent of plasmid 850. Expression of PSA is driven off the chicken beta actin promoter while PSCA and PSMA expression is driven off the CMV-TetO2 promoter. Multi-antigen expression strategies include two promoters and a 2A sequence.
EXAMPLE 4. ANTI-CANCER EFFICACY OF VACCINE IN COMBINATION
WITH SUNITINIB AND ANTI-CTLA-4 ANTIBODY The anti-tumor efficacy of a cancer vaccine in combination with sunitinib and anti- CTLA-4 monoclonal antibody (clone 9D9) was investigated in subcutaneous TUBO tumor bearing BALB/neuT mice.
Study Procedure. Briefly, ten mice per each group were daily orally dosed with either vehicle or sunitinib malate at 20 mg/kg starting at day 10 post tumor implant until day 64. Vaccination with DNA constructs that either encode no antigen (control vaccine) or a rat Her-2 antigen of SEQ Id NO: 54 (cancer vaccine) as adenovirus vectors initiated on day 13 subsequently followed by two weekly immunizations, two biweekly immunizations, and seven weekly immunizations of respective antigens (HBV antigens or rHer-2) by DNA. The groups of mice (closed circle and open triangle) that were treated with anti-murine CTLA-4 monoclonal antibody were intraperitoneal^ injected with 250 μg of the antibody on day 20, 27, 41 , 55, 62, 69, 76, 83, 90, and 97 right after the PMED injections.
Results. Figure 4 shows the Kaplan-Meier survival curve of the groups of mice from a representative study evaluating the anti-tumor efficacy of sunitinib and anti- murine CTLA-4 monoclonal antibody (clone 9D9) in combination with a cancer vaccine. Increased survival time was observed in mice treated with Sutent with control vaccine (open circle), anti-murine CTLA-4 monoclonal antibody (open triangle) or cancer vaccine (closed triangle). A further increase of survival was observed in mice treated with Sutent and cancer vaccine in combination with anti-murine CTLA-4 (closed circle). P values were calculated by log-rank test.
EXAMPLE 5. EFFECT OF CPG OR CD40 AGONIST ON THE IMMUNE RESPONSES INDUCED BY CANCER VACCINE
Immunogenicity Studies in BALB/c Mice
The effect of local administration of immune modulators on the magnitude and quality of antigen specific immune responses induced by a cancer was investigated in BALB/c mice, in which the immune response was assessed by measuring rHER2 specific T cell responses using the IFNy ELISPOT assay or intracellular cytokine staining assay. Briefly, 4 to 6 female BALB/c mice per group as indicated were immunized with DNA plasmid expression constructs encoding rHER2 antigen sequences (SEQ ID NO:54) by PMED delivery system. The immune modulators, CpG7909 (PF-03512676) and anti-CD40 monoclonal agonistic antibody, were administered locally by intradermal injections in proximity to the vaccine draining inguinal lymph node subsequently after the PMED actuations. Antigen specific T cell responses were measured by IFNy ELISPOT or intracellular cytokine staining assay according to the procedure described below.
Intracellular Cytokine Staining (ICS) Assay
The rHer-2 specific polyfunctional (multi-cytokine positive) T cell immune responses were measured from splenocytes or PBMCs isolated from individual animals by ICS assay. Typically 1 e6 splenocytes were incubated with Brefeldin A at 1 μg/ml and peptide stimulant (rHer-2 specific CD8 p66, rHer-2 specific CD4 p169 or irrelevant HBV p87) at 10 μg/ml for 5hr at 37°C in a 5% CO2 incubator. After the stimulation, the splenocytes were washed and blocked with FcD block (anti-mouse CD16/CD32) for 10 min. at 4°C followed by a 20min staining with Live/dead aqua stain, anti-mouse CD3ePE-Cy7, anti-mouse CD8a Pacific blue, and anti-mouse CD45R/B220 PerCP- Cy5.5. The cells were washed, fixed with 4% paraformaldehyde overnight at 4°C, permeabilized with BD fix/perm solution for 30 min at RT and incubated with anti-mouse IFNy APC, anti-mouse TNFD Alexa488 and anti-mouse IL-2 PE for 30 min at RT. The cells were washed and 20,000 CD4 or CD8 T cells were acquired for analysis by flow cytometry. The total number of antigen specific single, double or triple cytokine positive T cells per total spleen of each animal is calculated by subtracting the rHer-2 specific responses to the irrelevant peptide HBV from the vaccine specific responses and normalized to the total number of splenocytes isolated from the spleen.
IFNy ELISPOT Assay Results
Figure 5 shows the IFNy ELISPOT results from groups of mice from a representative study evaluating the magnitude of antigen specific T cell responses induced by the rHER2 vaccine when given with the immune modulators as indicated. Briefly, each mouse per treatment group (n=4) was immunized with DNA plasmid expression constructs encoding rHER2 antigen sequences (SEQ ID NO:54) by PMED immediately followed by either 100ug of control rat IgG monoclonal antibody (Bioxcell #BE0089: control mAb) or 50Dg CpG7909 or 100ug of anti-CD40 monoclonal antibody (Bioxcell #BE0016-2: a-CD40 mAb) as indicated. The antigen specific immune responses were measured by IFNy ELISPOT assay from 5e5 splenocytes mixed with control or rHer-2 specific p66 peptides at 1 0μg/ml concentration, 7 days after the PMED actuation. The number of total IFNy secreting cells from splenocytes containing1 e5 CD8 T cells was calculated from the ELISPOT results from individual animals and the % of CD8 T cells in splenocytes and mean and standard error of mean of each group are plotted. As shown, both CpG7909 and the anti-CD40 monoclonal antibody significantly enhanced the magnitude of antigen specific immune responses induced by rHer-2 DNA compared to mice that received control antibodies.
Intracellular Cytokine Staining (ICS) Assay Results. Figures 6 and 7 show the results of a representative study that evaluates the immunomodulatory activity of CpG 7909 on the quality of the vaccine induced immune responses by intracellular cytokine staining assay. Briefly, each animal was immunized twice with the DNA plasmid expression constructs encoding rHER2 antigen sequences (SEQ ID NO:54) delivered by PMED with a 4-week interval. The mice in each group (n=5) were given intradermal injections of either PBS (PMED group) or 50Dg of CpG 7909 (PMED+CpG group) in proximity to the right side vaccine draining inguinal node immediately following both DNA immunizations by PMED. Seven days after the last immunization by PMED, an ICS assay was performed on the splenocytes isolated from each individual mice to detect antigen specific polyfunctional CD8 or CD4 T cells that secrete IFNy, TNFD and/ or IL-2. A significant increase in rHer-2 specific multi-cytokine positive CD8 and CD4 T cell responses were detected from mice treated with the local delivery of CpG 7909 compared to PBS. An increase in the single cytokine positive CD8 population was observed in the animals that received local delivery of CpG7909 administration compared to PBS.
Figures 8 and 9 show the results of a representative study that evaluates the immunomodulatory activity of an agonistic anti-CD40 monoclonal antibody on the quality of the vaccine induced immune responses by intracellular cytokine staining assay. Briefly, each animal was immunized twice by DNA plasmid expression constructs encoding rHER2 antigen sequences (SEQ ID NO:54) delivered by PMED with a 4week interval. The mice in each group (n=6) were given 100 Dg of intradermal injections of either isotype IgG control (PMED with IgG) or anti-CD40 monoclonal antibody (PMED with aCD40) in proximity to the right side vaccine draining inguinal node, one day after the first immunization was administered by PMED. Seven days after the last PMED, an ICS assay was performed on the splenocytes isolated from each individual mice to detect rHer-2 specific polyfunctional CD8 or CD4 T cells that secrete IFND , TNFD and/ or IL-2.. A significant increase in the rHer-2 specific triple-cytokine positive CD8 and CD4 T cell responses were detected from mice treated with the local delivery of anti- CD40 monoclonal antibody compared to isotype IgG control. There were also significant increases in rHer-2 specific single and double cytokine positive CD4 T cells by anti- CD40 monoclonal antibody given locally.
EXAMPLE 6. ANTI-CANCER EFFICACY OF CANCER VACCINE IN
COMBINATION WITH LOW DOSE SUNITINIB
Anti-tumor efficacy of anti-cancer vaccine in combination with low dose sunitinib was investigated in BALB/neuT mice with spontaneous mammary pad tumors.
Animal treatment. Briefly, 13-14 weeks old female mice were orally given sunitinib malate (Sutent) at 5mg/kg for 1 12 days twice a day. The control vaccine, which delivers no antigen, and cancer vaccine which delivers a rat Her-2 antigen of SEQ ID NO: 54 (rHer-2), were given by adenovirus injections on day 3 as a prime followed by 7 biweekly administrations by PMED of DNA delivering HBV antigens (control vaccine) or rHer-2 (cancer vaccine) respectively. The survival end point was determined when all ten mammary pads became tumor positive or when the volume of any of the mammary tumors reached 2000mm3.
Results. The results are presented in Figure 10. Compared to previously published pharmacokinetic profile of Sutent (Mendel, D., Laird, D., et al.: "In vivo antitumor activity of SU1 1248, a novel tyrosine kinase inhibitor targeting vascular endothelial growth factor and platelet-derived growth factor receptors: determination of a pharmacokinetic/pharmacodynamic relationship". Clinical Cancer Research, 203, 9:327- 337), the CMax of Sutent in mice dosed twice a day at 5 mg/kg is expected to be significantly lower than the minimum blood levels necessary to achieve efficient antitumor efficacy in mice and man. The data shows a quick and temporary improvement in the survival of the mice treated with low dose Sutent monotherapy. However when given with the cancer vaccine, a more persistent and significant improvement of survival was observed (P< 0.0001 by Log rank test).
EXAMPLE 7. ENHANCEMENT OF VACCINE-INDUCED IMMUNE RESPONSES BY LOCAL ADMINISTRATION OF CPG
The immune enhancement of local administration of CpG (PF-03512676) on the immune responses induced by a human PSMA nucleic acid provided by the invention was investigated in a monkey study, in which the immune response was assessed by measuring PSMA specific T cell responses using an IFNy ELISPOT assay. Animal Treatment and Sample Collection. Six groups of Chinese cynomolgus macaques, six (#1 to 6) per each test group, were immunized with a plasmid DNA encoding the human PSMA modified antigen (the polypeptide of SEQ ID NO:9) delivered by electroporation. Briefly, all animals received bilateral intramuscular injections of 5 mg of plasmid DNA followed by electroporation (DNA EP) on day 0. Subsequently right after the electroporation, group 2 received bilateral intramuscular injections of 2 mg of CpG mixed with 1 mg Alum in proximity to the DNA injection sites. Groups 3 and 4 received bilateral intramuscular injections of 2 mg of CpG delivered without alum in proximity to the DNA injection sites either on day 0 or day 3, respectively. Group 5 received 2 mg of bilateral intradermal injections of CpG delivered in proximity to the vaccine draining inguinal nodes on day 3. Group 6 received bilateral injections of 200 Dg of CpG mixed with the DNA solution which was co-electroporated into the muscle on day 0.
IFNy ELISPOT Assay Procedure. Peripheral blood samples were collected from each animal fifteen days after the DNA immunization. Peripheral blood mononuclear cells (PBMCs) were isolated from the blood samples and were subjected to an IFNy ELISPOT assay to measure the PSMA specific T cell responses. Briefly, 4e5 PBMCs from individual animals were plated per well with pools of PSMA specific peptides or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFNy ELISPOT plates. The composition of each of the PSMA specific peptide pool is provided in Table 24A. The plates were incubated for 16 hrs at 37°C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction. The number of IFNy spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates.
Results. Table 6 shows the result of a representative IFNy ELISPOT assay that evaluates and compares the IFNy T cell responses induced by the vaccine without (group 1 ) or with CpG (PF-03512676) given locally by intramuscular (groups 2, 3, 4, and 5) or intradermal injections (group 6). The reported PSMA specific response was calculated by subtracting the average number of the SFC to the nonspecific control peptides (human HER2 peptide pool) from the average number of SFC to the PSMA peptide pools and normalized to the SFC observed with 1 e6 PBMCs. Λ indicates that the count is not accurate because the numbers of spots were too numerous to count. ND indicates not determined. The PSMA specific IFNy T cell responses were detected to multiple PSMA specific peptide pools in the absence of CpG (PF-03512676) in all six animals (group 1 ). The total responses to the PSMA peptides measured were modestly higher in a few animals that additionally received CpG (PF-03512676) either by intramuscular (group 4: 3/6) or intradermal (group 5: 2/6) injections 3 days after DNA electroporation. However, when CpG was delivered subsequently right after electroporation on the same day (groups 2 and 3), there were several animals that failed to produce high responses (group 2: 4/6 and group3: 3/6) whether mixed or not mixed with Alum. However, higher net responses were detected in 4/6 animals when a ten-fold lower dose of CpG was co- electroporated with the DNA solution into the muscle (group 6) with a statistically higher response (P<0.05) to peptide pools H1 and R1 compared to animals that did not receive CpG (group 1 ). The data shows that low dose of CpG can effectively enhance IFNy T cell responses induced by a DNA vaccine when co-electroporated into the muscle.
Table 6. PSMA specific IFNy T cell responses induced by the DNA vaccine without (Group 1 ) or with CpG (Groups 2, 3, 4, 5 and 6) is measured by IFNy ELISPOT assay from PBMCs, 15 days after DNA electroporation
Figure imgf000056_0001
EXAMPLE 8. ENHANCEMENT OF VACCINE-INDUCED IMMUNE
RESPONSES BY LOCAL ADMINISTRATION OF ANTI-CTLA-4 ANTIBODY The effect of low dose subcutaneous administration of anti-CTLA-4 monoclonal antibody (CP-675, 206) on the immune responses induced by a rhesus PSMA nucleic acid was investigated in a monkey study, in which the immune response was assessed by measuring PSMA specific T cell responses using an IFNy ELISPOT assay. The rhesus PSMA nucleic acid used in the study has the sequence as set forth in SEQ ID NO: 56) and encodes an immunogenic PSMA polypeptide of SEQ ID NO: 55.
Animal Treatment and Sample Collection. Five groups of male Indian rhesus macaques, seven (#1 to 7) per each test group, were immunized with an adenovirus encoding a rhesus PSMA modified polypeptide delivered by bilateral intramuscular injections (2x 5e10 V.P.). Immediately following the adenovirus injections, group 1 received vehicle, and groups 2 to 4 received bilateral subcutaneous injections of anti- CTLA-4 antibody (CP-675, 206) at doses 2x 25mg, 2x 16.7mg and 2x 8.4mg respectively in proximity to the vaccine draining lymph node.
Nine days after the immunization, peripheral blood mononuclear cells (PBMCs) were isolated from each animal and were subjected to an IFNy ELISPOT assay to measure the rhesus PSMA specific T cell responses. Briefly, 4e5 PBMCs from individual animals were plated per well with pools of rhesus PSMA specific peptides (P1 , P2, P3 or R1 +R2 defined in Table 24A) or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFN□ ELISPOT plates. The plates were incubated for 16 hrs at 37 °C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction. The number of IFN/ spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates. The average of the duplicates from the background adjusted SFC of the rhesus PSMA specific peptide pools was normalized to the response in 1 e6 PBMCs. The individual and sum responses to the peptide pools from each individual animal are presented in Table 29.
IFNy ELISPOT Assay Procedure. A capture antibody specific to IFNy (D BD Bioscience, #51 -2525kc) is coated onto a polyvinylidene fluoride (PVDF) membrane in a microplate overnight at 4°C. The plate is blocked with serum/protein to prevent nonspecific binding to the antibody. After blocking, effector cells (such as splenocytes isolated from immunized mice or PBMCs isolated from rhesus macaques) and targets (such as PSMA peptides from peptide library, target cells pulsed with antigen specific peptides or tumor cells expressing the relevant antigens) are added to the wells and incubated overnight at 37°C in a 5% CO2 incubator. Cytokine secreted by effector cells are captured by the coating antibody on the surface of the PVDF membrane. After removing the cells and culture media, 100 μΙ of a biotinylated polyclonal anti- humanlFNy antibody was added to each of the wells for detection. The spots are visualized by adding streptavidin-horseradish peroxidase and the precipitate substrate, 3-amino-9-ethylcarbazole (AEC), to yield a red color spot as per manufacturer's (Mabtech) protocol. Each spot represents a single cytokine producing T cell.
Results. Table 7 shows the results of a representative IFNy ELISPOT assay that compares the T cell responses induced by the vaccine without (group 1 ) or with (groups 2-4) anti-CTLA-4 monoclonal antibody (CP-675, 206) given locally by subcutaneous injections in proximity to the vaccine draining lymph node. The vaccine generated an immune response (groupl ) that was significantly enhanced by the local administration of the anti-CTLA-4 antibody (CP-675, 206) at a dose of 50mg (group 2, P=0.001 by Student's T-test using underestimated values). The response was also significantly enhanced by low doses of anti-CTLA-4 antibody at 33.4 mg (group3: P=0.004 by Student T-test using underestimated values) and 16.7mg (group4: P=0.05 by Student T- test) respectively. The data suggests that low doses of anti-CTLA-4 delivered by subcutaneous injection can significantly enhance the vaccine induced immune responses.
Table 7. IFNy T cell responses induced by the vaccine without (Group 1 ) or with subcutaneous injections of anti-CTLA-4 antibody (CP-675,206). Λ indicates that the count is underestimated due to the high spot numbers. TNTC means too numerous to count.
Figure imgf000059_0001
EXAMPLE 9. IMMUNOMODULATION OF MYELOID DERIVED SUPPRESSOR CELLS BY LOW DOSE SUNITINIB
The following example is provided to illustrate the immunomodulatory effects of low dose sunitinib on Myeloid Derived Suppressor Cells (MDSC) in vivo, in a non-tumor mouse model. Study Procedures.
To generate MDSC enriched splenocytes, TUBO cells (1 x106) were implanted into the flanks of 5 BALB/neuT mice, and left for approx. 20-30 days until tumor volume reached between 1000-1500mm3. Mice were then sacrificed, spleens removed and the MDSC enriched splenocytes recovered. Splenocytes were labeled for 10 minutes with 5 μΜ CFSE, washed with PBS and counted. Labeled cells were subsequently resuspended at 5x107 splenocytes/ml in PBS solution and adoptively transferred via an i.v. tail vein injection into na'ive BALB/c recipient mice. Three days prior to adoptive transfer, the recipient mice began bi-daily dosing with vehicle or sunitinib malate (Sutent) at 5 mg/kg, 10 mg/kg and 20 mg/kg. Following adoptive transfer, recipient mice continued to receive bi-daily dosing of Vehicle or sunitinib for two further days, after which point the mice were sacrificed, spleens removed, splenocytes recovered and processed for phenotypic analysis.
Splenocytes were counted and resuspended at 5x106 cells/ml in FACS staining buffer (PBS, 0.2% (w/v) bovine serum albumin, and 0.02% (w/v) Sodium Azide). For flow cytometry staining of splenocytes, 2.5x106 cells were first incubated with anti-bodies to CD16/CD32, 10 minutes at 4QC, to block Fc receptors and minimize non-specific binding. Splenocytes were then stained for 20 minutes at 4QC with appropriate fluorophore conjugated antibodies (Biolegend) to murine cell surface markers. For T cells (anti-CD3 (Pacific Blue), clone 17A2) and for MDSC (anti-GR-1 (APC), clone RB6- 8C5 and anti-CD1 1 b (PerCp Cy5.5), clone M1 /70). A live/dead stain was also included. Following antibody incubation, stained splenocytes were washed with 2mls of FACS buffer, pelleted by centrifugation and resuspended in 0.2ml of FACS buffer prior to data acquisition on a BD CANTO II flow cytometer. To monitor the effect of Sunitinib or Vehicle on the adoptively transferred MDSC survival, we calculated the percentage of CFSE+,CD3-,GR1 +,CD1 1 b+ in the live, singlet gate. We then determined the number of adoptively transferred MDSC per spleen by calculating what actual cell number the percentage represented of total splenocytes count. Data was analyzed by FloJo and Graph pad software.
Results. The data presented in Table 27 represents the mean number of adoptively transferred CSFE+,CD3-,GR1 +,CD1 1 b+ cells recovered per spleen (n=7/group), 2 days post adoptive transfer, from mice bi-daily dosed with either Vehicle or 5mg/kg, 10mg/kg and 20 mg/kg Sunitinib. Statistical significance was determined by one-way ANOVA using the Dunnett's multiple comparison test, comparing the Sunitinib dosed groups against the Omg/kg (vehicle) group. The data demonstrates that Sunitinib, dosed bi-daily, in vivo, has an immunomodulatory effect on MDSCs, even when dosed as low as 5mg/kg, resulting in a statistically significant reduction in the numbers recovered when compared to the vehicle treated control group.
Table 8. Mean number of CFSE+,CD3-,GR1 +,CD1 1 b+ MDSCs recovered from spleen
Figure imgf000061_0001
DNA CONSTRUCTS
The following example is provided to illustrate the capability of triple antigen vaccine constructs (either in the form of adenovirus vector or DNA plasmid) expressing three antigens PSMA, PSCA and PSA provided by the invention to elicit specific T cell responses to all three encoded antigens in nonhuman primates.
In Vivo Study Procedures. The T cell immunogenicity of five adenovirus vectors each expressing three antigens (PSMA, PSCA and PSA; Ad-733, Ad-734, Ad-735, Ad- 796 and Ad-809) provided by the invention were compared to the mix of three adenovirus vectors each only expressing a single antigen (PSMA, PSA or PSCA), 9 days post prime. The response to single adenovirus expressing a single antigen (groups 1 -3) was evaluated to demonstrate the specificity. Briefly, Indian rhesus macaques (n=6 for groups 1 and 3, n=7 for group 2 and n=8 for groups 4-9) were intramuscularly injected with a total of 1 e1 1 V.P. followed by intradermal injections of anti-CTLA-4 at 10 mg/kg on the same day. Nine days after the injections, peripheral blood mononuclear cells (PBMCs) were isolated from each animal and were subjected to an IFN D ELISPOT assay to measure the PSMA, PSA and PSCA specific T cell responses.
Thirteen weeks after the adenovirus and anti-CTLA-4 injections when the T cell responses have contracted, the monkeys received DNA (Group 1 : PSMA, plasmid 5166; Group 2: PSA, plasmid 5297; Group 3: PSCA, plasmid 5259; Group 4: mix of PSMA, PSA and PSCA, plasmids 5166, 5259 and 5297; Group 4: plasmid 457; Group 6: plasmid 458; Group 7: plasmid 459; Group 8: plasmid 796 and Group 9: plasmid 809) boost vaccinations delivered by electroporation. In summary, each animal received a total 5mg of plasmid DNA provided by the invention which delivers the same expression cassette encoded in the adenovirus used in the prime. Nine days after the boost vaccination, peripheral blood mononuclear cells (PBMCs) were isolated from each animal and were subjected to an IFNy ELISPOT assay.
IFNy ELISPOT assay. Briefly, 4e5 PBMCs from individual animals were plated per well with PSMA specific peptide pools P1 , P2, P3 or H1 and H2 (Table 9A), PSA specific pool 1 or 2 (Table 9B), PSCA specific pool (Table 10) or nonspecific control peptides (human HER2 peptide pool) each at 2ug/ml in IFNy ELISPOT plates. The plates were incubated for 16 hrs at 37 °C and 5% CO2 and washed and developed after incubation as per manufacturer's instruction. The number of IFNy spot forming cells (SFC) was counted by CTL reader. Each condition was performed in duplicates. The average of the duplicates from the background adjusted SFC of the antigen specific peptide pools was normalized to the response in 1 e6 PBMCs. The antigen specific responses in the tables present the sum of the responses to the corresponding antigen specific peptides or peptide pools.
Results: Table 1 1 represents a study that evaluates the T cell immunogenicity of five different adenoviruses each expressing all three antigens in comparison to the mixture of three adenoviruses each expressing a single antigen in Indian rhesus macaques by IFNy ELISPOT. The majority of animals that only received Ad-PSMA (group 1 ) injections induced specific responses to PSMA but not to PSA or PSCA (Student's T-test, P<0.03. One animal (#4) that induced responses to PSCA preferentially was removed from the statistical analysis). The animals that only received injections of Ad-PSA (group 2) induced specific responses to PSA but not to PSMA or PSCA (Student's T-test, P<0.02). The animals that only received injections of Ad-PSCA (group 3) induced specific responses to PSCA but not to PSMA or PSA (Student's T-test, P<0.03). All five triple-antigen expressing adenovirus vectors (groups 5-9) induced IFN D T cell responses to all three antigens which the magnitude varied by animal. The magnitude of the responses to PSCA induced by the triple antigen expressing adenoviruses was similar to the mix of individual vectors (group 4). However the magnitude of responses to PSMA induced by Ad-809 (group 9) and responses to PSA induced by Ad-796 (group 8) were each significantly superior to the mix (Student's T- test, P=0.04 and P=0.02) respectively. These results indicate that vaccinating with an adenovirus expressing triple antigens can elicit equivalent or superior T cell immune responses to vaccinating with the mix of individual adenoviruses in nonhuman primates.
Table 12 shows the IFNy ELISPOT results represents a study that evaluates the immunogenicity of the five different triple antigen expression cassettes provided in the invention delivered by an adenovirus prime in combination with anti-CTLA-4 followed by an electroporation boost of the corresponding plasmid DNA. The immune responses are compared to the mix of three constructs expressing a single antigen delivered similarly by an adenovirus prime with anti-CTLA-4 and DNA electroporation boost immunizations.
All of the animals that only received Ad-PSMA with anti-CTLA-4 followed by plasmid-PSMA (group 1 ) immunizations induced specific responses to PSMA but not to PSA or PSCA. Similarly all of the animals that only received Ad-PSA with anti-CTLA-4 followed by plasmid-PSA immunizations (group 2) induced specific responses to PSA but not to PSMA or PSCA and finally all of the animals that only received Ad-PSCA with anti-CTLA-4 followed by plasmid-PSCA (group 3) immunizations induced specific responses to PSCA but not to PSMA or PSA (Student's T-test, P<0.01 ).
All animals that have been immunized with either the triple-antigen expressing vectors (groups 5-9) or the mix (group 4) induced IFNy T cell responses to all three antigens. The frequency of PSCA or PSA specific IFy T cells detected were similar in all of these groups (groups 4-9) respectively. However construct groups 7 and 9 that received triple antigen expression vector vaccinations produced significantly higher frequency of responses to PSMA than the mix of three single antigen expressing constructs (group 4). These results indicate that adenovirus and DNA vaccines expressing triple antigens in one cassette can elicit equivalent or superior IFNy T cell responses to the mix of adenoviruses and DNAs expressing the single antigens in nonhuman primates. Table 9A. PSMA peptide pools*
P1 P2 P3 H1 H2 R1 R2 h 1-15 h 249- -263 h 449 -463 h 33-47 h 465 -479 r 33-47 r465 -479 h 5-19 h 253- -267 h 453 -467 h 37-51 h 469 -483 r 37-51 r469 -483 h 9-23 h 257- -271 h 457 -471 h 41-55 h 473 -487 r41-55 r473 -487 h 13-27 h 261- -275 h 485 -499 h 45-59 h 477 -491 r 45-59 r477 -491 h 17-31 h 265- -279 h 489 -503 h 61-75 h 481 -495 r61-75 r 481 -495 h 21-35 h 269- -283 h 493 -507 h 65-79 h 537 -551 r 65-79 r537 -551 h 25-39 h 273- -287 h 497 -511 h 69-83 h 541 -555 r 69-83 r 541 -555 h 29-43 h 277- -291 h 501 -515 h 73-87 h 545 -559 r 73-87 r545 -559 h 49-63 h 281- -295 h 505 -519 h 97-111 h 577 -591 r 97-111 r577 -591 h 53-67 h 285- -299 h 509 -523 h 101-115 h 581 -595 r 101-115 r 581 -595 h 57-71 h 289- -303 h 513 -527 h 105-119 h 585 -599 r 105-119 r585 -599 h 77-91 h 293- -307 h 517 -531 h 109-123 h 589 -603 r 109-123 r589 -603 h 81-95 h 297- -311 h 521 -535 h 137-151 h 601 -615 r 137-151 r 601 -615 h 85-99 h 317- -331 h 525 -539 h 141-155 h 605 -619 r 141-155 r605 -619 h 89-103 h 321- -335 h 529 -543 h 145-159 h 609 -623 r 145-159 r609 -623 h 93-107 h 325- -339 h 533 -547 h 149-163 h 613 -627 r 149-163 r 613 -627 h 113-127 h 329- -343 h 549 -563 h 209-223 h 637 -651 r 209-223 r637 -651 h 117-131 h 333- -347 h 553 -567 h 213-227 h 641 -655 r 213-227 r 641 -655 h 121-135 h 353- -367 h 557 -571 h 217-231 h 645 -659 r 217-231 r645 -659 h 125-139 h 357- -371 h 561 -575 h 221-235 h 649 -663 r 221 -235 r649 -663 h 129-143 h 361- -375 h 565 -579 h 301-315 h 653 -667 r 301 -315 r653 -667 h 133-147 h 365- -379 h 569 -583 h 305-319 h 657 -671 r 305-319 r657 -671 h 153-167 h 369- -383 h 573 -587 h 309-323 h 709 -723 r 309-323 r709 -723 h 157-171 h 373- -387 h 593 -607 h 313-327 h 713 -727 r 313-327 r 713 -727 h 161-175 h 377- -391 h 597 -611 h 337-351 h 717 -731 r 337-351 r 717 -731 h 165-179 h 381- -395 h 617 -631 h 341-355 h 721 -735 r 341 -355 r 721 -735 h 169-183 h 385-399 h 621 -635 h 345-359 h 725-739 r 345-359 r 725-739 h 173-187 h 389-403 h 625-639 h 349-363 h 729-743 r 349-363 r 729-743 h 177-191 h 393-407 h 629-643 h 461 -475 h 733-747 r 461 -475 r 733-747 h 181 -195 h 397-41 1 h 633-647
h 185-199 h 401 -415 h 661 -675
h 189-203 h 405-419 h 665-679
h 193-207 h 409-423 h 669-683
h 197-21 1 h 413-427 h 673-687
h 201 -215 h 417-431 h 677-691
h 205-219 h 421 -435 h 681 -695
h 225-239 h 425-439 h 685-699
h 229-243 h 429-443 h 689-703
h 233-247 h 433-447 h 693-707
h 237-251 h 437-451 h 697-71 1
h 241 -255 h 441 -455 h 701 -715
h 245-259 h 445-459 h 705-719
h737-750
Table 9B. PSA peptide pools: the amino acid position and sequence of fifteen amino acid peptides overlapping by thirteen amino acids from PSA peptide library is shown.
PSA peptide pool 1 PSA peptide pool 2 amino acid no. PSA peptide sequence amino acid no. PSA peptide sequence
5-19 VVFLTLSVTWIGAAP 129-143 PAELTDAVKVMDLPT
9-23 TLSVTWIGAAPLILS 131 -145 ELTDAVKVMDLPTQE
1 1 -25 SVTWIGAAPLILSRI 133-147 TDAVKVMDLPTQEPA
13-27 TWIGAAPLILSRIVG 135-149 AVKVMDLPTQEPALG
15-29 IGAAPLILSRIVGGW 137-151 KVMDLPTQEPALGTT
17-31 AAPLILSRIVGGWEC 139-153 MDLPTQEPALGTTCY
19-33 PLILSRIVGGWECEK 141 -155 LPTQEPALGTTCYAS -35 ILSRIVGGWECEKHS 143-157 TQEPALGTTCYASGW-37 SRIVGGWECEKHSQP 145-159 EPALGTTCYASGWGS-39 IVGGWECEKHSQPWQ 147-161 ALGTTCYASGWGSIE-41 GGWECEKHSQPWQVL 149-163 GTTCYASGWGSIEPE-43 WECEKHSQPWQVLVA 151 -165 TCYASGWGSIEPEEF-45 CEKHSQPWQVLVASR 153-167 YASGWGSIEPEEFLT-47 KHSQPWQVLVASRGR 155-169 SGWGSIEPEEFLTPK-49 SQPWQVLVASRGRAV 157-171 WGSIEPEEFLTPKKL-51 PWQVL VAS RG RAVCG 159-173 SIEPEEFLTPKKLQC-53 QVLVASRGRAVCGGV 161 -175 EPEEFLTPKKLQCVD-55 LVASRGRAVCGGVLV 163-177 EEFLTPKKLQCVDLH-57 ASRGRAVCGGVLVHP 165-179 FLTPKKLQCVDLHVI-59 RGRAVCGGVLVHPQW 167-181 TPKKLQCVDLHVISN-61 RAVCGG VLVH PQWVL 169-183 KKLQCVDLHVISNDV-63 VCGG VLVH PQWVLTA 171 -185 LQCVDLHVISNDVCA-65 GG VLVH PQWVLTAAH 173-187 CVDLHVISNDVCAQV-67 VLVHPQWVLTAAHCI 175-189 DLHVISNDVCAQVHP-69 VHPQWVLTAAHCIRN 177-191 HVISNDVCAQVHPQK-71 PQWVLTAAHCIRNKS 179-193 ISNDVCAQVHPQKVT-73 WVLTAAHCIRNKSVI 181 -195 N DVCAQVH PQKVTKF-75 LTAAHCIRNKSVILL 183-197 VCAQVHPQKVTKFML-77 AAHCIRNKSVILLGR 185-199 AQVHPQKVTKFMLCA-79 HCIRNKSVILLGRHS 187-201 VHPQKVTKFMLCAGR-81 IRNKSVILLGRHSLF 189-203 PQKVTKFMLCAGRWT-83 NKSVILLGRHSLFHP 191 -205 KVTKFMLCAGRWTGG-85 SVILLGRHSLFHPED 193-207 TKFMLCAGRWTGGKS-87 ILLGRHSLFHPEDTG 195-209 FMLCAGRWTGGKSTC-89 LGRHSLFHPEDTGQV 197-21 1 LCAG RWTGG KSTCSG-91 RHSLFHPEDTGQVFQ 199-213 AGRWTGGKSTCSGDS-93 SLFHPEDTGQVFQVS 201 -215 RWTGGKSTCSGDSGG-95 FHPEDTGQVFQVSHS 203-217 TGGKSTCSGDSGGPL-97 PEDTGQVFQVSHSFP 205-219 GKSTCSGDSGGPLVC 85-99 DTGQVFQVSHSFPHP 207-221 STCSGDSGGPLVCNG
87-101 GQVFQVSHSFPHPLY 209-223 CSGDSGGPLVCNGVL
89-103 VFQVSHSFPHPLYDM 21 1 -225 GDSGGPLVCNGVLQG
91 -105 QVSHSFPHPLYDMSL 213-227 SGGPLVCNGVLQGIT
93-107 SHSFPHPLYDMSLLK 215-229 GPLVCNGVLQGITSW
95-109 SFPHPLYDMSLLKNR 217-231 LVCNGVLQGITSWGS
97-1 1 1 PHPLYDMSLLKNRFL 219-233 CNGVLQGITSWGSEP
99-1 13 PLYDMSLLKNRFLRP 221 -235 G VLQG ITSWGSE PCA
101 -1 15 YDMSLLKNRFLRPGD 223-237 LQGITSWGSEPCALP
103-1 17 MSLLKNRFLRPGDDS 225-239 GITSWGSEPCALPER
105-1 19 LLKNRFLRPGDDSSH 227-241 TSWGSEPCALPERPS
107-121 KNRFLRPGDDSSHDL 229-243 WGSEPCALPERPSLY
109-123 RFLRPGDDSSHDLML 231 -245 SEPCALPERPSLYTK
1 1 1 -125 LRPGDDSSHDLMLLR 233-247 PCALPERPSLYTKVV
1 13-127 PGDDSSHDLMLLRLS 235-249 ALPERPSLYTKVVHY
1 15-129 DDSSHDLMLLRLSEP 237-251 PERPSLYTKVVHYRK
1 17-131 SSHDLMLLRLSEPAE 239-253 RPSLYTKVVHYRKWI
1 19-133 HDLMLLRLSEPAELT 241 -255 SLYTKVVHYRKWIKD
121 -135 LMLLRLSEPAELTDA 243-257 YTKVVHYRKWIKDTI
123-137 LLRLSEPAELTDAVK 245-259 KVVHYRKWIKDTIVA
125-139 RLSEPAELTDAVKVM 247-261 VHYRKWIKDTIVANP
127-141 SEPAELTDAVKVMDL 249-261 YRKWIKDTIVANP
251 -261 KWIKDTIVANP
Table 10. PSCA peptide pool: The amino acid position and sequence of fifteen amino acid peptides overlapping by thirteen amino acids from PSCA peptide library is shown.
amino acid no. PSCA peptide sequence
1 -15 MKAVLLALLMAGLAL
3-17 AVLLALLMAGLALQP
5-19 LLALLMAGLALQPGT
7-21 ALLMAGLALQPGTAL
9-23 LMAGLALQPGTALLC
1 1 -25 AGLALQPGTALLCYS
13-27 LALQPGTALLCYSCK
15-29 LQPGTALLCYSCKAQ
17-31 PGTALLCYSCKAQVS
19-33 TALLCYSCKAQVSNE
21 -35 LLCYSCKAQVSNEDC
23-37 CYSCKAQVSNEDCLQ
25-39 SCKAQVSNEDCLQVE
27-41 KAQVSNEDCLQVENC
29-43 QVSNEDCLQVENCTQ
31 -45 SNEDCLQVENCTQLG
33-47 EDCLQVENCTQLGEQ
35-49 CLQVENCTQLGEQCW
37-51 QVENCTQLGEQCWTA
39-53 ENCTQLGEQCWTARI
41 -55 CTQLGEQCWTARIRA
43-57 QLGEQCWTARIRAVG
45-59 GEQCWTARIRAVGLL
47-61 QCWTARIRAVGLLTV
49-63 WTARIRAVGLLTVIS
51 -65 ARIRAVGLLTVISKG
53-67 IRAVGLLTVISKGCS
55-69 AVGLLTVISKGCSLN 57-71 GLLTVISKGCSLNCV
59-73 LTVISKGCSLNCVDD
61 -75 VISKGCSLNCVDDSQ
63-77 SKGCSLNCVDDSQDY
65-79 GCSLNCVDDSQDYYV
67-81 SLNCVDDSQDYYVGK
69-83 NCVDDSQDYYVGKKN
71 -85 VDDSQDYYVGKKNIT
73-87 DSQDYYVGKKNITCC
75-89 QDYYVGKKNITCCDT
77-91 YYVGKKNITCCDTDL
79-93 VGKKNITCCDTDLCN
81 -95 KKNITCCDTDLCNAS
83-97 NITCCDTDLCNASGA
85-99 TCCDTDLCNASGAHA
87-101 CDTDLCNASGAHALQ
89-103 TDLCNASGAHALQPA
91 -105 LCNASGAHALQPAAA
93-107 NASGAHALQPAAAIL
95-109 SGAHALQPAAAILAL
97-1 1 1 AHALQPAAAILALLP
99-1 13 ALQPAAAILALLPAL
101 -1 15 QPAAAILALLPALGL
103-1 17 AAAILALLPALGLLL
105-1 19 AILALLPALGLLLWG
107-121 LALLPALGLLLWGPG
109-123 LLPALGLLLWGPGQL
1 1 1 -125 PALGLLLWGPGQL
Table 1 1 . IFNy T cell responses induced by the single antigen (Group 1 : Ad-PSMA; Group 2: Ad-PSA; Group 3: Ad-PSCA; Group 4: mix of Ad-PSMA, Ad-PSA and Ad- PSCA) or triple antigen expressing adenovirus vectors (Group 4: Ad-733; Group 6: Ad- 734; Group 7: Ad-735; Group 8: Ad-796 and Group 9: Ad-809) after adenovirus prime with anti-CTLA-4 analyzed by ELISPOT assay.
Response to animal ID
PSMA peptides 1 2 3 4 5 6 7 8
1 2356 988 1505 335 501 2145 NA NA
2 342 1776 154 329 158 438 321 NA
3 0 1276 40 126 20 0 NA NA
4 304 1 198 774 2007 1277 1310 1 159 2774
Group
5 943 2670 2757 780 1082 2251 1566 544 No.
6 472 2092 4248 1369 1760 2964 1447 263
7 2161 2202 939 869 3513 1654 3424 900
8 1 166 799 2566 663 1043 497 1334 560
9 1621 3247 2031 980 2942 1882 1918 3805
Response to animal ID
PSA peptides 1 2 3 4 5 6 7 8
1 0 0 0 48 0 42 NA NA
2 1419 1426 298 1223 1346 1 120 1694 NA
3 6 462 91 0 77 0 NA NA
4 790 1093 161 1 790 186 783 2016 1964
Group
5 101 510 955 665 336 1512 1052 1 19 No.
6 236 673 2155 724 504 1600 930 83
7 0 1086 494 663 2265 1 17 1712 84
8 1893 2060 1490 1759 2352 1700 2232 1326
9 1 193 1432 207 1738 1886 949 492 1940
Response to animal ID
PSCA peptides 1 2 3 4 5 6 7 8
Group 1 795 425 874 1069 219 203 NA NA No. 2 669 713 391 199 164 560 461 NA 3 510 1234 1099 1115 1194 339 NA NA
4 778 528 680 1101 165 531 1175 1009
5 378 1061 1161 143 71 756 766 204
6 118 380 1190 403 829 1225 148 261
7 615 1141 794 564 1175 490 856 204
8 968 1136 745 290 550 976 955 841
9 929 434 1150 745 1120 246 1195 970
Table 12. IFNy T cell responses induced by the single antigen (Group 1 : PSMA; Group 2: PSA; Group 3: PSCA; Group 4: mix of PSMA, PSA and PSCA) or triple antigen expressing vectors (Groups 5 - 9) after adenovirus prime with anti-CTLA-4 and DNA electroporation boost immunizations analyzed by ELISPOT assay.
Figure imgf000071_0001
Response to animal ID
PSA peptides 1 2 3 4 5 6 7 8
1 0 0 0 1 0 26 NA NA
Group
2 1883 1236 1574 393 461 941 1565 NA No.
3 33 30 9 13 8 11 NA NA 4 571 1 129 1 180 210 88 274 924 360
5 50 1255 1344 628 210 638 948 1 161
6 88 228 1390 489 1006 908 683 51
7 0 21 1 321 156 1509 56 199 85
8 414 61 1 85 105 544 1080 331 1883
9 434 821 556 343 1 160 510 144 1 1 15
Response to animal ID
PSCA
peptides 1 2 3 4 5 6 7 8
1 615 799 533 74 258 61 NA NA
2 194 170 133 133 8 66 405 NA
3 819 1071 873 839 1045 724 NA NA
4 543 506 664 470 70 673 761 1235
Group
5 154 455 1218 109 218 1094 285 569 No.
6 56 293 603 506 745 91 1 63 165
7 429 298 939 589 1226 263 803 451
8 279 214 871 61 144 51 1 193 963
9 379 191 1 196 73 699 198 616 836
EXAMPLE 1 1 . CONSTRUCTION OF C68 VECTORS 1 1 A. Vector AdC68-734 Construciton
AdC68-734 is a replication incompetent adenovirus vector based upon the chimpanzee adenovirus C68 that encodes three immunogenic PAA polypeptides - an immunogenic PSA polypeptide, immunogenic PSCA polypeptide, and immunogenic PSMA polypeptide. The vector sequence was designed in silico. First, the baseline full length C68 sequence was obtained from Genbank (Definition: Simian adenovirus 25, complete genome; accession number AC_00001 1 .1 ). Five point mutations described in the literature were introduced into the sequence. (Roshorm, Y., M. G. Cottingham, et al. (2012). "T cells induced by recombinant chimpanzee adenovirus alone and in prime- boost regimens decrease chimeric EcoHIV/NDK challenge virus load." Eur J Immunol 42(12): 3243-3255) Next, 2.6 kilobases of the viral early transcription region 1 (E1 ) were deleted to render the vector replication incompetent, and 3.5 kilobases of the early transcription region 3 (E3) were removed to create space in the vector for the transgene expression cassette. (Tatsis, N., L. Tesema, et al. (2006). Chimpanzee-origin adenovirus vectors as vaccine carriers. Gene Ther. 13: 421 -429) A highly efficient eukaryotic expression cassette was then introduced into the E1 region. The expression cassette included the following components: (A) Cytomegalovirus (CMV) immediate early enhancer/promoter, (B) Tet operator (binding site for the tetracycline repressor), (C) the multi-antigen construct comprising (1 ) nucleotide sequence encoding amino acids 25 through 261 of the human PSA, (2) Cis acting hydrolase element encoding a glycine- serine linker and Thosea asigna virus 2A peptide (T2A), (3) nucleotide sequence encoding amino acids 2 through 123 of the human PSCA, ( 4) Cis acting hydrolase element encoding a glycine-serine linker and Foot and Mouth Disease Virus 2A peptide (F2A), and (5) nucleotide sequence encoding amino acids 15 through 750 the human PSMA, and (D) SV40 polyA transcription termination signal. Finally, Pad restriction sites were inserted at each end of the viral genome to facilitate the release of the genome from the parent Bacmid. Nucleotides from the Pad restriction sites are removed during viral propagation and, therefore, are not incorporated into the genome of the vector product itself. A nucleotid sequence of the entire vector AdC68-734, including the Pad restriction sites, is set forth in SEQ ID NO:58. The multi-antigen construct (PSA-T2A-PSCA-F2A-PSMA) incorporated in vector AdC68-734 (as well as in Plasmid 458) is also set forth in SEQ ID NO:61 . The amino acid sequence encoded by the multi-agtigen construct of SEQ ID NO:61 is set forth in SEq ID NO:60. The components of vector AdC68-734 are provided in Table 13.
Table 13. Components of Vector AdC68-734
Base Numbers Feature
1 -8 Pad restriction site
9-463 Bases 1 -455 of AC00001 1 .1 (SEQ ID NO:57)
464-1096 CMV enhancer/promoter
1031 -1070 Tetracycline operator / repressor binding site
1 106-1825 Sequence encoding amino acids 25 through 261 of the human
PSA and the preceding methionine-alanine-serine linker
1826-1831 Linker encoding glycine - serine 1832-1885 Cis acting hydrolase element encoding a Thosea asigna virus
2A peptide
1886-2257 Sequence encoding amino acids 2 through 123 of the human
PSCA and the preceding alanine-serine linker
2258-2263 Linker encoding glycine - serine
2264-2323 Cis acting hydrolase element encoding a Foot and Mouth
Disease Virus 2A peptide
2324-4543 Sequence encoding amino acids 15 through 750 of the human
PSMA and the preceding methionine-alanine-serine linker
4541 -4543 Stop codon
4596-4823 SV40 polyA transcription termination signal
4824-29622 Bases 3013-2781 1 of AC00001 1 .1 (SEQ ID NO:57)
29623-3481 1 Bases 31331 -36519 of AC00001 1 .1 (SEQ ID NO:57)
10730 C to G substitution at base 8919 of AC00001 1 .1 (SEQ ID
NO:57)
17569 G to C substitution at base 15758 of AC00001 1 .1 (SEQ ID
NO:57)
18967 A to T substitution at base 17156 of AC00001 1 .1 (SEQ ID
NO:57)
19245 C to A substitution at base 17434 of AC00001 1 .1 (SEQ ID
NO:57)
33520 G to C substitution at base 35228 of AC00001 1 .1 (SEQ ID
NO:57)
34812-34819 Pad restriction site
Following in silico design, the 34,819 base-pair sequence was biochemically synthesized in a multi-stage process utilizing in vitro oligo synthesis and subsequent recombination-mediated intermediate assembly in E. coli and yeast. The viral genome was ultimately inserted into a bacterial artificial chromosome (pCC1 BAC-LCyeast-TRP Trunc) for propagation. Next generation sequencing (MiSeq technology) was performed at multiple steps in the production process, including the final Bacmid 17.3.3.22 lot that was used to create the viral seed stock. Viral seed stock was generated by digesting Bacmid 17.3.3.22 with Pad to release the AdC68-734 genome from the BAC backbone. The linearized nucleic acid was transfected into an E1 complimenting adherent HEK293 cell line and upon visible cytopathic effects and adenovirus foci formation, cultures were harvested by multiple rounds of freezing/thawing to release virus from the cells. Viruses were amplified and purified by standard techniques. The genetic organization of Bacmid 17.3.3.22 is provided in Figure 1 1 .
1 1 B. Constructions of Additonal C68 Vectors
Additional triple antigen C68 vectors were constructed in a similar fashion to AdC68-734. Some of the additional vectors involve functional deletions in the C68 genome that are slightly different from those in Vector AdC68-734, while others incorporate different multi-antigen constructs. Based on these examples and other description of the presentdisclosure, a person skilled in the art would be able construct additional vectors from C68 for expressing vrious multi-antigen constructs, all of which are within the scope of the present invention.
( 1 ) AdC68X-734 and AdC68W-734
Vector AdC68X-734 was constructed from C68 by functional deletion of the E1 and E3 regions of the C68 genome through deletions of nucleotides 577-3403 (E1 region) and 27125- 31831 (E2 region) of the C68 genome of SEQ ID NO:57 and by insertion of the triple antigen construct (PSA-T2A-PSCA-F2A-PSMA) of SEQ ID NO:61 in the deleted E1 region. Vector AdC68W-734 is identical to Vector vector AdC68-734 except that AdC68W-734 contains one or more mutitions in the C68 NDA sequence.
(2) AdC68X-733 and AdC68X-735
Vectors AdC68X-733 and AdC68X-735 were created by replacing the triple antige-construct incorporated in the AdC68X-734 vector with the triple antigen construct of SEQ ID NOs:65 and 66, respectively. The multi-antigen construct incorporated in vector AdC68X-733 (i.e, PSA-F2A-PSMA-T2A-PSCA) is the same as that incorporated in Plasmid 457 and the multi-antigen construct incorporated in vector AdC68X-735 (i.e., PSCA-F2A-PSMA-m I RES-PSA) is the same as that in Plasmid 459. 1 1 C. Research Productivity Characterization
Various research grade lots of AdC68-734 were produced and tested for productivity. Bacmid was digested with Pad to release the vector genome from the BAC backbone and the linearized nucleic acid was transfected into E1 complimenting adherent HEK293 cell lines. When extensive cytopathic effects and adenovirus foci were visible, cultures were harvested by multiple rounds of freezing/thawing to release virus from the cells. Viruses from these Passage 0 (P0) cultures were amplified at least one additional passage in tissue culture flasks and then used as seed stocks for research scale production runs (-0.5 to 3e13 total viral particles per lot). In total, 1 1 production runs were executed (five in HEK293 suspension cells and six in HEK293 adherent cells). The average specific productivity was 15,000 +/- 6,000 viral particles purified per initial infected cell, with a viral particle:infectious unit ratio of 55. Research scale productivities are summarized in Table 14.
Table 14. Specific productivities and infectivities of research scale production lots
Lot Specific productivity (purified Viral particle :
viral particles / cell) infectious unit ratio
20039 17000 33
20424 19000 49
20542 12000 76
20609 25000 54
20626 16000 58
20671 19000 ND
130502 17000 51
130718* 3500 52
130820 7400 55
130821 9300 70
130822 19000 54
* Late passage HEK293 suspension cells used in production
1 1 D. Antigen Expression
The surface expression of PSMA and PSCA was measured by flow cytometry (Figure 12) and total cellular expression of PSMA, PSCA and PSA was measured by western blot analysis (Figure 13) from AdC68-vector infected A549 cells at an MOI=10,000. Mock and AdC68 infected cells were stained with anti-PSCA (fluorescein isothiocyanate-conjugated monoclonal antibody 1 G8 [1 :200]) and PSMA antibodies (allophycocyanin- conjugated monoclonal antibody J591 [1 :200]) for flow cytometric analysis, 2 days post infection. Surface expression of PSCA and PSMA were detected from majority of the cells infected with the different triple antigen-expressing AdC68 vectors with varying levels. Relatively higher levels of expression of PSCA and PSMA were detected from AdC68X-809 infected cells and lower levels were detected from AdC68X-733 infected cell. Two days after infection, total cellular lysates from approximately 1 x105 infected cells were loaded onto each lane of a sodium dodecyl sulfate polyacrylamide gel. The gel was subsequently transferred to a membrane for the detection of PSA, PSMA, and PSCA proteins using primary antibodies specific to PSA, PSMA, and PSCA by western blot analysis. The expressions of all three antigens were detected in the infected cells to varying degrees. While relatively similar levels of PSMA and PSCA were detected from AdC68-734 and AdC68X-735 infected lysates, higher levels of PSA were detected from AdC68-734 lysates compared to those from AdC68X-735
1 1 E. Immunogenicity
A head-to head comparison of the CD8 IFNy responses induced by various triple antigen AdC68 vectors was performed. Each group of mice (n=5 per group) was immunized with AdC68-734, AdC68X-735, AdC68X-809, or Ad5-734 at 1 e9 or 1 e10 VP in the quadriceps. IFNy CD8+ T cell responses in the mice were measured by collecting the spleens from each animal on day 13 post immunization. Splenocytes were isolated and subjected to an IFNy ELISPOT assay to measure the PSMA, PSCA, and PSA- specific T cell responses. Briefly, 2.5 to 5x105 splenocytes from immunized animals were cultured in the presence of individual human PSMA, PSCA, or PSA-specific peptides at 10μg/ml. The 15-mer peptides were previously defined to contain CD8+ T cell epitopes to each prostate antigen. Splenocytes cultured with medium alone served as a control. Each condition was performed in triplicate. The plates were incubated for 20h at 37°C and 5% CO2, washed, and developed after incubation as per the manufacturer's instructions. The number of IFNy SFC was counted by a CTL reader. The results show the average number of PSMA, PSCA, and PSA-specific SFCs with the medium alone background values subtracted, and normalized to 1 x106 splenocytes.
In summary, all triple antigen expressing AdC68 vectors induced immune responses to all three antigens but to different magnitude. At 1 e9 VP, the response to PSMA by the AdC68 vectors was similar to Ad5. The response to PSCA by the three AdC68 vectors was similar or lower than the response induced by Ad5 while the response to PSA was lower with Ad68-735 compared to all of the vectors tested. However at 1e10VP, AdC68-809 induced similar or better responses to all three antigens compared to AdC68-734, AdC68-735 or Ad5. Resutls are presented in Table 15.
Table 15. IFNy T cellular Immunogenicity by AdC68 vectors co-expressing
PSMA, PSA and PSCA in C57BL6 mice by IFNy ELISPOT assay
Construct Ad5-734 AdC68-734 AdC68-809 AdC68-735
Titer, vp 1e9 1e10 1e9 1e10 1e9 1e10 1e9 1e10
473 1221 699 296 489 684 288 503
491 831 143 513 221 687 203 261
PSMA 435 740 149 607 315 809 256 745
248 596 224 116 347 317 317 1197
709 711 269 681 296 536 320 368
1299 1472 1180 1741 1973 1979 533 695
939 1025 1327 1985 841 1532 313 1615
PSA 1096 797 672 780 1869 1979 277 1420
989 933 904 635 1009 1669 535 616
1971 1047 1309 1901 907 1920 824 403
104 64 228 61 115 197 148 92
160 80 11 41 59 92 80 897
PSCA 163 52 15 116 25 235 47 39
119 223 32 57 24 96 107 33
207 100 8 53 17 35 32 16
SELECT RAW SEQUENCES
SEQ ID NO: 1. AMINO ACID SEQUENCE OF THE FULL LENGTH HUMAN
PSMA
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNM KAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLS YPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVN YARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAP GVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPV HPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNE VTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGW RPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPL MYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQR LGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVF ELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASK FSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGES FPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
SEQ ID NO: 2. NUCLEOTIDE SEQUENCE ENCODING THE FULL LENGTH HUMAN PSMA OF SEQ ID NO: 1
atgtggaatctccttcacgaaaccgactcggctgtggccaccgcgcgccgcccgcgctggctgtgcgctggggcgctggt gctggcgggtggcttctttctcctcggcttcctcttcgggtggtttataaaatcctccaatgaagctactaacattactccaaagc ataatatg aaag catttttg g atg aattg aaag ctg ag aacatcaag aag ttcttatataatttt acacag ataccacatttag caggaacagaacaaaactttcagcttgcaaagcaaattcaatcccagtggaaagaatttggcctggattctgttgagctag cacattatgatgtcctgttgtcctacccaaataagactcatcccaactacatctcaataattaatgaagatggaaatgagatttt caacacatcattatttgaaccacctcctccaggatatgaaaatgtttcggatattgtaccacctttcagtgctttctctcctcaag gaatgccagagggcgatctagtgtatgttaactatgcacgaactgaagacttctttaaattggaacgggacatgaaaatca attgctctgggaaaattgtaattgccagatatgggaaagttttcagaggaaataaggttaaaaatgcccagctggcagggg ccaaaggagtcattctctactccgaccctgctgactactttgctcctggggtgaagtcctatccagatggttggaatcttcctgg aggtggtgtccagcgtggaaatatcctaaatctgaatggtgcaggagaccctctcacaccaggttacccagcaaatgaat atgcttataggcgtggaattgcagaggctgttggtcttccaagtattcctgttcatccaattggatactatgatgcacagaagct cctagaaaaaatgggtggctcagcaccaccagatagcagctggagaggaagtctcaaagtgccctacaatgttggacct ggctttactggaaacttttctacacaaaaagtcaagatgcacatccactctaccaatgaagtgacaagaatttacaatgtgat aggtactctcagaggagcagtggaaccagacagatatgtcattctgggaggtcaccgggactcatgggtgtttggtggtatt gaccctcagagtggagcagctgttgttcatgaaattgtgaggagctttggaacactgaaaaaggaagggtggagacctag aagaacaattttgtttgcaagctgggatgcagaagaatttggtcttcttggttctactgagtgggcagaggagaattcaagac tccttcaagagcgtggcgtggcttatattaatgctgactcatctatagaaggaaactacactctgagagttgattgtacaccgc tgatgtacagcttggtacacaacctaacaaaagagctgaaaagccctgatgaaggctttgaaggcaaatctctttatgaaa gttggactaaaaaaagtccttccccagagttcagtggcatgcccaggataagcaaattgggatctggaaatgattttgaggt gttcttccaacgacttggaattgcttcaggcagagcacggtatactaaaaattgggaaacaaacaaattcagcggctatcc actgtatcacagtgtctatgaaacatatgagttggtggaaaagttttatgatccaatgtttaaatatcacctcactgtggcccag gttcgaggagggatggtgtttgagctagccaattccatagtgctcccttttgattgtcgagattatgctgtagttttaagaaagtat gctgacaaaatctacagtatttctatgaaacatccacaggaaatgaagacatacagtgtatcatttgattcacttttttctgcag taaagaattttacagaaattgcttccaagttcagtgagagactccaggactttgacaaaagcaacccaatagtattaagaat gatgaatgatcaactcatgtttctggaaagagcatttattgatccattagggttaccagacaggcctttttataggcatgtcatct atgctccaagcagccacaacaagtatgcaggggagtcattcccaggaatttatgatgctctgtttgatattgaaagcaaagt ggacccttccaaggcctggggagaagtgaagagacagatttatgttgcagccttcacagtgcaggcagctgcagagactt tgagtgaagtagcc
SEQ ID NO: 3. AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 1 SEQ ID NO: 4. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID
SEQUENCE OF PSMA SHUFFLED ANTIGEN 1 OF SEQ ID NO: 3
SEQ ID NO: 5. AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 2
SEQ ID NO: 6. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 2 OF SEQ ID NO:5
SEQ ID NO: 7. AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 3
SEQ ID NO: 8. NUCLEOTIDE SEQEUNCE ENCODING AMINO ACID SEQUENCE OF PSMA SHUFFLED ANTIGEN 3 OF SEQ ID NO:7
SEQ ID NO: 9. AMINO ACID SEQUENCE OF A MEMBRANE-BOUND PSMA ANTIGEN MASARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISI INEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLE RDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWN LPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLL EKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRG AVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWD AEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL KSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTK NWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDC RDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKS NPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIE SKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA SEQ ID NO: 10. NUCLEOTIDE SEQEUNCE ENCODING AMINO ACID
SEQUENCE OF THE MEMBRANE-BOUND PSMA ANTIGEN OF SEQ ID NO: 9 atggctagcgcgcgccgcccgcgctggctgtgcgctggggcgctggtgctggcgggtggcttctttctcctcggcttcctcttc gggtggtttataaaatcctccaatgaagctactaacattactccaaagcataatatgaaagcatttttggatgaattgaaagct g ag aacatcaag aag ttcttatataattttacacag ataccacatttag cag g aacag aacaaaactttcag cttg caaag caaattcaatcccagtggaaagaatttggcctggattctgttgagctggcacattatgatgtcctgttgtcctacccaaataag actcatcccaactacatctcaataattaatgaagatggaaatgagattttcaacacatcattatttgaaccacctcctccagg atatgaaaatgtttcggatattgtaccacctttcagtgctttctctcctcaaggaatgccagagggcgatctagtgtatgttaact atgcacgaactgaagacttctttaaattggaacgggacatgaaaatcaattgctctgggaaaattgtaattgccagatatgg gaaagttttcagaggaaataaggttaaaaatgcccagctggcaggggccaaaggagtcattctctactccgaccctgctg actactttgctcctggggtgaagtcctatccagatggttggaatcttcctggaggtggtgtccagcgtggaaatatcctaaatct gaatggtgcaggagaccctctcacaccaggttacccagcaaatgaatatgcttataggcgtggaattgcagaggctgttgg tcttccaagtattcctgttcatccaattggatactatgatgcacagaagctcctagaaaaaatgggtggctcagcaccacca gatagcagctggagaggaagtctcaaagtgccctacaatgttggacctggctttactggaaacttttctacacaaaaagtca agatgcacatccactctaccaatgaagtgacaagaatttacaatgtgataggtactctcagaggagcagtggaaccagac agatatgtcattctgggaggtcaccgggactcatgggtgtttggtggtattgaccctcagagtggagcagctgttgttcatgaa attgtgaggagctttggaacactgaaaaaggaagggtggagacctagaagaacaattttgtttgcaagctgggatgcaga agaatttggtcttcttggttctactgagtgggcagaggagaattcaagactccttcaagagcgtggcgtggcttatattaatgct g actcatctatag aagg aaactacactctg ag ag ttg attg tacaccg ctg atg tacag cttg g tacacaacctaacaaaa gagctgaaaagccctgatgaaggctttgaaggcaaatctctttatgaaagttggactaaaaaaagtccttccccagagttc agtggcatgcccaggataagcaaattgggatctggaaatgattttgaggtgttcttccaacgacttggaattgcttcaggcag agcacggtatactaaaaattgggaaacaaacaaattcagcggctatccactgtatcacagtgtctatgaaacatatgagtt ggtggaaaagttttatgatccaatgtttaaatatcacctcactgtggcccaggttcgaggagggatggtgtttgagctggcca attccatagtgctcccttttgattgtcgagattatgctgtagttttaagaaagtatgctgacaaaatctacagtatttctatgaaac atccacaggaaatgaagacatacagtgtatcatttgattcacttttttctgcagtaaagaattttacagaaattgcttccaagttc agtgagagactccaggactttgacaaaagcaacccaatagtattaagaatgatgaatgatcaactcatgtttctggaaaga gcatttattgatccattagggttaccagacaggcctttttataggcatgtcatctatgctccaagcagccacaacaagtatgca ggggagtcattcccaggaatttatgatgctctgtttgatattgaaagcaaagtggacccttccaaggcctggggagaagtga agagacagatttatgttgcagccttcacagtgcaggcagctgcagagactttgagtgaagtagcc SEQ ID NO: 11. AMINO ACID SEQUENCE OF A CYTOSOLIC PSMA ANTIGEN
SEQ ID NO: 12. NUCLEOTIDE SEQEUNCE ENCODING AMINO ACID SEQUENCE OF THE CYTOSOLIC PSMA ANTIGEN OF SEQ ID NO: 11
SEQ ID NO: 13. AMINO ACID SEQUENCE OF A SECRETED PSMA ANTIGEN
SEQ ID NO: 14. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF THE SECRETED PSMA ANTIGEN OF SEQ ID NO:13
SEQ ID NO: 15. AMINO ACID SEQUENCE OF THE FULL LENGTH HUMAN
PSA MASWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLV HPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRP GDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKL QCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITS WGSEPCALPERPSLYTKVVHYRKWIKDTIVANP SEQ ID NO: 16. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID
SEQUENCE OF THE FULL LENGTH HUMAN PSA OF SEQ ID NO: 15
atggctagctgggtcccggttgtcttcctcaccctgtccgtgacgtggattggcgctgcgcccctcatcctgtctcggattgtgg gaggctgggagtgcgagaagcattcccaaccctggcaggtgcttgtggcctctcgtggcagggcagtctgcggcggtgtt ctggtgcacccccagtgggtcctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagctt gtttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctctacgatatgagcctcctgaag aatcgattcctcaggccaggtgatgactccagccacgacctcatgctgctccgcctgtcagagcctgccgagctcacggat gctgtgaaggtcatggacctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcatt gaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttccaatgacgtgtgtgcgcaagttca ccctcagaaggtgaccaagttcatgctgtgtgctggacgctggacagggggcaaaagcacctgctcgggtgattctgggg gcccacttgtctgtaatggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggccttccctg tacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaacccc
SEQ ID NO: 17. AMINO ACID SEQUENCE OF A CYTOSOLIC PSA ANTIGEN MASIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRH SLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAV KVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTK FMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYR KWIKDTIVANP SEQ ID NO: 18. NUCLEOTIDE SEQEUNCE ENCODING AMINO ACID SEQUENCE OF THE CYTOSOLIC PSA ANTIGEN OF SEQ ID NO: 17
atggctagcattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtgcttgtggcctctcgtggcagggc agtctgcggcggtgttctggtgcacccccagtgggtcctcacagctgcccactgcatcaggaacaaaagcgtgatcttgct gggtcggcacagcttgtttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctctacgat atgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgacctcatgctgctccgcctgtcagagcct gccgagctcacggatgctgtgaaggtcatggacctgcccacccaggagccagcactggggaccacctgctacgcctca ggctggggcagcattgaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttccaatgacg tgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctggacgctggacagggggcaaaagcacctgc tcgggtgattctgggggcccacttgtctgtaatggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcc cgaaaggccttccctgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaacccc
SEQ ID NO: 19. AMINO ACID SEQUENCE OF A MEMBRANE-BOUND PSA ANTIGEN
MASARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPGIVGGWECEKHSQP WQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSH SFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTC YASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTC SGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
SEQ ID NO:20. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF THE MEMBRANE-BOUND PSA ANTIGEN OF SEQ ID NO:19
atggctagcgcgcgccgcccgcgctggctgtgcgctggggcgctggtgctggcgggtggcttctttctcctcggcttcctcttc gggtggtttataaaatcctccaatgaagctactaacattactccaggaattgtgggaggctgggagtgcgagaagcattcc caaccctggcaggtgcttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtcctcaca gctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcttgtttcatcctgaagacacaggccaggta tttcaggtcagccacagcttcccacacccgctctacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgact ccagccacgacctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggacctgcccacc caggagccagcactggggaccacctgctacgcctcaggctggggcagcattgaaccagaggagttcttgaccccaaag aaacttcagtgtgtggacctccatgttatttccaatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctg tgtgctggacgctggacagggggcaaaagcacctgctcgggtgattctgggggcccacttgtctgtaatggtgtgcttcaag gtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggccttccctgtacaccaaggtggtgcattaccggaagt g g atcaagg acaccatcg tgg ccaacccctg a
SEQ ID NO: 21. AMINO ACID SEQUENCE OF THE FULL LENGTH HUMAN
PSCA MASKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAV GLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLL LWGPGQL
SEQ ID NO: 22. NUCLEOTIDE SEQUENCE ENCODING AMINO ACID SEQUENCE OF THE FULL LENGTH HUMAN PSCA OF SEQ ID NO: 21
atggctagcaaggctgtgctgcttgccctgttgatggcaggcttggccctgcagccaggcactgccctgctgtgctactcctg caaagcccaggtgagcaacgaggactgcctgcaggtggagaactgcacccagctgggggagcagtgctggaccgcg eg catccg eg cagttgg cctcctg accgtcatcag caaagg ctg cag cttgaactg eg tgg atg actcacagg actacta cgtgggcaagaagaacatcacgtgctgtgacaccgacttgtgcaacgccagcggggcccatgccctgcagccggctgc cgccatccttgcgctgctccctgcactcggcctgctgctctggggacccggccagcta
SEQ ID NO:23. NUCLEOTIDE SEQUENCE OF PLASMID 5166
SEQ ID NO:24. NUCLEOTIDE SEQUENCE OF PLASMID 5259
SEQ ID NO:25. NUCLEOTIDE SEQUENCE OF PLASMID 5297
SEQ ID NO:26. NUCLEOTIDE SEQUENCE OF PLASMID 460
SEQ ID NO:27. NUCLEOTIDE SEQUENCE OF PLASMID 451
SEQ ID NO:28. NUCLEOTIDE SEQUENCE OF PLASMID 454
SEQ ID NO:29. NUCLEOTIDE SEQUENCE OF PLASMID 5300
SEQ ID NO:30. NUCLEOTIDE SEQUENCE OF PLASMID 449
SEQ ID NO:31. NUCLEOTIDE SEQUENCE OF PLASMID 603
SEQ ID NO:32. NUCLEOTIDE SEQUENCE OF PLASMID 455
SEQ ID NO:33. NUCLEOTIDE SEQUENCE OF PLASMID 456
SEQ ID NO:34. NUCLEOTIDE SEQUENCE OF PLASMID 457
SEQ ID NO:35. NUCLEOTIDE SEQUENCE OF PLASMID 458
GGCGTAATGCTCTGCCAGTGTTACAACCAATTAACCAATTCTGATTAGAAAAACTCA TCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATACCATATTTTT GAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATG GCAAGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTAT TAATTTCCCCTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGAC TGAATCCGGTGAGAATGGCAAAAGCTTATGCATTTCTTTCCAGACTTGTTCAACAGG CCAGCCATTACGCTCGTCATCAAAATCACTCGCATCAACCAAACCGTTATTCATTCG TGATTGCGCCTGAGCGAGACGAAATACGCGATCGCTGTTAAAAGGACAATTACAAA CAGGAATCAAATGCAACCGGCGCAGGAACACTGCCAGCGCATCAACAATATTTTCA CCTGAATCAGGATATTCTTCTAATACCTGGAATGCTGTTTTCCCGGGGATCGCAGT GGTGAGTAACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAGAG GCATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATTGGCAA CGCTACCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCTTCCCATACAAT CGATAGATTGTCGCACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCATA TAAATCAGCATCCATGTTGGAATTTAATCGCGGCCTCGAGCAAGACGTTTCCCGTT GAATATGGCTCATAACACCCCTTGTATTACTGTTTATGTAAGCAGACAGGTCGACAA T ATTG G CTATTGG CC ATTG C AT ACGTTGT ATCT AT ATC AT A AT ATGT AC ATTT ATATT GGCTCATGTCCAATATGACCGCCATGTTGACATTGATTATTGACTAGTTATTAATAG TAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAA CTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGT CAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAAT GGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATG CCAAGTCCGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATG CCCAGTACATGACCTTACGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCA TCGCTATTACCATGGTGATGCGGTTTTGGCAGTACACCAATGGGCGTGGATAGCG GTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGT TTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAATAACCCCGCCCCGTTG ACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTT TAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGA AGACACCGGGACCGATCCAGCCTCCGCGGCCGGGAACGGTGCATTGGAACGCGG ATTCCCCGTGCCAAGAGTGACTCACCGTCCGGATCTCAGCAAGCAGGTATGTACTC TCCAGGGTGGGCCTGGCTTCCCCAGTCAAGACTCCAGGGATTTGAGGGACGCTGT GGGCTCTTCTCTTACATGTACCTTTTGCTTGCCTCAACCCTGACTATCTTCCAGGTC AGGATCCCAGAGTCAGGGGTCTGTATTTTCCTGCTGGTGGCTCCAGTTCAGGAACA GTAAACCCTGCTCCGAATATTGCCTCTCACATCTCGTCAATCTCCGCGAGGACTGG GGACCCTGTGACGAACATGGCTAGCATTGTGGGAGGCTGGGAGTGCGAGAAGCAT TCCCAACCCTGGCAGGTGCTTGTGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGT GTTCTGGTGCACCCCCAGTGGGTCCTCACAGCTGCCCACTGCATCAGGAACAAAA GCGTGATCTTGCTGGGTCGGCACAGCTTGTTTCATCCTGAAGACACAGGCCAGGT ATTTCAGGTCAGCCACAGCTTCCCACACCCGCTCTACGATATGAGCCTCCTGAAGA ATCGATTCCTCAGGCCAGGTGATGACTCCAGCCACGACCTCATGCTGCTCCGCCT GTCAGAGCCTGCCGAGCTCACGGATGCTGTGAAGGTCATGGACCTGCCCACCCAG GAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGGCAGCATTGAACCA GAGGAGTTCTTGACCCCAAAGAAACTTCAGTGTGTGGACCTCCATGTTATTTCCAAT GACGTGTGTGCGCAAGTTCACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTG GACGCTGGACAGGGGGCAAAAGCACCTGCTCGGGTGATTCTGGGGGCCCACTTG TCTGTAATGGTGTGCTTCAAGGTATCACGTCATGGGGCAGTGAACCATGTGCCCTG CCCGAAAGGCCTTCCCTGTACACCAAGGTGGTGCATTACCGGAAGTGGATCAAGG ACACCATCGTGGCCAACCCCGGATCCGAAGGTAGGGGTTCATTATTGACCTGTGG AGATGTCGAAGAAAACCCAGGACCCGCTAGCAAGGCTGTGCTGCTTGCCCTGTTG ATGGCAGGCTTGGCCCTGCAGCCAGGCACTGCCCTGCTGTGCTACTCCTGCAAAG CCCAGGTGAGCAACGAGGACTGCCTGCAGGTGGAGAACTGCACCCAGCTGGGGG AGCAGTGCTGGACCGCGCGCATCCGCGCAGTTGGCCTCCTGACCGTCATCAGCAA AGGCTGCAGCTTGAACTGCGTGGATGACTCACAGGACTACTACGTGGGCAAGAAG AACATCACGTGCTGTGACACCGACTTGTGCAACGCCAGCGGGGCCCATGCCCTGC AGCCGGCTGCCGCCATCCTTGCGCTGCTCCCTGCACTCGGCCTGCTGCTCTGGG GACCCGGCCAGCTAGGATCCCAGACCCTGAACTTTGATCTGCTGAAACTGGCAGG CGATGTGGAAAGCAACCCAGGCCCAATGGCAAGCGCGCGCCGCCCGCGCTGGCT GTGCGCTGGGGCGCTGGTGCTGGCGGGTGGCTTCTTTCTCCTCGGCTTCCTCTTC GGGTGGTTTATAAAATCCTCCAATGAAGCTACTAACATTACTCCAAAGCATAATATG AAAGCATTTTTGGATGAATTGAAAGCTGAGAACATCAAGAAGTTCTTATATAATTTTA C AC AG AT ACC AC ATTT AG C AG G AAC AG AAC AA AACTTTCAG CTTG C AA AG C A AATTC AATCCCAGTGGAAAGAATTTGGCCTGGATTCTGTTGAGCTGGCACATTATGATGTC CTGTTGTCCTACCCAAATAAGACTCATCCCAACTACATCTCAATAATTAATGAAGAT GGAAATGAGATTTTCAACACATCATTATTTGAACCACCTCCTCCAGGATATGAAAAT GTTTCGGATATTGTACCACCTTTCAGTGCTTTCTCTCCTCAAGGAATGCCAGAGGG CGATCTAGTGTATGTTAACTATGCACGAACTGAAGACTTCTTTAAATTGGAACGGGA CATGAAAATCAATTGCTCTGGGAAAATTGTAATTGCCAGATATGGGAAAGTTTTCAG AG G A AATA AG GTT AAA AATG CCC AG CTG G C AG G G G CC AAAG G AGTC ATTCTCT ACT CCGACCCTGCTGACTACTTTGCTCCTGGGGTGAAGTCCTATCCAGATGGTTGGAAT CTTCCTGGAGGTGGTGTCCAGCGTGGAAATATCCTAAATCTGAATGGTGCAGGAGA CCCTCTCACACCAGGTTACCCAGCAAATGAATATGCTTATAGGCGTGGAATTGCAG AGGCTGTTGGTCTTCCAAGTATTCCTGTTCATCCAATTGGATACTATGATGCACAGA AGCTCCTAGAAAAAATGGGTGGCTCAGCACCACCAGATAGCAGCTGGAGAGGAAG TCTCAAAGTGCCCTACAATGTTGGACCTGGCTTTACTGGAAACTTTTCTACACAAAA AGTCAAGATGCACATCCACTCTACCAATGAAGTGACAAGAATTTACAATGTGATAGG TACTCTCAGAGGAGCAGTGGAACCAGACAGATATGTCATTCTGGGAGGTCACCGG GACTCATGGGTGTTTGGTGGTATTGACCCTCAGAGTGGAGCAGCTGTTGTTCATGA AATTGTGAGGAGCTTTGGAACACTGAAAAAGGAAGGGTGGAGACCTAGAAGAACA ATTTTGTTTGCAAGCTGGGATGCAGAAGAATTTGGTCTTCTTGGTTCTACTGAGTGG GCAGAGGAGAATTCAAGACTCCTTCAAGAGCGTGGCGTGGCTTATATTAATGCTGA CTCATCTATAGAAGGAAACTACACTCTGAGAGTTGATTGTACACCGCTGATGTACA GCTTGGTACACAACCTAACAAAAGAGCTGAAAAGCCCTGATGAAGGCTTTGAAGGC AAATCTCTTTATGAAAGTTGGACTAAAAAAAGTCCTTCCCCAGAGTTCAGTGGCATG CCCAGGATAAGCAAATTGGGATCTGGAAATGATTTTGAGGTGTTCTTCCAACGACT TG G A ATTG CTTC AG G C AG AG C ACG GT ATACT AAAA ATTG G G AAAC A AAC AAATTCA GCGGCTATCCACTGTATCACAGTGTCTATGAAACATATGAGTTGGTGGAAAAGTTTT ATGATCCAATGTTTAAATATCACCTCACTGTGGCCCAGGTTCGAGGAGGGATGGTG TTTGAGCTGGCCAATTCCATAGTGCTCCCTTTTGATTGTCGAGATTATGCTGTAGTT TTAAGAAAGTATGCTGACAAAATCTACAGTATTTCTATGAAACATCCACAGGAAATG AAGACATACAGTGTATCATTTGATTCACTTTTTTCTGCAGTAAAGAATTTTACAGAAA TTGCTTCCAAGTTCAGTGAGAGACTCCAGGACTTTGACAAAAGCAACCCAATAGTA TTAAGAATGATGAATGATCAACTCATGTTTCTGGAAAGAGCATTTATTGATCCATTA GGGTTACCAGACAGGCCTTTTTATAGGCATGTCATCTATGCTCCAAGCAGCCACAA CAAGTATGCAGGGGAGTCATTCCCAGGAATTTATGATGCTCTGTTTGATATTGAAAG CAAAGTGGACCCTTCCAAGGCCTGGGGAGAAGTGAAGAGACAGATTTATGTTGCA GCCTTCACAGTGCAGGCAGCTGCAGAGACTTTGAGTGAAGTAGCCTAAAGATCTG G G CCCT AAC AA AACA AAA AG ATG G G GTTATTCCCT AAACTTC ATG GGTTACGT AATT GGAAGTTGGGGGACATTGCCACAAGATCATATTGTACAAAAGATCAAACACTGTTTT AGAAAACTTCCTGTAAACAGGCCTATTGATTGGAAAGTATGTCAAAGGATTGTGGG TCTTTTGGGCTTTGCTGCTCCATTTACACAATGTGGATATCCTGCCTTAATGCCTTT GTATGCATGTATACAAGCTAAACAGGCTTTCACTTTCTCGCCAACTTACAAGGCCTT TCTAAGTAAACAGTACATGAACCTTTACCCCGTTGCTCGGCAACGGCCTGGTCTGT GCCAAGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCTTGGCCATAGGCCATCA GCGCATGCGTGGAACCTTTGTGGCTCCTCTGCCGATCCATACTGCGGAACTCCTA GCCGCTTGTTTTGCTCGCAGCCGGTCTGGAGCAAAGCTCATAGGAACTGACAATTC TGTCGTCCTCTCGCGGAAATATACATCGTTTCGATCTACGTATGATCTTTTTCCCTC TGCCAAAAATTATGGGGACATCATGAAGCCCCTTGAGCATCTGACTTCTGGCTAAT AAAGGAAATTTATTTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTCACTCGG AAGGAATTCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTAT TGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTG CGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAG GGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCG TAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCAT CACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATA CCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCG CTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAG CTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGT GTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTC TTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAA CAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGG CCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCC AGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTG GTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCT CAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTC ACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTT AAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGAC AGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCA TCCATAGTTGCCTGACTC
SEQ ID NO:36. NUCLEOTIDE SEQUENCE OF PLASMID 459
SEQ ID NO:37. NUCLEOTIDE SEQUENCE OF PSHUTTLE IRES
SEQ ID NO:38. Amino acid sequence of Her-2 antigen:
SEQ ID NO:39. Nucleic acid sequence encoding the Her-2 antigen amino acid sequence of SEQ ID NO: 38
SEQ ID NO:40. Amino acid sequence of heavy chain of the anti-CD40 antibody CP870,893:
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWV RQAPGQGLEWMGWINPDSGGTNYAQKFQGRVTMTRDTSISTAYMELNRLRSDDTAV YYCARDQPLGYCTNGVCSYFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYT CNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGK EYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK.
SEQ ID N0:41. Acid sequence of the light chain of the anti-CD40 antibody CP870,893:
MRLPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGIYSWLAWYQQ KPGKAPNLLIYTASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANIFPLTF GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC.
SEQ ID NO:42. Acid sequence of the heavy chain of the anti-CTLA-4 antibody Tremelimumab
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGS
NKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMD
VWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCC VECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGV EVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPM LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO:43. Acid sequence of the light chain of the anti-CTLA-4 antibody Tremelimumab
DIQMTQSPSSLSASVGDRVTITCRASQSINSYLDWYQQKPGKAPKLLIYAASSLQSGVP SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYSTPFTFGPGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO:44. Nucleotide sequence of CpG 7909
5' TCGTCGTTTTGTCGTTTTGTCGTT3'
SEQ ID NO:45. Nucleotide sequence of CpG 24555
5' TCGTCGTTTTTCGGTGCTTTT3'
SEQ ID NO:46. Nucleotide sequence of CpG 10103
5' TCGTCGTTTTTCGGTCGTTTT3'
SEQ ID NO:47. Amino acid sequence of eGFP
SEQ ID NO:48. Amino acid sequence of HBV core antigen SEQ ID NO:49. Amino acid sequence of HBV surface antigen
SEQ ID NO:50. Amino acid sequence of Rhesus PSMA ECD protein:
SEQ ID NO:51. Amino acid sequence of rat Her-2 p66 peptide (H-2d T cell epitope)
SEQ ID NO:52. Amino acid sequence of rat Her-2 p169 peptide (H-2d T cell epitope)
SEQ ID NO:53. Amino acid sequence of HBV core antigen p87 peptide SEQ ID NO:54. Amino acid sequence of a Rat Her-2 Antigen (rHer-2):
SEQ ID NO:55. Amino Acid Sequence of Rhesus PSMA antigen:
SEQ ID NO:56. Nucleotide sequence encoding the rhesus PSMA antigen of
SEQ ID NO: 55"
SEQ ID NO:57. Complete Genome of Simian Adenovirus 25 (C68)
ccatcttcaataatatacctcaaactttttgtgcgcgttaatatgcaaatgaggcgtttgaatttggggaggaagggcggtgatt ggtcgagggatgagcgaccgttaggggcggggcgagtgacgttttgatgacgtggttgcgaggaggagccagtttgcaa gttctcgtgggaaaagtgacgtcaaacgaggtgtggtttgaacacggaaatactcaattttcccgcgctctctgacaggaaa tgaggtgtttctgggcggatgcaagtgaaaacgggccattttcgcgcgaaaactgaatgaggaagtgaaaatctgagtaa tttcgcgtttatggcagggaggagtatttgccgagggccgagtagactttgaccgattacgtgggggtttcgattaccgtgttttt cacctaaatttccgcgtacggtgtcaaagtccggtgtttttacgtaggtgtcagctgatcgccagggtatttaaacctgcgctct ccagtcaagaggccactcttgagtgccagcgagaagagttttctcctccgcgccgcgagtcagatctacactttgaaagat gaggcacctgagagacctgcccgatgagaaaatcatcatcgcttccgggaacgagattctggaactggtggtaaatgcc atgatgggcgacgaccctccggagccccccaccccatttgagacaccttcgctgcacgatttgtatgatctggaggtggat gtgcccgaggacgatcccaatgaggaggcggtaaatgatttttttagcgatgccgcgctgctagctgccgaggaggcttcg ag ctctag ctcag acag eg actcttcactg catacccctag acccg g cag agg tg ag aaaaag atccccg ag cttaaag gggaagagatggacttgcgctgctatgaggaatgcttgcccccgagcgatgatgaggacgagcaggcgatccagaacg cagcgagccagggagtgcaagccgccagcgagagctttgcgctggactgcccgcctctgcccggacacggctgtaagt cttgtgaatttcatcgcatgaatactggagataaagctgtgttgtgtgcactttgctatatgagagcttacaaccattgtgtttaca gtaagtgtgattaagttgaactttagagggaggcagagagcagggtgactgggcgatgactggtttatttatgtatatatgttct ttatataggtcccgtctctgacgcagatgatgagacccccactacaaagtccacttcgtcacccccagaaattggcacatct ccacctgagaatattgttagaccagttcctgttagagccactgggaggagagcagctgtggaatgtttggatgacttgctac agggtggggttgaacctttggacttgtgtacccggaaacgccccaggcactaagtgccacacatgtgtgtttacttgaggtg atgtcagtatttatagggtgtggagtgcaataaaaaatgtgttgactttaagtgcgtggtttatgactcaggggtggggactgtg agtatataagcaggtgcagacctgtgtggttagctcagagcggcatggagatttggacggtcttggaagactttcacaaga ctagacagctgctagagaacgcctcgaacggagtctcttacctgtggagattctgcttcggtggcgacctagctaggctagt ctacagggccaaacaggattatagtgaacaatttgaggttattttgagagagtgttctggtctttttgacgctcttaacttgggcc atcagtctcactttaaccagaggatttcgagagcccttgattttactactcctggcagaaccactgcagcagtagccttttttgct tttattcttgacaaatggagtcaagaaacccatttcagcagggattaccagctggatttcttagcagtagctttgtggagaaca tggaagtgccagcgcctgaatgcaatctccggctacttgccggtacagccgctagacactctgaggatcctgaatctccag gagagtcccagggcacgccaacgtcgccagcagcagcagcaggaggaggatcaagaagagaacccgagagccg gcctggaccctccggcggaggaggaggagtagctgacctgtttcctgaactgcgccgggtgctgactaggtcttcgagtg gtcgggagagggggattaagcgggagaggcatgatgagactaatcacagaactgaactgactgtgggtctgatgagtc gcaagcgcccagaaacagtgtggtggcatgaggtgcagtcgactggcacagatgaggtgtcggtgatgcatgagaggtt ttctctagaacaagtcaagacttgttggttagagcctgaggatgattgggaggtagccatcaggaattatgccaagctggct ctgaggccagacaagaagtacaagattactaagctgataaatatcagaaatgcctgctacatctcagggaatggggctg aagtggagatctgtctccaggaaagggtggctttcagatgctgcatgatgaatatgtacccgggagtggtgggcatggatg gggttacctttatgaacatgaggttcaggggagatgggtataatggcacggtctttatggccaataccaagctgacagtcca tggctgctccttctttgggtttaataacacctgcatcgaggcctggggtcaggtcggtgtgaggggctgcagtttttcagccaa ctggatgggggtcgtgggcaggaccaagagtatgctgtccgtgaagaaatgcttgtttgagaggtgccacctgggggtgat gagcgagggcgaagccagaatccgccactgcgcctctaccgagacgggctgctttgtgctgtgcaagggcaatgctaag atcaagcataatatgatctgtggagcctcggacgagcgcggctaccagatgctgacctgcgccggcgggaacagccata tgctggccaccgtacatgtggcttcccatgctcgcaagccctggcccgagttcgagcacaatgtcatgaccaggtgcaata tgcatctggggtcccgccgaggcatgttcatgccctaccagtgcaacctgaattatgtgaaggtgctgctggagcccgatgc catgtccagagtgagcctgacgggggtgtttgacatgaatgtggaggtgtggaagattctgagatatgatgaatccaagac caggtgccgagcctgcgagtgcggagggaagcatgccaggttccagcccgtgtgtgtggatgtgacggaggacctgcg acccgatcatttggtgttgccctgcaccgggacggagttcggttccagcggggaagaatctgactagagtgagtagtgttct ggggcgggggaggacctgcatgagggccagaataactgaaatctgtgcttttctgtgtgttgcagcagcatgagcggaag cggctcctttgagggaggggtattcagcccttatctgacggggcgtctcccctcctgggcgggagtgcgtcagaatgtgatg ggatccacggtggacggccggcccgtgcagcccgcgaactcttcaaccctgacctatgcaaccctgagctcttcgtcgttg gacgcagctgccgccgcagctgctgcatctgccgccagcgccgtgcgcggaatggccatgggcgccggctactacggc actctggtggccaactcgagttccaccaataatcccgccagcctgaacgaggagaagctgttgctgctgatggcccagct cgaggccttgacccagcgcctgggcgagctgacccagcaggtggctcagctgcaggagcagacgcgggccgcggttg ccacggtgaaatccaaataaaaaatgaatcaataaataaacggagacggttgttgattttaacacagagtctgaatctttatt tgatttttcgcgcgcggtaggccctggaccaccggtctcgatcattgagcacccggtggatcttttccaggacccggtagag gtgggcttggatgttgaggtacatgggcatgagcccgtcccgggggtggaggtagctccattgcagggcctcgtgctcggg ggtggtgttgtaaatcacccagtcatagcaggggcgcagggcatggtgttgcacaatatctttgaggaggagactgatggc cacgggcagccctttggtgtaggtgtttacaaatctgttgagctgggagggatgcatgcggggggagatgaggtgcatcttg gcctggatcttgagattggcgatgttaccgcccagatcccgcctggggttcatgttgtgcaggaccaccagcacggtgtatc cggtgcacttggggaatttatcatgcaacttggaagggaaggcgtgaaagaatttggcgacgcctttgtgcccgcccaggtt ttccatgcactcatccatgatgatggcgatgggcccgtgggcggcggcctgggcaaagacgtttcgggggtcggacacat catagttgtggtcctgggtgaggtcatcataggccattttaatgaatttggggcggagggtgccggactgggggacaaaggt accctcgatcccgggggcgtagttcccctcacagatctgcatctcccaggctttgagctcggagggggggatcatgtccac ctgcggggcgataaagaacacggtttccggggcgggggagatgagctgggccgaaagcaagttccggagcagctgg gacttgccgcagccggtggggccgtagatgaccccgatgaccggctgcaggtggtagttgagggagagacagctgccg tcctcccggaggaggggggccacctcgttcatcatctcgcgcacgtgcatgttctcgcgcaccagttccgccaggaggcg ctctccccccagggataggagctcctggagcgaggcgaagtttttcagcggcttgagtccgtcggccatgggcattttggag agggtttgttgcaagagttccaggcggtcccagagctcggtgatgtgctctacggcatctcgatccagcagacctcctcgttt cgcgggttgggacggctgcgggagtagggcaccagacgatgggcgtccagcgcagccagggtccggtccttccagggt cgcagcgtccgcgtcagggtggtctccgtcacggtgaaggggtgcgcgccgggctgggcgcttgcgagggtgcgcttca ggctcatccggctggtcgaaaaccgctcccgatcggcgccctgcgcgtcggccaggtagcaattgaccatgagttcgtag ttgagcgcctcggccgcgtggcctttggcgcggagcttacctttggaagtctgcccgcaggcgggacagaggagggactt gagggcgtagagcttgggggcgaggaagacggactcgggggcgtaggcgtccgcgccgcagtgggcgcagacggtc tcgcactccacgagccaggtgaggtcgggctggtcggggtcaaaaaccagtttcccgccgttctttttgatgcgtttcttacctt tggtctccatgagctcgtgtccccgctgggtgacaaagaggctgtccgtgtccccgtagaccgactttatgggccggtcctc gagcggtgtgccgcggtcctcctcgtagaggaaccccgcccactccgagacgaaagcccgggtccaggccagcacga aggaggccacgtgggacgggtagcggtcgttgtccaccagcgggtccaccttttccagggtatgcaaacacatgtccccc tcgtccacatccaggaaggtgattggcttgtaagtgtaggccacgtgaccgggggtcccggccgggggggtataaaagg gtgcgggtccctgctcgtcctcactgtcttccggatcgctgtccaggagcgccagctgttggggtaggtattccctctcgaag gcgggcatgacctcggcactcaggttgtcagtttctagaaacgaggaggatttgatattgacggtgccggcggagatgcctt tcaagagcccctcgtccatctggtcagaaaagacgatctttttgttgtcgagcttggtggcgaaggagccgtagagggcgtt ggagaggagcttggcgatggagcgcatggtctggtttttttccttgtcggcgcgctccttggcggcgatgttgagctgcacgta ctcgcgcgccacgcacttccattcggggaagacggtggtcagctcgtcgggcacgattctgacctgccagccccgattatg cagggtgatgaggtccacactggtggccacctcgccgcgcaggggctcattagtccagcagaggcgtccgcccttgcgc gagcagaaggggggcagggggtccagcatgacctcgtcgggggggtcggcatcgatggtgaagatgccgggcagga ggtcggggtcaaagtagctgatggaagtggccagatcgtccagggcagcttgccattcgcgcacggccagcgcgcgctc gtagggactgaggggcgtgccccagggcatgggatgggtaagcgcggaggcgtacatgccgcagatgtcgtagacgt agaggggctcctcgaggatgccgatgtaggtggggtagcagcgccccccgcggatgctggcgcgcacgtagtcataca gctcgtgcgagggggcgaggagccccgggcccaggttggtgcgactgggcttttcggcgcggtagacgatctggcgga aaatggcatgcgagttggaggagatggtgggcctttggaagatgttgaagtgggcgtggggcagtccgaccgagtcgcg gatgaagtgggcgtaggagtcttgcagcttggcgacgagctcggcggtgactaggacgtccagagcgcagtagtcgag ggtctcctggatgatgtcatacttgagctgtcccttttgtttccacagctcgcggttgagaaggaactcttcgcggtccttccagt actcttcgagggggaacccgtcctgatctgcacggtaagagcctagcatgtagaactggttgacggccttgtaggcgcag cagcccttctccacggggagggcgtaggcctgggcggccttgcgcagggaggtgtgcgtgagggcgaaagtgtccctg accatgaccttgaggaactggtgcttgaagtcgatatcgtcgcagcccccctgctcccagagctggaagtccgtgcgcttct tgtaggcggggttgggcaaagcgaaagtaacatcgttgaagaggatcttgcccgcgcggggcataaagttgcgagtgat gcggaaaggttggggcacctcggcccggttgttgatgacctgggcggcgagcacgatctcgtcgaagccgttgatgttgtg gcccacgatgtagagttccacgaatcgcggacggcccttgacgtggggcagtttcttgagctcctcgtaggtgagctcgtcg gggtcgctgagcccgtgctgctcgagcgcccagtcggcgagatgggggttggcgcggaggaaggaagtccagagatc cacggccagggcggtttgcagacggtcccggtactgacggaactgctgcccgacggccattttttcgggggtgacgcagt agaaggtgcgggggtccccgtgccagcgatcccatttgagctggagggcgagatcgagggcgagctcgacgagccgg tcgtccccggagagtttcatgaccagcatgaaggggacgagctgcttgccgaaggaccccatccaggtgtaggtttccac atcgtaggtgaggaagagcctttcggtgcgaggatgcgagccgatggggaagaactggatctcctgccaccaattggag gaatggctgttgatgtgatggaagtagaaatgccgacggcgcgccgaacactcgtgcttgtgtttatacaagcggccacag tgctcgcaacgctgcacgggatgcacgtgctgcacgagctgtacctgagttcctttgacgaggaatttcagtgggaagtgg agtcgtggcgcctgcatctcgtgctgtactacgtcgtggtggtcggcctggccctcttctgcctcgatggtggtcatgctgacg agcccgcgcgggaggcaggtccagacctcggcgcgagcgggtcggagagcgaggacgagggcgcgcaggccgga gctgtccagggtcctgagacgctgcggagtcaggtcagtgggcagcggcggcgcgcggttgacttgcaggagtttttcca gggcgcgcgggaggtccagatggtacttgatctccaccgcgccattggtggcgacgtcgatggcttgcagggtcccgtgc ccctggggtgtgaccaccgtcccccgtttcttcttgggcggctggggcgacgggggcggtgcctcttccatggttagaagcg gcggcgaggacgcgcgccgggcggcaggggcggctcggggcccggaggcaggggcggcaggggcacgtcggcg ccgcgcgcgggtaggttctggtactgcgcccggagaagactggcgtgagcgacgacgcgacggttgacgtcctggatct gacgcctctgggtgaaggccacgggacccgtgagtttgaacctgaaagagagttcgacagaatcaatctcggtatcgttg acggcggcctgccgcaggatctcttgcacgtcgcccgagttgtcctggtaggcgatctcggtcatgaactgctcgatctcctc ctcttgaaggtctccgcggccggcgcgctccacggtggccgcgaggtcgttggagatgcggcccatgagctgcgagaag gcgttcatgcccgcctcgttccagacgcggctgtagaccacgacgccctcgggatcgccggcgcgcatgaccacctggg cgaggttgagctccacgtggcgcgtgaagaccgcgtagttgcagaggcgctggtagaggtagttgagcgtggtggcgat gtgctcggtgacgaagaaatacatgatccagcggcggagcggcatctcgctgacgtcgcccagcgcctccaaacgttcc atggcctcgtaaaagtccacggcgaagttgaaaaactgggagttgcgcgccgagacggtcaactcctcctccagaagac ggatgagctcggcgatggtggcgcgcacctcgcgctcgaaggcccccgggagttcctccacttcctcttcttcctcctccact aacatctcttctacttcctcctcaggcggcagtggtggcgggggagggggcctgcgtcgccggcggcgcacgggcagac ggtcgatgaagcgctcgatggtctcgccgcgccggcgtcgcatggtctcggtgacggcgcgcccgtcctcgcggggccg cagcgtgaagacgccgccgcgcatctccaggtggccgggggggtccccgttgggcagggagagggcgctgacgatgc atcttatcaattgccccgtagggactccgcgcaaggacctgagcgtctcgagatccacgggatctgaaaaccgctgaacg aaggcttcgagccagtcgcagtcgcaaggtaggctgagcacggtttcttctggcgggtcatgttggttgggagcggggcgg gcgatgctgctggtgatgaagttgaaataggcggttctgagacggcggatggtggcgaggagcaccaggtctttgggccc ggcttgctggatgcgcagacggtcggccatgccccaggcgtggtcctgacacctggccaggtccttgtagtagtcctgcat gagccgctccacgggcacctcctcctcgcccgcgcggccgtgcatgcgcgtgagcccgaagccgcgctggggctggac gagcgccaggtcggcgacgacgcgctcggcgaggatggcttgctggatctgggtgagggtggtctggaagtcatcaaag tcgacgaagcggtggtaggctccggtgttgatggtgtaggagcagttggccatgacggaccagttgacggtctggtggccc ggacgcacgagctcgtggtacttgaggcgcgagtaggcgcgcgtgtcgaagatgtagtcgttgcaggtgcgcaccaggt actggtagccgatgaggaagtgcggcggcggctggcggtagagcggccatcgctcggtggcgggggcgccgggcgc gaggtcctcgagcatggtgcggtggtagccgtagatgtacctggacatccaggtgatgccggcggcggtggtggaggcg cgcgggaactcgcggacgcggttccagatgttgcgcagcggcaggaagtagttcatggtgggcacggtctggcccgtga ggcgcgcgcagtcgtggatgctctatacgggcaaaaacgaaagcggtcagcggctcgactccgtggcctggaggctaa gcgaacgggttgggctgcgcgtgtaccccggttcgaatctcgaatcaggctggagccgcagctaacgtggtattggcactc ccgtctcgacccaagcctgcaccaaccctccaggatacggaggcgggtcgttttgcaacttttttttggaggccggatgaga ctagtaagcgcggaaagcggccgaccgcgatggctcgctgccgtagtctggagaagaatcgccagggttgcgttgcggt gtgccccggttcgaggccggccggattccgcggctaacgagggcgtggctgccccgtcgtttccaagaccccatagcca gccgacttctccagttacggagcgagcccctcttttgttttgtttgtttttgccagatgcatcccgtactgcggcagatgcgcccc caccaccctccaccg caacaacag ccccctccacag ccg g eg cttctg cccccg ccccag cag caacttccag ccacg accgccgcggccgccgtgagcggggctggacagagttatgatcaccagctggccttggaagagggcgaggggctggc gcgcctgggggcgtcgtcgccggagcggcacccgcgcgtgcagatgaaaagggacgctcgcgaggcctacgtgccc aagcagaacctgttcagagacaggagcggcgaggagcccgaggagatgcgcgcggcccggttccacgcggggcgg gagctgcggcgcggcctggaccgaaagagggtgctgagggacgaggatttcgaggcggacgagctgacggggatca gccccgcgcgcgcgcacgtggccgcggccaacctggtcacggcgtacgagcagaccgtgaaggaggagagcaactt ccaaaaatccttcaacaaccacgtgcgcaccctgatcgcgcgcgaggaggtgaccctgggcctgatgcacctgtgggac ctgctggaggccatcgtgcagaaccccaccagcaagccgctgacggcgcagctgttcctggtggtgcagcatagtcggg acaacgaagcgttcagggaggcgctgctgaatatcaccgagcccgagggccgctggctcctggacctggtgaacattct gcagagcatcgtggtgcaggagcgcgggctgccgctgtccgagaagctggcggccatcaacttctcggtgctgagtttgg gcaagtactacgctaggaagatctacaagaccccgtacgtgcccatagacaaggaggtgaagatcgacgggttttacat gcgcatgaccctgaaagtgctgaccctgagcgacgatctgggggtgtaccgcaacgacaggatgcaccgtgcggtgag cgccagcaggcggcgcgagctgagcgaccaggagctgatgcatagtctgcagcgggccctgaccggggccgggacc gagggggagagctactttgacatgggcgcggacctgcactggcagcccagccgccgggccttggaggcggcggcagg accctacgtagaagaggtggacgatgaggtggacgaggagggcgagtacctggaagactgatggcgcgaccgtattttt gctagatgcaacaacaacagccacctcctgatcccgcgatgcgggcggcgctgcagagccagccgtccggcattaact cctcg g acg attg g acccagg ccatg caacg catcatg g eg ctg acg acccg caaccccg aag cctttag acag cag c cccaggccaaccggctctcggccatcctggaggccgtggtgccctcgcgctccaaccccacgcacgagaaggtcctgg ccatcgtgaacgcgctggtggagaacaaggccatccgcggcgacgaggccggcctggtgtacaacgcgctgctggag cgcgtggcccgctacaacagcaccaacgtgcagaccaacctggaccgcatggtgaccgacgtgcgcgaggccgtggc ccagcgcgagcggttccaccgcgagtccaacctgggatccatggtggcgctgaacgccttcctcagcacccagcccgcc aacgtgccccggggccaggaggactacaccaacttcatcagcgccctgcgcctgatggtgaccgaggtgccccagagc gaggtgtaccagtccgggccggactacttcttccagaccagtcgccagggcttgcagaccgtgaacctgagccaggcttt caagaacttgcagggcctgtggggcgtgcaggccccggtcggggaccgcgcgacggtgtcgagcctgctgacgccga actcgcgcctgctgctgctgctggtggcccccttcacggacagcggcagcatcaaccgcaactcgtacctgggctacctg attaacctgtaccgcgaggccatcggccaggcgcacgtggacgagcagacctaccaggagatcacccacgtgagccg cgccctgggccaggacgacccgggcaacctggaagccaccctgaactttttgctgaccaaccggtcgcagaagatccc gccccagtacgcgctcagcaccgaggaggagcgcatcctgcgttacgtgcagcagagcgtgggcctgttcctgatgcag gagggggccacccccagcgccgcgctcgacatgaccgcgcgcaacatggagcccagcatgtacgccagcaaccgcc cgttcatcaataaactgatggactacttgcatcgggcggccgccatgaactctgactatttcaccaacgccatcctgaatccc cactggctcccgccgccggggttctacacgggcgagtacgacatgcccgaccccaatgacgggttcctgtgggacgatgt ggacagcagcgtgttctccccccgaccgggtgctaacgagcgccccttgtggaagaaggaaggcagcgaccgacgcc cgtcctcggcgctgtccggccgcgagggtgctgccgcggcggtgcccgaggccgccagtcctttcccgagcttgcccttct cgctgaacagtatccgcagcagcgagctgggcaggatcacgcgcccgcgcttgctgggcgaagaggagtacttgaatg actcgctgttgagacccgagcgggagaagaacttccccaataacgggatagaaagcctggtggacaagatgagccgct ggaagacgtatgcgcaggagcacagggacgatccccgggcgtcgcagggggccacgagccggggcagcgccgcc cgtaaacgccggtggcacgacaggcagcggggacagatgtgggacgatgaggactccgccgacgacagcagcgtgt tggacttgggtgggagtggtaacccgttcgctcacctgcgcccccgtatcgggcgcatgatgtaagagaaaccgaaaata aatgatactcaccaaggccatggcgaccagcgtgcgttcgtttcttctctgttgttgttgtatctagtatgatgaggcgtgcgtac ccggagggtcctcctccctcgtacgagagcgtgatgcagcaggcgatggcggcggcggcgatgcagcccccgctgga ggctccttacgtgcccccgcggtacctggcgcctacggaggggcggaacagcattcgttactcggagctggcacccttgta cgataccacccggttgtacctggtggacaacaagtcggcggacatcgcctcgctgaactaccagaacgaccacagcaa cttcctgaccaccgtggtgcagaacaatgacttcacccccacggaggccagcacccagaccatcaactttgacgagcgc tcgcggtggggcggccagctgaaaaccatcatgcacaccaacatgcccaacgtgaacgagttcatgtacagcaacaag ttcaaggcgcgggtgatggtctcccgcaagacccccaatggggtgacagtgacagaggattatgatggtagtcaggatg agctgaagtatgaatgggtggaatttgagctgcccgaaggcaacttctcggtgaccatgaccatcgacctgatgaacaac gccatcatcgacaattacttggcggtggggcggcagaacggggtgctggagagcgacatcggcgtgaagttcgacacta ggaacttcaggctgggctgggaccccgtgaccgagctggtcatgcccggggtgtacaccaacgaggctttccatcccgat attgtcttgctgcccggctgcggggtggacttcaccgagagccgcctcagcaacctgctgggcattcgcaagaggcagcc cttccaggaaggcttccagatcatgtacgaggatctggaggggggcaacatccccgcgctcctggatgtcgacgcctatg agaaaagcaaggaggatgcagcagctgaagcaactgcagccgtagctaccgcctctaccgaggtcaggggcgataat tttgcaagcgccgcagcagtggcagcggccgaggcggctgaaaccgaaagtaagatagtcattcagccggtggagaa ggatagcaagaacaggagctacaacgtactaccggacaagataaacaccgcctaccgcagctggtacctagcctaca actatggcgaccccgagaagggcgtgcgctcctggacgctgctcaccacctcggacgtcacctgcggcgtggagcaagt ctactggtcgctgcccgacatgatgcaagacccggtcaccttccgctccacgcgtcaagttagcaactacccggtggtggg eg ccg ag ctcctg cccg tctactccaag ag cttcttcaacg ag cagg ccg tctactcg cag cag ctg eg eg ccttcacctc gcttacgcacgtcttcaaccgcttccccgagaaccagatcctcgtccgcccgcccgcgcccaccattaccaccgtcagtga aaacgttcctgctctcacagatcacgggaccctgccgctgcgcagcagtatccggggagtccagcgcgtgaccgttactg acgccagacgccgcacctgcccctacgtctacaaggccctgggcatagtcgcgccgcgcgtcctctcgagccgcacctt ctaaatgtccattctcatctcgcccagtaataacaccggttggggcctgcgcgcgcccagcaagatgtacggaggcgctc gccaacgctccacgcaacaccccgtgcgcgtgcgcgggcacttccgcgctccctggggcgccctcaagggccgcgtgc ggtcgcgcaccaccgtcgacgacgtgatcgaccaggtggtggccgacgcgcgcaactacacccccgccgccgcgccc gtctccaccgtggacgccgtcatcgacagcgtggtggcggacgcgcgccggtacgcccgcgccaagagccggcggcg gcgcatcgcccggcggcaccggagcacccccgccatgcgcgcggcgcgagccttgctgcgcagggccaggcgcacg ggacgcagggccatgctcagggcggccagacgcgcggcttcaggcgccagcgccggcaggacccggagacgcgcg gccacggcggcggcagcggccatcgccagcatgtcccgcccgcggcgagggaacgtgtactgggtgcgcgacgccg ccaccggtgtgcgcgtgcccgtgcgcacccgcccccctcgcacttgaagatgttcacttcgcgatgttgatgtgtcccagcg gcgaggaggatgtccaagcgcaaattcaaggaagagatgctccaggtcatcgcgcctgagatctacggccctgcggtg gtgaaggaggaaagaaagccccgcaaaatcaagcgggtcaaaaaggacaaaaaggaagaagaaagtgatgtgga cggattggtggagtttgtgcgcgagttcgccccccggcggcgcgtgcagtggcgcgggcggaaggtgcaaccggtgctg agacccggcaccaccgtggtcttcacgcccggcgagcgctccggcaccgcttccaagcgctcctacgacgaggtgtacg gggatgatgatattctggagcaggcggccgagcgcctgggcgagtttgcttacggcaagcgcagccgttccgcaccgaa ggaagaggcggtgtccatcccgctggaccacggcaaccccacgccgagcctcaagcccgtgaccttgcagcaggtgct gccgaccgcggcgccgcgccgggggttcaagcgcgagggcgaggatctgtaccccaccatgcagctgatggtgccca agcgccagaagctggaagacgtgctggagaccatgaaggtggacccggacgtgcagcccgaggtcaaggtgcggcc catcaagcaggtggccccgggcctgggcgtgcagaccgtggacatcaagattcccacggagcccatggaaacgcaga ccgagcccatgatcaagcccagcaccagcaccatggaggtgcagacggatccctggatgccatcggctcctagtcgaa gaccccggcgcaagtacggcgcggccagcctgctgatgcccaactacgcgctgcatccttccatcatccccacgccggg ctaccg egg cacg eg cttctaccg eg g tcataccag cag ccg ccg ccg caag accaccactcg ccg ccg ccg teg ccg caccgccgctgcaaccacccctgccgccctggtgcggagagtgtaccgccgcggccgcgcacctctgaccctgccgcg cgcgcgctaccacccgagcatcgccatttaaactttcgccagctttgcagatcaatggccctcacatgccgccttcgcgttcc cattacgggctaccgaggaagaaaaccgcgccgtagaaggctggcggggaacgggatgcgtcgccaccaccaccgg cggcggcgcgccatcagcaagcggttggggggaggcttcctgcccgcgctgatccccatcatcgccgcggcgatcggg gcgatccccggcattgcttccgtggcggtgcaggcctctcagcgccactgagacacacttggaaacatcttgtaataaacc catggactctgacgctcctggtcctgtgatgtgttttcgtagacagatggaagacatcaatttttcgtccctggctccgcgacac ggcacgcggccgttcatgggcacctggagcgacatcggcaccagccaactgaacgggggcgccttcaattggagcagt ctctggagcgggcttaagaatttcgggtccacgcttaaaacctatggcagcaaggcgtggaacagcaccacagggcag gcgctgagggataagctgaaagagcagaacttccagcagaaggtggtcgatgggctcgcctcgggcatcaacggggtg gtggacctggccaaccaggccgtgcagcggcagatcaacagccgcctggacccggtgccgcccgccggctccgtgga gatgccgcaggtggaggaggagctgcctcccctggacaagcggggcgagaagcgaccccgccccgatgcggagga gacgctgctgacgcacacggacgagccgcccccgtacgaggaggcggtgaaactgggtctgcccaccacgcggccc atcgcgcccctggccaccggggtgctgaaacccgaaaagcccgcgaccctggacttgcctcctccccagccttcccgcc cctctacagtggctaagcccctgccgccggtggccgtggcccgcgcgcgacccgggggcaccgcccgccctcatgcga actggcagagcactctgaacagcatcgtgggtctgggagtgcagagtgtgaagcgccgccgctgctattaaacctaccgt agcgcttaacttgcttgtctgtgtgtgtatgtattatgtcgccgccgccgctgtccaccagaaggaggagtgaagaggcgcgt cgccgagttgcaagatggccaccccatcgatgctgccccagtgggcgtacatgcacatcgccggacaggacgcttcgga gtacctgagtccgggtctggtgcagtttgcccgcgccacagacacctacttcagtctggggaacaagtttaggaaccccac ggtggcgcccacgcacgatgtgaccaccgaccgcagccagcggctgacgctgcgcttcgtgcccgtggaccgcgagg acaacacctactcgtacaaagtgcgctacacgctggccgtgggcgacaaccgcgtgctggacatggccagcacctacttt gacatccgcggcgtgctggatcggggccctagcttcaaaccctactccggcaccgcctacaacagtctggcccccaagg gagcacccaacacttgtcagtggacatataaagccgatggtgaaactgccacagaaaaaacctatacatatggaaatgc acccgtgcagggcattaacatcacaaaagatggtattcaacttggaactgacaccgatgatcagccaatctacgcagata aaacctatcagcctgaacctcaagtgggtgatgctgaatggcatgacatcactggtactgatgaaaagtatggaggcaga gctcttaagcctgataccaaaatgaagccttgttatggttcttttgccaagcctactaataaagaaggaggtcaggcaaatgt gaaaacaggaacaggcactactaaagaatatgacatagacatggctttctttgacaacagaagtgcggctgctgctggcc tagctccagaaattgttttgtatactgaaaatgtggatttggaaactccagatacccatattgtatacaaagcaggcacagat gacagcagctcttctattaatttgggtcagcaagccatgcccaacagacctaactacattggtttcagagacaactttatcgg gctcatgtactacaacagcactggcaatatgggggtgctggccggtcaggcttctcagctgaatgctgtggttgacttgcaa gacagaaacaccgagctgtcctaccagctcttgcttgactctctgggtgacagaacccggtatttcagtatgtggaatcagg cggtggacagctatgatcctgatgtgcgcattattgaaaatcatggtgtggaggatgaacttcccaactattgtttccctctgga tgctgttggcagaacagatacttatcagggaattaaggctaatggaactgatcaaaccacatggaccaaagatgacagtg tcaatgatgctaatgagataggcaagggtaatccattcgccatggaaatcaacatccaagccaacctgtggaggaacttc ctctacg ccaacgtgg ccctgtacctg cccg actcttacaag tacacg ccgg ccaatg ttaccctg cccaccaacaccaa cacctacgattacatgaacggccgggtggtggcgccctcgctggtggactcctacatcaacatcggggcgcgctggtcgc tggatcccatggacaacgtgaaccccttcaaccaccaccgcaatgcggggctgcgctaccgctccatgctcctgggcaa cgggcgctacgtgcccttccacatccaggtgccccagaaatttttcgccatcaagagcctcctgctcctgcccgggtcctac acctacgagtggaacttccgcaaggacgtcaacatgatcctgcagagctccctcggcaacgacctgcgcacggacggg g cctccatctccttcaccag catcaacctctacg ccaccttcttccccatg g eg cacaacacg g cctccacg ctcg agg cc atgctgcgcaacgacaccaacgaccagtccttcaacgactacctctcggcggccaacatgctctaccccatcccggcca acgccaccaacgtgcccatctccatcccctcgcgcaactgggccgccttccgcggctggtccttcacgcgtctcaagacca aggagacgccctcgctgggctccgggttcgacccctacttcgtctactcgggctccatcccctacctcgacggcaccttcta cctcaaccacaccttcaagaaggtctccatcaccttcgactcctccgtcagctggcccggcaacgaccggctcctgacgc ccaacgagttcgaaatcaagcgcaccgtcgacggcgagggctacaacgtggcccagtgcaacatgaccaaggactgg ttcctggtccagatgctggcccactacaacatcggctaccagggcttctacgtgcccgagggctacaaggaccgcatgtac tccttcttccgcaacttccagcccatgagccgccaggtggtggacgaggtcaactacaaggactaccaggccgtcaccct ggcctaccagcacaacaactcgggcttcgtcggctacctcgcgcccaccatgcgccagggccagccctaccccgccaa ctacccctacccgctcatcggcaagagcgccgtcaccagcgtcacccagaaaaagttcctctgcgacagggtcatgtgg cgcatccccttctccagcaacttcatgtccatgggcgcgctcaccgacctcggccagaacatgctctatgccaactccgcc cacgcgctagacatgaatttcgaagtcgaccccatggatgagtccacccttctctatgttgtcttcgaagtcttcgacgtcgtc cgagtgcaccagccccaccgcggcgtcatcgaggccgtctacctgcgcacccccttctcggccggtaacgccaccacct aagctcttgcttcttgcaagccatggccgcgggctccggcgagcaggagctcagggccatcatccgcgacctgggctgcg ggccctacttcctgggcaccttcgataagcgcttcccgggattcatggccccgcacaagctggcctgcgccatcgtcaaca cggccggccgcgagaccgggggcgagcactggctggccttcgcctggaacccgcgctcgaacacctgctacctcttcg accccttcgggttctcggacgagcgcctcaagcagatctaccagttcgagtacgagggcctgctgcgccgcagcgccctg gccaccgaggaccgctgcgtcaccctggaaaagtccacccagaccgtgcagggtccgcgctcggccgcctgcgggctc ttctgctgcatgttcctgcacgccttcgtgcactggcccgaccgccccatggacaagaaccccaccatgaacttgctgacg ggggtgcccaacggcatgctccagtcgccccaggtggaacccaccctgcgccgcaaccaggaggcgctctaccgcttc ctcaactcccactccg cctactttcg ctcccaccg eg eg eg catcg ag aagg ccaccg ccttcg accg catg aatcaag a catgtaaaccgtgtgtgtatgttaaatgtctttaataaacagcactttcatgttacacatgcatctgagatgatttatttagaaatc gaaagggttctgccgggtctcggcatggcccgcgggcagggacacgttgcggaactggtacttggccagccacttgaact cggggatcagcagtttgggcagcggggtgtcggggaaggagtcggtccacagcttccgcgtcagttgcagggcgccca gcaggtcgggcgcggagatcttgaaatcgcagttgggacccgcgttctgcgcgcgggagttgcggtacacggggttgca gcactggaacaccatcagggccgggtgcttcacgctcgccagcaccgtcgcgtcggtgatgctctccacgtcgaggtcct cggcgttggccatcccgaagggggtcatcttgcaggtctgccttcccatggtgggcacgcacccgggcttgtggttgcaatc gcagtgcagggggatcagcatcatctgggcctggtcggcgttcatccccgggtacatggccttcatgaaagcctccaattg cctgaacgcctgctgggccttggctccctcggtgaagaagaccccgcaggacttgctagagaactggttggtggcgcacc cggcgtcgtgcacgcagcagcgcgcgtcgttgttggccagctgcaccacgctgcgcccccagcggttctgggtgatcttgg cccggtcggggttctccttcagcgcgcgctgcccgttctcgctcgccacatccatctcgatcatgtgctccttctggatcatggt ggtcccgtgcaggcaccgcagcttgccctcggcctcggtgcacccgtgcagccacagcgcgcacccggtgcactccca gttcttgtgggcgatctgggaatgcgcgtgcacgaagccctgcaggaagcggcccatcatggtggtcagggtcttgttgcta gtgaaggtcagcggaatgccgcggtgctcctcgttgatgtacaggtggcagatgcggcggtacacctcgccctgctcggg catcagctggaagttggctttcaggtcggtctccacgcggtagcggtccatcagcatagtcatgatttccatacccttctccca ggccgagacgatgggcaggctcatagggttcttcaccatcatcttagcgctagcagccgcggccagggggtcgctctcgt ccagggtctcaaagctccgcttgccgtccttctcggtgatccgcaccggggggtagctgaagcccacggccgccagctcc tcctcggcctgtctttcgtcctcgctgtcctggctgacgtcctgcaggaccacatgcttggtcttgcggggtttcttcttgggcggc agcggcggcggagatgttggagatggcgagggggagcgcgagttctcgctcaccactactatctcttcctcttcttggtccg aggccacgcggcggtaggtatgtctcttcgggggcagaggcggaggcgacgggctctcgccgccgcgacttggcggat ggctggcagagccccttccgcgttcgggggtgcgctcccggcggcgctctgactgacttcctccgcggccggccattgtgtt ctcctagggaggaacaacaagcatggagactcagccatcgccaacctcgccatctgcccccaccgccgacgagaagc ag cag cag cag aatg aaag cttaaccg ccccg ccg cccag ccccg ccacctccg acg eg g ccg tcccag acatg ca agagatggaggaatccatcgagattgacctgggctatgtgacgcccgcggagcacgaggaggagctggcagtgcgcttt tcacaagaagagatacaccaagaacagccagagcaggaagcagagaatgagcagagtcaggctgggctcgagcat gacggcgactacctccacctgagcgggggggaggacgcgctcatcaagcatctggcccggcaggccaccatcgtcaa ggatgcgctgctcgaccgcaccgaggtgcccctcagcgtggaggagctcagccgcgcctacgagttgaacctcttctcgc cgcgcgtgccccccaagcgccagcccaatggcacctgcgagcccaacccgcgcctcaacttctacccggtcttcgcggt g cccg ag g ccctgg ccacctaccacatctttttcaag aaccaaaag atccccg tctcctg ccg eg ccaaccg cacccg c gccgacgcccttttcaacctgggtcccggcgcccgcctacctgatatcgcctccttggaagaggttcccaagatcttcgagg gtctgggcagcgacgagactcgggccgcgaacgctctgcaaggagaaggaggagagcatgagcaccacagcgccct ggtcgagttggaaggcgacaacgcgcggctggcggtgctcaaacgcacggtcgagctgacccatttcgcctacccggct ctgaacctgccccccaaagtcatgagcgcggtcatggaccaggtgctcatcaagcgcgcgtcgcccatctccgaggacg agggcatgcaagactccgaggagggcaagcccgtggtcagcgacgagcagctggcccggtggctgggtcctaatgct agtccccagagtttggaagagcggcgcaaactcatgatggccgtggtcctggtgaccgtggagctggagtgcctgcgcc gcttcttcgccgacgcggagaccctgcgcaaggtcgaggagaacctgcactacctcttcaggcacgggttcgtgcgccag gcctgcaagatctccaacgtggagctgaccaacctggtctcctacatgggcatcttgcacgagaaccgcctggggcaga acgtgctgcacaccaccctgcgcggggaggcccggcgcgactacatccgcgactgcgtctacctctacctctgccacac ctggcagacgggcatgggcgtgtggcagcagtgtctggaggagcagaacctgaaagagctctgcaagctcctgcagaa gaacctcaagggtctgtggaccgggttcgacgagcgcaccaccgcctcggacctggccgacctcattttccccgagcgc ctcaggctgacgctgcgcaacggcctgcccgactttatgagccaaagcatgttgcaaaactttcgctctttcatcctcgaacg ctccg g aatcctg cccg ccacctg ctccg eg ctg ccctcg g acttcg tg ccg ctg accttccg eg ag tg ccccccg ccg ct gtggagccactgctacctgctgcgcctggccaactacctggcctaccactcggacgtgatcgaggacgtcagcggcgag g g cctg ctcg ag tg ccactg ccg ctg caacctctg cacg ccg caccg ctccctg g cctg caacccccag ctg ctg ag eg agacccagatcatcggcaccttcgagttgcaagggcccagcgaaggcgagggttcagccgccaaggggggtctgaaa ctcaccccggggctgtggacctcggcctacttgcgcaagttcgtgcccgaggactaccatcccttcgagatcaggttctacg aggaccaatcccatccgcccaaggccgagctgtcggcctgcgtcatcacccagggggcgatcctggcccaattgcaag ccatccagaaatcccgccaagaattcttgctgaaaaagggccgcggggtctacctcgacccccagaccggtgaggagc tcaaccccggcttcccccaggatgccccgaggaaacaagaagctgaaagtggagctgccgcccgtggaggatttggag gaagactgggagaacagcagtcaggcagaggaggaggagatggaggaagactgggacagcactcaggcagagg aggacagcctgcaagacagtctggaggaagacgaggaggaggcagaggaggaggtggaagaagcagccgccgc cagaccgtcgtcctcggcgggggagaaagcaagcagcacggataccatctccgctccgggtcggggtcccgctcgacc acacagtagatgggacgagaccggacgattcccgaaccccaccacccagaccggtaagaaggagcggcagggata caagtcctggcgggggcacaaaaacgccatcgtctcctgcttgcaggcctgcgggggcaacatctccttcacccggcgct acctgctcttccaccgcggggtgaactttccccgcaacatcttgcattactaccgtcacctccacagcccctactacttccaa gaagaggcagcagcagcagaaaaagaccagcagaaaaccagcagctagaaaatccacagcggcggcagcaggt ggactgaggatcgcggcgaacgagccggcgcaaacccgggagctgaggaaccggatctttcccaccctctatgccatc ttccagcagagtcgggggcaggagcaggaactgaaagtcaagaaccgttctctgcgctcgctcacccgcagttgtctgtat cacaag ag eg aag accaacttcag eg cactctcg agg acg ccg agg ctctcttcaacaag tactg eg eg ctcactcttaa agagtagcccgcgcccgcccagtcgcagaaaaaggcgggaattacgtcacctgtgcccttcgccctagccgcctccacc catcatcatgagcaaagagattcccacgccttacatgtggagctaccagccccagatgggcctggccgccggtgccgcc caggactactccacccgcatgaattggctcagcgccgggcccgcgatgatctcacgggtgaatgacatccgcgcccacc g aaaccag atactcctag aacag tcag eg ctcaccg ccacg ccccg caatcacctcaatccg eg taattg g cccg ccg c cctggtgtaccaggaaattccccagcccacgaccgtactacttccgcgagacgcccaggccgaagtccagctgactaac tcaggtgtccagctggcgggcggcgccaccctgtgtcgtcaccgccccgctcagggtataaagcggctggtgatccggg gcagaggcacacagctcaacgacgaggtggtgagctcttcgctgggtctgcgacctgacggagtcttccaactcgccgg atcggggagatcttccttcacgcctcgtcaggccgtcctgactttggagagttcgtcctcgcagccccgctcgggtggcatcg gcactctccagttcgtggaggagttcactccctcggtctacttcaaccccttctccggctcccccggccactacccggacga gttcatcccgaacttcgacgccatcagcgagtcggtggacggctacgattgaatgtcccatggtggcgcagctgacctagc tcggcttcgacacctggaccactgccgccgcttccgctgcttcgctcgggatctcgccgagtttgcctactttgagctgcccga ggagcaccctcagggcccggcccacggagtgcggatcgtcgtcgaagggggcctcgactcccacctgcttcggatcttc agccagcgtccgatcctggtcgagcgcgagcaaggacagacccttctgactctgtactgcatctgcaaccaccccggcct gcatgaaagtctttgttgtctgctgtgtactgagtataataaaagctgagatcagcgactactccggacttccgtgtgttcctga atccatcaaccagtctttgttcttcaccgggaacgagaccgagctccagctccagtgtaagccccacaagaagtacctcac ctggctgttccagggctccccgatcgccgttgtcaaccactgcgacaacgacggagtcctgctgagcggccctgccaacc ttactttttccacccgcagaagcaagctccagctcttccaacccttcctccccgggacctatcagtgcgtctcgggaccctgc catcacaccttccacctg atcccg aataccacag eg teg ctccccg ctactaacaaccaaactaacctccaccaacg cca ccgtcgcgacctttctgaatctaatactaccacccacaccggaggtgagctccgaggtcaaccaacctctgggatttactac ggcccctgggaggtggttgggttaatagcgctaggcctagttgcgggtgggcttttggttctctgctacctatacctcccttgct gttcgtacttagtggtgctgtgttgctggtttaagaaatggggaagatcaccctagtgagctgcggtgcgctggtggcggtgtt gctttcgattgtgggactgggcggtgcggctgtagtgaaggagaaggccgatccctgcttgcatttcaatcccaacaaatgc cagctgagttttcagcccgatggcaatcggtgcgcggtactgatcaagtgcggatgggaatgcgagaacgtgagaatcg agtacaataacaagactcggaacaatactctcgcgtccgtgtggcagcccggggaccccgagtggtacaccgtctctgtc cccggtgctgacggctccccgcgcaccgtgaataatactttcatttttgcgcacatgtgcgacacggtcatgtggatgagca agcagtacgatatgtggccccccacgaaggagaacatcgtggtcttctccatcgcttacagcctgtgcacggcgctaatca ccg ctatcg tg tg cctg ag cattcacatg ctcatcg ctattcg ccccag aaataatg ccg aaaaag aaaaacag ccataa cgttttttttcacacctttttcagaccatggcctctgttaaatttttgcttttatttgccagtctcattgccgtcattcatggaatgagtaa tgagaaaattactatttacactggcactaatcacacattgaaaggtccagaaaaagccacagaagtttcatggtattgttattt taatgaatcagatgtatctactgaactctgtggaaacaataacaaaaaaaatgagagcattactctcatcaagtttcaatgtg gatctgacttaaccctaattaacatcactagagactatgtaggtatgtattatggaactacagcaggcatttcggacatggaa ttttatcaag tttctg tg tctg aacccaccacg cctag aatg accacaaccacaaaaactacacctg ttaccactatg cag ct cactaccaataacatttttgccatgcgtcaaatggtcaacaatagcactcaacccaccccacccagtgaggaaattcccaa atccatgattggcattattgttgctgtagtggtgtgcatgttgatcatcgccttgtgcatggtgtactatgccttctgctacagaaa gcacagactgaacgacaagctggaacacttactaagtgttgaattttaattttttagaaccatgaagatcctaggccttttaatt ttttctatcattacctctgctctatgcaattctgacaatgaggacgttactgtcgttgtcggatcaaattatacactgaaaggtcca gcgaagggtatgctttcgtggtattgctattttggatctgacactacagaaactgaattatgcaatcttaagaatggcaaaattc aaaattctaaaattaacaattatatatgcaatggtactgatctgatactcctcaatatcacgaaatcatatgctggcagttaca cctg ccctgg ag atg atg ctg acag tatg attttttacaaag taactg ttg ttg atcccactactccacctccacccaccacaa ctactcacaccacacacacagatcaaaccgcagcagaggaggcagcaaagttagccttgcaggtccaagacagttcat ttgttggcattacccctacacctgatcagcggtgtccggggctgctagtcagcggcattgtcggtgtgctttcgggattagcag tcataatcatctg catg ttcatttttg cttg ctg ctatag aag g ctttaccg acaaaaatcag acccactg ctg aacctctatg ttt aattttttccagagtcatgaaggcagttagcgctctagttttttgttctttgattggcattgttttttgcaatcctattcctaaagttagct ttattaaagatgtgaatgttactgaggggggcaatgtgacactggtaggtgtagagggtgctgaaaacaccacctggaca aaataccacctcaatgggtggaaagatatttgcaattggagtgtattagtttatacatgtgagggagttaatcttaccattgtca atgccacctcagctcaaaatggtagaattcaaggacaaagtgtcagtgtatctaatgggtattttacccaacatacttttatcta tg acg ttaaag tcataccactg cctacg cctag cccacctag cactaccacacag acaacccacactacacag acaacc acatacagtacattaaatcagcctaccaccactacagcagcagaggttgccagctcgtctggggtccgagtggcatttttga tgtgggccccatctagcagtcccactgctagtaccaatgagcagactactgaatttttgtccactgtcgagagccacaccac ag ctacctccag tg ccttctctag caccg ccaatctct cctcg ctttcctctacaccaatcag tcccg ctactactcctag cccc gctcctcttcccactcccctgaagcaaacagacggcggcatgcaatggcagatcaccctgctcattgtgatcgggttggtca tcctg g ccg tg ttg ctctactacatcttctg ccg ccg cattcccaacg eg caccg caag ccgg tctacaag cccatcattg tc gggcagccggagccgcttcaggtggaagggggtctaaggaatcttctcttctcttttacagtatggtgattgaactatgattcct agacaattcttgatcactattcttatctgcctcctccaagtctgtgccaccctcgctctggtggccaacgccagtccagactgta ttg gg cccttcg cctcctacg tg ctctttg ccttcaccacctg catctg ctg ctg tag catag tctg cctg cttatcaccttcttcca gttcattgactggatctttgtgcgcatcgcctacctgcgccaccacccccagtaccgcgaccagcgagtggcgcggctgct caggctcctctgataagcatgcgggctctgctacttctcgcgcttctgctgttagtgctcccccgtcccgtcgacccccggtcc cccacccag tcccccg agg ag g tccg caaatg caaattccaag aaccctg g aaattcctcaaatg ctaccg ccaaaaat cagacatgcatcccagctggatcatgatcattgggatcgtgaacattctggcctgcaccctcatctcctttgtgatttacccctg ctttg actttgg ttg g aactcg ccag ag g eg ctctatctcccg cctg aacctg acacaccaccacag caacctcagg caca eg cactaccaccactacag cctag g ccacaatacatg cccatattag actatg agg ccg ag ccacag eg acccatg etc cccgctattagttacttcaatctaaccggcggagatgactgacccactggccaacaacaacgtcaacgaccttctcctgga catggacggccgcgcctcggagcagcgactcgcccaacttcgcattcgccagcagcaggagagagccgtcaaggagc tgcaggatgcggtggccatccaccagtgcaagagaggcatcttctgcctggtgaaacaggccaagatctcctacgaggtc actccaaacg accatcg cctctcctacg ag ctcctg cag cag eg ccag aag ttcacctg cctgg teg g ag tcaaccccat cgtcatcacccagcagtctggcgataccaaggggtgcatccactgctcctgcgactcccccgactgcgtccacactctgat caagaccctctgcggcctccgcgacctcctccccatgaactaatcacccccttatccagtgaaataaagatcatattgatga tg attttacag aaataaaaaataatcatttg atttg aaataaag atacaatcatattg atg atttg ag tttaacaaaaaaataa agaatcacttacttgaaatctgataccaggtctctgtccatgttttctgccaacaccacttcactcccctcttcccagctctggta ctgcaggccccggcgggctgcaaacttcctccacacgctgaaggggatgtcaaattcctcctgtccctcaatcttcattttatc ttctatcagatgtccaaaaagcgcgtccgggtggatgatgacttcgaccccgtctacccctacgatgcagacaacgcacc gaccgtgcccttcatcaacccccccttcgtctcttcagatggattccaagagaagcccctgggggtgttgtccctgcgactgg ccgaccccgtcaccaccaagaacggggaaatcaccctcaagctgggagagggggtggacctcgattcctcgggaaaa ctcatctccaacacg g ccaccaag g ccg ccg cccctctcag tttttccaacaacaccatttcccttaacatgg atcacccctt ttacactaaagatggaaaattatccttacaagtttctccaccattaaatatactgagaacaagcattctaaacacactagcttt aggttttggatcaggtttaggactccgtggctctgccttggcagtacagttagtctctccacttacatttgatactgatggaaaca taaagcttaccttagacagaggtttgcatgttacaacaggagatgcaattgaaagcaacataagctgggctaaaggtttaa aatttgaagatggagccatagcaaccaacattggaaatgggttagagtttggaagcagtagtacagaaacaggtgttgat gatgcttacccaatccaagttaaacttggatctggccttagctttgacagtacaggagccataatggctggtaacaaagaag acg ataaactcactttg tg g acaacacctg atccatcaccaaactg tcaaatactcg cag aaaatg atg caaaactaaca ctttgcttgactaaatgtggtagtcaaatactggccactgtgtcagtcttagttgtaggaagtggaaacctaaaccccattactg gcaccgtaagcagtgctcaggtgtttctacgttttgatgcaaacggtgttcttttaacagaacattctacactaaaaaaatactg ggggtataggcagggagatagcatagatggcactccatataccaatgctgtaggattcatgcccaatttaaaagcttatcc aaagtcacaaagttctactactaaaaataatatagtagggcaagtatacatgaatggagatgtttcaaaacctatgcttctca ctataaccctcaatggtactgatgacagcaacagtacatattcaatgtcattttcatacacctggactaatggaagctatgttg gagcaacatttggggctaactcttataccttctcatacatcgcccaagaatgaacactgtatcccaccctgcatgccaaccct tcccaccccactctgtggaacaaactctgaaacacaaaataaaataaagttcaagtgttttattgattcaacagttttacagg attcg ag cag ttatttttcctccaccctcccag g acatg g aatacaccaccctctccccccg cacag ccttg aacatctg aat gccattggtgatggacatgcttttggtctccacgttccacacagtttcagagcgagccagtctcgggtcggtcagggagatg aaaccctccgggcactcccgcatctgcacctcacagctcaacagctgaggattgtcctcggtggtcgggatcacggttatct ggaagaagcagaagagcggcggtgggaatcatagtccgcgaacgggatcggccggtggtgtcgcatcaggccccgc agcagtcgctgccgccgccgctccgtcaagctgctgctcagggggtccgggtccagggactccctcagcatgatgccca cggccctcagcatcagtcgtctggtgcggcgggcgcagcagcgcatgcggatctcgctcaggtcgctgcagtacgtgca acacagaaccaccaggttgttcaacagtccatagttcaacacgctccagccgaaactcatcgcgggaaggatgctaccc acgtggccgtcgtaccagatcctcaggtaaatcaagtggtgccccctccagaacacgctgcccacgtacatgatctccttg ggcatgtggcggttcaccacctcccggtaccacatcaccctctggttgaacatgcagccccggatgatcctgcggaacca cagggccagcaccgccccgcccgccatgcagcgaagagaccccgggtcccggcaatggcaatggaggacccaccg ctcgtacccgtggatcatctgggagctgaacaagtctatgttggcacagcacaggcatatgctcatgcatctcttcagcactc tcaactcctcgggggtcaaaaccatatcccagggcacggggaactcttgcaggacagcgaaccccgcagaacagggc aatcctcgcacagaacttacattgtgcatggacagggtatcgcaatcaggcagcaccgggtgatcctccaccagagaag cgcgggtctcggtctcctcacagcgtggtaagggggccggccgatacgggtgatggcgggacgcggctgatcgtgttcgc gaccgtgtcatgatgcagttgctttcggacattttcgtacttgctgtagcagaacctggtccgggcgctgcacaccgatcgcc ggcggcggtctcggcgcttggaacgctcggtgttgaaattgtaaaacagccactctctcagaccgtgcagcagatctagg gcctcaggagtgatgaagatcccatcatgcctgatggctctgatcacatcgaccaccgtggaatgggccagacccagcc agatgatgcaattttgttgggtttcggtgacggcgggggagggaagaacaggaagaaccatgattaacttttaatccaaac ggtctcggagtacttcaaaatgaagatcgcggagatggcacctctcgcccccgctgtgttggtggaaaataacagccagg tcaaaggtgatacggttctcgagatgttccacggtggcttccagcaaagcctccacgcgcacatccagaaacaagacaat agcgaaagcgggagggttctctaattcctcaatcatcatgttacactcctgcaccatccccagataattttcatttttccagcctt gaatgattcgaactagttcgtgaggtaaatccaagccagccatgataaagagctcgcgcagagcgccctccaccggcatt cttaagcacaccctcataattccaagatattctgctcctggttcacctgcagcagattgacaagcggaatatcaaaatctctg ccgcgatccctgagctcctccctcagcaataactgtaagtactctttcatatcctctccgaaatttttagccataggaccacca ggaataagattagggcaagccacagtacagataaaccgaagtcctccccagtgagcattgccaaatgcaagactgctat aagcatgctggctagacccggtgatatcttccagataactggacagaaaatcgcccaggcaatttttaagaaaatcaaca aaagaaaaatcctccaggtggacgtttagagcctcgggaacaacgatgaagtaaatgcaagcggtgcgttccagcatg gttagttagctgatctgtagaaaaaacaaaaatgaacattaaaccatgctagcctggcgaacaggtgggtaaatcgttctct ccagcaccaggcaggccacggggtctccggcgcgaccctcgtaaaaattgtcgctatgattgaaaaccatcacagaga gacgttcccggtggccggcgtgaatgattcgacaagatgaatacacccccggaacattggcgtccgcgagtgaaaaaa ag eg cccg agg aag caataag g cactacaatg ctcag tctcaag tccag caaag eg atg ccatg egg atg aag caca aaattctcaggtgcgtacaaaatgtaattactcccctcctgcacaggcagcaaagcccccgatccctccaggtacacatac aaag cctcag eg tccatag cttaccg ag cag cag cacacaacagg eg caag ag tcag ag aaagg ctg ag ctctaacc tg tccacccg ctctctg ctcaatatatag cccag atctacactg acg taaagg ccaaag tctaaaaatacccg ccaaataa tcacacacg cccag cacacg cccag aaaccg g tg acacactcaaaaaaatacg eg cacttcctcaaacg cccaaaa ctgccgtcatttccgggttcccacgctacgtcatcaaaacacgactttcaaattccgtcgaccgttaaaaacgtcacccgcc ccg cccctaacg g teg cccg tctct cag ccaatcag eg ccccg catccccaaattcaaacacctcatttg catattaacg c gcacaaaaagtttgaggtatattattgatgatgg
SEQ ID NO:58. Complete Sequence of the AdC68-734 Vector
TTAATTAAccatcttcaataatatacctcaaactttttgtgcgcgttaatatgcaaatgaggcgtttgaatttggggaggaa gggcggtgattggtcgagggatgagcgaccgttaggggcggggcgagtgacgttttgatgacgtggttgcgaggaggag ccagtttgcaagttctcgtgggaaaagtgacgtcaaacgaggtgtggtttgaacacggaaatactcaattttcccgcgctctc tgacaggaaatgaggtgtttctgggcggatgcaagtgaaaacgggccattttcgcgcgaaaactgaatgaggaagtgaa aatctgagtaatttcgcgtttatggcagggaggagtatttgccgagggccgagtagactttgaccgattacgtgggggtttcg attaccgtgtttttcacctaaatttccgcgtacggtgtcaaagtccggtgtttttactactgtaatagtaatcaattacggggtcatt agttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccg cccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacg gtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggccc gcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggt gatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtca atgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatgggcg gtaggcgtgtacggtgggaggtctatataagcagagctgtccctatcagtgatagagatctccctatcagtgatagagagttt agtgaaccgtcagatccgctagggtaccaacATGGCTAGCATCGTCGGAGGGTGGGAGTGCGAA AAGCACTCACAGCCATGGCAGGTCCTGGTCGCCTCGCGCGGACGCGCCGTGTGT GGAGGTGTGCTGGTCCACCCGCAGTGGGTGTTGACTGCGGCCCATTGCATCAGAA ATAAGTCCGTGATCCTCTTGGGGAGACATTCCCTGTTTCACCCCGAAGATACTGGA CAGGTGTTCCAAGTGAGCCACTCCTTCCCGCATCCACTGTACGACATGAGCCTGCT GAAGAACCGCTTTCTGCGGCCAGGGGACGACTCATCACACGATTTGATGCTGCTT CGGCTCTCGGAACCGGCCGAGCTCACCGACGCAGTGAAGGTCATGGACCTCCCTA CGCAAGAGCCTGCTCTCGGTACCACTTGTTACGCATCGGGATGGGGCTCCATCGA GCCGGAAGAATTCCTGACCCCGAAAAAGCTGCAGTGCGTGGATCTGCACGTGATT TCGAATGACGTGTGCGCGCAAGTGCATCCACAAAAGGTCACTAAGTTCATGCTGTG CGCCGGAAGGTGGACCGGCGGAAAATCGACCTGTTCCGGCGACAGCGGAGGCCC ACTCGTGTGCAACGGTGTGCTGCAGGGCATCACTAGCTGGGGATCAGAACCGTGC GCGCTTCCGGAGCGGCCCTCGCTCTACACGAAGGTGGTGCACTACCGCAAATGGA TTAAAGATACCATCGTCGCAAACCCTggatccgaaggtaggggttcattattgacctgtggagatgtcga agaaaacccaggacccGCTAGCAAAGCAGTGCTGCTGGCGCTCCTGATGGCTGGACTCG CGCTGCAGCCTGGAACCGCCCTGCTCTGTTACTCGTGCAAGGCCCAAGTCTCGAA TGAGGACTGTTTGCAAGTGGAAAACTGCACCCAGCTCGGAGAACAATGCTGGACT GCACGGATCCGCGCTGTCGGCCTGCTGACCGTGATCTCCAAAGGGTGCTCATTGA ACTGCGTGGACGATAGCCAGGACTACTACGTGGGAAAGAAGAATATCACTTGTTGC GACACGGATCTTTGCAACGCGTCCGGAGCGCACGCCCTGCAGCCAGCAGCCGCC ATTCTGGCCCTGCTTCCGGCCCTGGGGTTGCTGCTCTGGGGTCCGGGCCAGCTCg gatcccagaccctgaactttgatctgctgaaactggcaggcgatgtggaaagcaacccaggcccaATGGCTAGC GCTCGCAGACCGCGGTGGCTGTGTGCAGGGGCGCTCGTCCTGGCGGGTGGCTTC TTTTTGCTCGGCTTTCTTTTCGGATGGTTCATCAAATCGTCAAACGAAGCTACCAAT ATCACCCCGAAGCACAACATGAAGGCCTTTCTGGATGAGCTGAAGGCTGAGAACAT TAAGAAGTTCCTCTACAACTTCACCCAGATCCCACATTTGGCGGGCACTGAGCAGA ACTTTCAGTTGGCTAAGCAGATCCAGAGCCAGTGGAAGGAATTCGGCCTGGACTC CGTCGAGCTGGCGCATTACGATGTGCTGCTGAGCTACCCTAATAAGACTCATCCGA ACTATATCTCGATTATCAATGAGGACGGAAACGAAATCTTTAACACGTCCCTCTTCG AGCCGCCACCGCCTGGATACGAGAACGTGTCAGATATCGTGCCTCCGTTCTCGGC CTTCTCGCCCCAGGGAATGCCCGAAGGGGACCTGGTGTACGTGAACTACGCAAGG ACCGAGGACTTCTTCAAGTTGGAGCGGGATATGAAGATCAATTGCAGCGGAAAGAT CGTCATCGCCCGCTACGGCAAAGTGTTCCGCGGCAACAAGGTGAAGAATGCACAG TTGGCAGGCGCCAAGGGCGTCATCCTCTACTCGGATCCTGCCGACTACTTCGCTC CTGGCGTGAAATCCTACCCTGATGGTTGGAATCTGCCAGGAGGAGGGGTGCAGAG GGGAAATATCCTGAACCTGAACGGTGCCGGTGACCCACTTACTCCGGGTTACCCG GCCAACGAATACGCGTACAGGCGGGGTATCGCGGAAGCCGTCGGACTGCCGTCC ATCCCGGTCCATCCGATTGGTTACTACGACGCCCAGAAGCTCCTCGAAAAGATGG GAGGCAGCGCCCCTCCGGACTCGTCATGGAGAGGCTCGCTGAAGGTGCCATACA ACGTGGGACCCGGATTCACTGGAAATTTCAGCACTCAAAAAGTGAAGATGCACATT CACTCCACTAACGAAGTCACCAGGATCTACAACGTCATCGGAACCCTCCGGGGAG CGGTGGAACCGGACCGCTACGTGATCCTCGGTGGACACCGGGATAGCTGGGTGT TCGGAGGAATCGATCCTCAATCGGGCGCAGCCGTCGTCCATGAAATCGTCAGGTC CTTTGGTACTCTTAAGAAGGAGGGCTGGCGCCCTAGACGCACTATTCTGTTCGCCT CGTGGGATGCCGAAGAATTTGGTCTGCTCGGCAGCACCGAATGGGCTGAGGAAAA CTCCCGCCTGCTCCAAGAACGCGGAGTGGCGTACATCAATGCCGACTCATCCATC GAAGGAAACTACACGCTGCGGGTGGACTGCACTCCACTGATGTACTCGCTCGTGC ACAACCTGACCAAAGAACTCAAATCCCCAGACGAAGGATTCGAGGGAAAATCGCTG TACGAGTCGTGGACCAAGAAGAGCCCATCCCCGGAGTTCAGCGGGATGCCGCGG ATCTCAAAGCTCGGATCAGGAAATGATTTCGAAGTGTTCTTTCAGAGGCTGGGAAT TGCGTCGGGAAGGGCTCGGTACACGAAAAACTGGGAAACTAACAAGTTCTCGGGA TACCCGCTGTACCACTCGGTGTATGAAACTTACGAACTGGTGGAGAAATTCTACGA TCCTATGTTTAAGTACCACCTGACTGTGGCCCAAGTGAGAGGCGGAATGGTGTTCG AGTTGGCCAATTCAATTGTGCTGCCATTCGATTGCCGCGACTACGCCGTGGTGCTG AGAAAGTACGCAGACAAAATCTACTCAATCAGCATGAAGCACCCACAAGAGATGAA AACCTACTCAGTCTCCTTCGACTCCCTCTTCTCCGCGGTGAAGAACTTCACCGAGA TCGCGAGCAAATTCTCGGAGCGCCTTCAAGATTTTGACAAATCCAATCCGATCGTC CTCCGCATGATGAATGACCAGCTCATGTTTCTCGAACGGGCCTTCATCGATCCACT GGGACTTCCGGACCGGCCGTTTTACCGCCACGTGATCTACGCGCCCTCGTCGCAT AACAAGTATGCTGGAGAGAGCTTCCCGGGTATCTACGACGCATTGTTCGACATTGA GTCCAAGGTGGATCCGTCCAAAGCCTGGGGTGAAGTGAAGCGCCAAATCTACGTG GCGGCCTTTACCGTCCAGGCGGCAGCAGAAACCTTGAGCGAGGTGGCTTGActcga g cctaag cttctag ataag atatccg atccaccgg atctag ataactg atcataatcag ccataccacatttg tag ag g tttta cttgctttaaaaaacctcccacacctccccctgaacctgaaacataaaatgaatgcaattgttgttgttaacttgtttattgcagc ttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaa actcatcaatgtatcttatatgctggccaccgtacatgtggcttcccatgctcgcaagccctggcccgagttcgagcacaatg tcatgaccaggtgcaatatgcatctggggtcccgccgaggcatgttcatgccctaccagtgcaacctgaattatgtgaaggt gctgctggagcccgatgccatgtccagagtgagcctgacgggggtgtttgacatgaatgtggaggtgtggaagattctgag atatgatgaatccaagaccaggtgccgagcctgcgagtgcggagggaagcatgccaggttccagcccgtgtgtgtggat gtgacggaggacctgcgacccgatcatttggtgttgccctgcaccgggacggagttcggttccagcggggaagaatctga ctagagtgagtagtgttctggggcgggggaggacctgcatgagggccagaataactgaaatctgtgcttttctgtgtgttgca gcagcatgagcggaagcggctcctttgagggaggggtattcagcccttatctgacggggcgtctcccctcctgggcggga gtgcgtcagaatgtgatgggatccacggtggacggccggcccgtgcagcccgcgaactcttcaaccctgacctatgcaa ccctgagctcttcgtcgttggacgcagctgccgccgcagctgctgcatctgccgccagcgccgtgcgcggaatggccatg ggcgccggctactacggcactctggtggccaactcgagttccaccaataatcccgccagcctgaacgaggagaagctgt tgctgctgatggcccagctcgaggccttgacccagcgcctgggcgagctgacccagcaggtggctcagctgcaggagc agacgcgggccgcggttgccacggtgaaatccaaataaaaaatgaatcaataaataaacggagacggttgttgattttaa cacagagtctgaatctttatttgatttttcgcgcgcggtaggccctggaccaccggtctcgatcattgagcacccggtggatctt ttccaggacccggtagaggtgggcttggatgttgaggtacatgggcatgagcccgtcccgggggtggaggtagctccattg cagggcctcgtgctcgggggtggtgttgtaaatcacccagtcatagcaggggcgcagggcatggtgttgcacaatatctttg aggaggagactgatggccacgggcagccctttggtgtaggtgtttacaaatctgttgagctgggagggatgcatgcgggg ggagatgaggtgcatcttggcctggatcttgagattggcgatgttaccgcccagatcccgcctggggttcatgttgtgcagga ccaccagcacggtgtatccggtgcacttggggaatttatcatgcaacttggaagggaaggcgtgaaagaatttggcgacg cctttgtgcccgcccaggttttccatgcactcatccatgatgatggcgatgggcccgtgggcggcggcctgggcaaagacg tttcgggggtcggacacatcatagttgtggtcctgggtgaggtcatcataggccattttaatgaatttggggcggagggtgcc ggactgggggacaaaggtaccctcgatcccgggggcgtagttcccctcacagatctgcatctcccaggctttgagctcgg agggggggatcatgtccacctgcggggcgataaagaacacggtttccggggcgggggagatgagctgggccgaaag caagttccggagcagctgggacttgccgcagccggtggggccgtagatgaccccgatgaccggctgcaggtggtagttg agggagagacagctgccgtcctcccggaggaggggggccacctcgttcatcatctcgcgcacgtgcatgttctcgcgcac cagttccgccaggaggcgctctccccccagggataggagctcctggagcgaggcgaagtttttcagcggcttgagtccgt cggccatgggcattttggagagggtttgttgcaagagttccaggcggtcccagagctcggtgatgtgctctacggcatctcg atccagcagacctcctcgtttcgcgggttgggacggctgcgggagtagggcaccagacgatgggcgtccagcgcagcc agggtccggtccttccagggtcgcagcgtccgcgtcagggtggtctccgtcacggtgaaggggtgcgcgccgggctggg cgcttgcgagggtgcgcttcaggctcatccggctggtcgaaaaccgctcccgatcggcgccctgcgcgtcggccaggtag caattgaccatgagttcgtagttgagcgcctcggccgcgtggcctttggcgcggagcttacctttggaagtctgcccgcagg cgggacagaggagggacttgagggcgtagagcttgggggcgaggaagacggactcgggggcgtaggcgtccgcgc cgcagtgggcgcagacggtctcgcactccacgagccaggtgaggtcgggctggtcggggtcaaaaaccagtttcccgc cgttctttttgatgcgtttcttacctttggtctccatgagctcgtgtccccgctgggtgacaaagaggctgtccgtgtccccgtaga ccgactttatgggccggtcctcgagcggtgtgccgcggtcctcctcgtagaggaaccccgcccactccgagacgaaagc ccgggtccaggccagcacgaaggaggccacgtgggacgggtagcggtcgttgtccaccagcgggtccaccttttccag ggtatgcaaacacatgtccccctcgtccacatccaggaaggtgattggcttgtaagtgtaggccacgtgaccgggggtccc ggccgggggggtataaaagggtgcgggtccctgctcgtcctcactgtcttccggatcgctgtccaggagcgccagctgttg gggtaggtattccctctcgaaggcgggcatgacctcggcactcaggttgtcagtttctagaaacgaggaggatttgatattg acggtgccggcggagatgcctttcaagagcccctcgtccatctggtcagaaaagacgatctttttgttgtcgagcttggtggc gaaggagccgtagagggcgttggagaggagcttggcgatggagcgcatggtctggtttttttccttgtcggcgcgctccttg gcggcgatgttgagctgcacgtactcgcgcgccacgcacttccattcggggaagacggtggtcagctcgtcgggcacgat tctgacctgccagccccgattatgcagggtgatgaggtccacactggtggccacctcgccgcgcaggggctcattagtcca gcagaggcgtccgcccttgcgcgagcagaaggggggcagggggtccagcatgacctcgtcgggggggtcggcatcg atggtgaagatgccgggcaggaggtcggggtcaaagtagctgatggaagtggccagatcgtccagggcagcttgccatt cgcgcacggccagcgcgcgctcgtagggactgaggggcgtgccccagggcatgggatgggtaagcgcggaggcgta catgccgcagatgtcgtagacgtagaggggctcctcgaggatgccgatgtaggtggggtagcagcgccccccgcggat gctggcgcgcacgtagtcatacagctcgtgcgagggggcgaggagccccgggcccaggttggtgcgactgggcttttcg gcgcggtagacgatctggcggaaaatggcatgcgagttggaggagatggtgggcctttggaagatgttgaagtgggcgt ggggcagtccgaccgagtcgcggatgaagtgggcgtaggagtcttgcagcttggcgacgagctcggcggtgactagga cgtccagagcgcagtagtcgagggtctcctggatgatgtcatacttgagctgtcccttttgtttccacagctcgcggttgagaa ggaactcttcgcggtccttccagtactcttcgagggggaacccgtcctgatctgcacggtaagagcctagcatgtagaactg gttgacggccttgtaggcgcagcagcccttctccacggggagggcgtaggcctgggcggccttgcgcagggaggtgtgc gtgagggcgaaagtgtccctgaccatgaccttgaggaactggtgcttgaagtcgatatcgtcgcagcccccctgctcccag agctggaagtccgtgcgcttcttgtaggcggggttgggcaaagcgaaagtaacatcgttgaagaggatcttgcccgcgcg gggcataaagttgcgagtgatgcggaaaggttggggcacctcggcccggttgttgatgacctgggcggcgagcacgatct cgtcgaagccgttgatgttgtggcccacgatgtagagttccacgaatcgcggacggcccttgacgtggggcagtttcttgag ctcctcgtaggtgagctcgtcggggtcgctgagcccgtgctgctcgagcgcccagtcggcgagatgggggttggcgcgga ggaaggaagtccagagatccacggccagggcggtttgcagacggtcccggtactgacggaactgctgcccgacggcc attttttcgggggtgacgcagtagaaggtgcgggggtccccgtgccagcgatcccatttgagctggagggcgagatcgag ggcgagctcgacgagccggtcgtccccggagagtttcatgaccagcatgaaggggacgagctgcttgccgaaggaccc catccaggtgtaggtttccacatcgtaggtgaggaagagcctttcggtgcgaggatgcgagccgatggggaagaactgg atctcctgccaccaattggaggaatggctgttgatgtgatggaagtagaaatgccgacggcgcgccgaacactcgtgcttg tgtttatacaagcggccacagtgctcgcaacgctgcacgggatgcacgtgctgcacgagctgtacctgagttcctttgacga ggaatttcagtgggaagtggagtcgtggcgcctgcatctcgtgctgtactacgtcgtggtggtcggcctggccctcttctgcct cgatggtggtcatgctgacgagcccgcgcgggaggcaggtccagacctcggcgcgagcgggtcggagagcgaggac gagggcgcgcaggccggagctgtccagggtcctgagacgctgcggagtcaggtcagtgggcagcggcggcgcgcgg ttgacttgcaggagtttttccagggcgcgcgggaggtccagatggtacttgatctccaccgcgccattggtggcgacgtcga tggcttgcagggtcccgtgcccctggggtgtgaccaccgtcccccgtttcttcttgggcggctggggcgacgggggcggtg cctcttccatggttagaagcggcggcgaggacgcgcgccgggcggcaggggcggctcggggcccggaggcaggggc ggcaggggcacgtcggcgccgcgcgcgggtaggttctggtactgcgcccggagaagactggcgtgagcgacgacgcg acggttgacgtcctggatctgacgcctctgggtgaaggccacgggacccgtgagtttgaacctgaaagagagttcgacag aatcaatctcggtatcgttgacggcggcctgccgcaggatctcttgcacgtcgcccgagttgtcctggtaggcgatctcggtc atgaactgctcgatctcctcctcttgaaggtctccgcggccggcgcgctccacggtggccgcgaggtcgttggagatgcgg cccatgagctgcgagaaggcgttcatgcccgcctcgttccagacgcggctgtagaccacgacgccctcgggatcgcGg gcgcgcatgaccacctgggcgaggttgagctccacgtggcgcgtgaagaccgcgtagttgcagaggcgctggtagagg tagttgagcgtggtggcgatgtgctcggtgacgaagaaatacatgatccagcggcggagcggcatctcgctgacgtcgcc cagcgcctccaaacgttccatggcctcgtaaaagtccacggcgaagttgaaaaactgggagttgcgcgccgagacggtc aactcctcctccagaagacggatgagctcggcgatggtggcgcgcacctcgcgctcgaaggcccccgggagttcctcca cttcctcttcttcctcctccactaacatctcttctacttcctcctcaggcggcagtggtggcgggggagggggcctgcgtcgcc ggcggcgcacgggcagacggtcgatgaagcgctcgatggtctcgccgcgccggcgtcgcatggtctcggtgacggcgc gcccgtcctcgcggggccgcagcgtgaagacgccgccgcgcatctccaggtggccgggggggtccccgttgggcagg gagagggcgctgacgatgcatcttatcaattgccccgtagggactccgcgcaaggacctgagcgtctcgagatccacgg gatctgaaaaccgctgaacgaaggcttcgagccagtcgcagtcgcaaggtaggctgagcacggtttcttctggcgggtca tgttggttgggagcggggcgggcgatgctgctggtgatgaagttgaaataggcggttctgagacggcggatggtggcgag gagcaccaggtctttgggcccggcttgctggatgcgcagacggtcggccatgccccaggcgtggtcctgacacctggcca ggtccttgtagtagtcctgcatgagccgctccacgggcacctcctcctcgcccgcgcggccgtgcatgcgcgtgagcccga agccgcgctggggctggacgagcgccaggtcggcgacgacgcgctcggcgaggatggcttgctggatctgggtgagg gtggtctggaagtcatcaaagtcgacgaagcggtggtaggctccggtgttgatggtgtaggagcagttggccatgacgga ccagttgacggtctggtggcccggacgcacgagctcgtggtacttgaggcgcgagtaggcgcgcgtgtcgaagatgtagt cgttgcaggtgcgcaccaggtactggtagccgatgaggaagtgcggcggcggctggcggtagagcggccatcgctcgg tggcgggggcgccgggcgcgaggtcctcgagcatggtgcggtggtagccgtagatgtacctggacatccaggtgatgcc ggcggcggtggtggaggcgcgcgggaactcgcggacgcggttccagatgttgcgcagcggcaggaagtagttcatggt gggcacggtctggcccgtgaggcgcgcgcagtcgtggatgctctatacgggcaaaaacgaaagcggtcagcggctcg actccgtggcctggaggctaagcgaacgggttgggctgcgcgtgtaccccggttcgaatctcgaatcaggctggagccgc agctaacgtggtattggcactcccgtctcgacccaagcctgcaccaaccctccaggatacggaggcgggtcgttttgcaac ttttttttggaggccggatgagactagtaagcgcggaaagcggccgaccgcgatggctcgctgccgtagtctggagaaga atcgccagggttgcgttgcggtgtgccccggttcgaggccggccggattccgcggctaacgagggcgtggctgccccgtc gtttccaagaccccatagccagccgacttctccagttacggagcgagcccctcttttgttttgtttgtttttgccagatgcatcccg tactg eg g cag atg eg cccccaccaccctccaccg caacaacag ccccctccacag ccg g eg cttctg cccccg cccc agcagcaacttccagccacgaccgccgcggccgccgtgagcggggctggacagagttatgatcaccagctggccttgg aagagggcgaggggctggcgcgcctgggggcgtcgtcgccggagcggcacccgcgcgtgcagatgaaaagggacg ctcgcgaggcctacgtgcccaagcagaacctgttcagagacaggagcggcgaggagcccgaggagatgcgcgcggc ccggttccacgcggggcgggagctgcggcgcggcctggaccgaaagagggtgctgagggacgaggatttcgaggcg gacgagctgacggggatcagccccgcgcgcgcgcacgtggccgcggccaacctggtcacggcgtacgagcagaccg tgaaggaggagagcaacttccaaaaatccttcaacaaccacgtgcgcaccctgatcgcgcgcgaggaggtgaccctgg gcctgatgcacctgtgggacctgctggaggccatcgtgcagaaccccaccagcaagccgctgacggcgcagctgttcct ggtggtgcagcatagtcgggacaacgaagcgttcagggaggcgctgctgaatatcaccgagcccgagggccgctggct cctggacctggtgaacattctgcagagcatcgtggtgcaggagcgcgggctgccgctgtccgagaagctggcggccatc aacttctcggtgctgagtttgggcaagtactacgctaggaagatctacaagaccccgtacgtgcccatagacaaggaggt gaagatcgacgggttttacatgcgcatgaccctgaaagtgctgaccctgagcgacgatctgggggtgtaccgcaacgac aggatgcaccgtgcggtgagcgccagcaggcggcgcgagctgagcgaccaggagctgatgcatagtctgcagcggg ccctgaccggggccgggaccgagggggagagctactttgacatgggcgcggacctgcactggcagcccagccgccg ggccttggaggcggcggcaggaccctacgtagaagaggtggacgatgaggtggacgaggagggcgagtacctggaa gactgatggcgcgaccgtatttttgctagatgcaacaacaacagccacctcctgatcccgcgatgcgggcggcgctgcag agccagccgtccggcattaactcctcggacgattggacccaggccatgcaacgcatcatggcgctgacgacccgcaac cccgaagcctttagacagcagccccaggccaaccggctctcggccatcctggaggccgtggtgccctcgcgctccaacc ccacgcacgagaaggtcctggccatcgtgaacgcgctggtggagaacaaggccatccgcggcgacgaggccggcct ggtgtacaacgcgctgctggagcgcgtggcccgctacaacagcaccaacgtgcagaccaacctggaccgcatggtga ccgacgtgcgcgaggccgtggcccagcgcgagcggttccaccgcgagtccaacctgggatccatggtggcgctgaacg ccttcctcag cacccag cccg ccaacg tg ccccg gg g ccag g ag g actacaccaacttcatcag eg ccctg eg cctg at ggtgaccgaggtgccccagagcgaggtgtaccagtccgggccggactacttcttccagaccagtcgccagggcttgcag accgtgaacctgagccaggctttcaagaacttgcagggcctgtggggcgtgcaggccccggtcggggaccgcgcgacg gtgtcgagcctgctgacgccgaactcgcgcctgctgctgctgctggtggcccccttcacggacagcggcagcatcaaccg caactcgtacctgggctacctgattaacctgtaccgcgaggccatcggccaggcgcacgtggacgagcagacctaccag gagatcacccacgtgagccgcgccctgggccaggacgacccgggcaacctggaagccaccctgaactttttgctgacc aaccggtcgcagaagatcccgccccagtacgcgctcagcaccgaggaggagcgcatcctgcgttacgtgcagcagag cgtgggcctgttcctgatgcaggagggggccacccccagcgccgcgctcgacatgaccgcgcgcaacatggagccca g catg tacg ccag caaccg cccg ttcatcaataaactg atgg actacttg catcg g g egg ccg ccatg aactctg actattt caccaacgccatcctgaatccccactggctcccgccgccggggttctacacgggcgagtacgacatgcccgaccccaat gacgggttcctgtgggacgatgtggacagcagcgtgttctccccccgaccgggtgctaacgagcgccccttgtggaagaa ggaaggcagcgaccgacgcccgtcctcggcgctgtccggccgcgagggtgctgccgcggcggtgcccgaggccgcc agtcctttcccgagcttgcccttctcgctgaacagtatccgcagcagcgagctgggcaggatcacgcgcccgcgcttgctg ggcgaagaggagtacttgaatgactcgctgttgagacccgagcgggagaagaacttccccaataacgggatagaaag cctggtggacaagatgagccgctggaagacgtatgcgcaggagcacagggacgatccccgggcgtcgcagggggcc acgagccggggcagcgccgcccgtaaacgccggtggcacgacaggcagcggggacagatgtgggacgatgagga ctccgccgacgacagcagcgtgttggacttgggtgggagtggtaacccgttcgctcacctgcgcccccgtatcgggcgcat gatgtaagagaaaccgaaaataaatgatactcaccaaggccatggcgaccagcgtgcgttcgtttcttctctgttgttgttgta tctagtatgatgaggcgtgcgtacccggagggtcctcctccctcgtacgagagcgtgatgcagcaggcgatggcggcggc ggcgatgcagcccccgctggaggctccttacgtgcccccgcggtacctggcgcctacggaggggcggaacagcattcgt tactcggagctggcacccttgtacgataccacccggttgtacctggtggacaacaagtcggcggacatcgcctcgctgaa ctaccagaacgaccacagcaacttcctgaccaccgtggtgcagaacaatgacttcacccccacggaggccagcaccc agaccatcaactttgacgagcgctcgcggtggggcggccagctgaaaaccatcatgcacaccaacatgcccaacgtga acgagttcatgtacagcaacaagttcaaggcgcgggtgatggtctcccgcaagacccccaatggggtgacagtgacag aggattatgatggtagtcaggatgagctgaagtatgaatgggtggaatttgagctgcccgaaggcaacttctcggtgaccat gaccatcgacctgatgaacaacgccatcatcgacaattacttggcggtggggcggcagaacggggtgctggagagcga catcggcgtgaagttcgacactaggaacttcaggctgggctgggaccccgtgaccgagctggtcatgcccggggtgtaca ccaacgaggctttccatcccgatattgtcttgctgcccggctgcggggtggacttcaccgagagccgcctcagcaacctgct gggcattcgcaagaggcagcccttccaggaaggcttccagatcatgtacgaggatctggaggggggcaacatccccgc g ctcctgg atg teg acg cctatg ag aaaag caagg agg atg cag cag ctg aag caactg cag ccg tag ctaccg cctct accgaggtcaggggcgataattttgcaagcgccgcagcagtggcagcggccgaggcggctgaaaccgaaagtaagat agtcattcagccggtggagaaggatagcaagaacaggagctacaacgtactaccggacaagataaacaccgcctacc gcagctggtacctagcctacaactatggcgaccccgagaagggcgtgcgctcctggacgctgctcaccacctcggacgt cacctgcggcgtggagcaagtctactggtcgctgcccgacatgatgcaagacccggtcaccttccgctccacgcgtcaag ttagcaactacccggtggtgggcgccgagctcctgcccgtctactccaagagcttcttcaacgagcaggccgtctactcgc ag cag ctg eg eg ccttcacctcg cttacg cacg tcttcaaccg cttccccg ag aaccag atcctcg tccg cccg cccg eg c ccaccattaccaccgtcagtgaaaacgttcctgctctcacagatcacgggaccctgccgctgcgcagcagtatccgggga gtccagcgcgtgaccgttactgacgccagacgccgcacctgcccctacgtctacaaggccctgggcatagtcgcgccgc gcgtcctctcgagccgcaccttctaaatgtccattctcatctcgcccagtaataacaccggttggggcctgcgcgcgcccag caagatgtacggaggcgctcgccaacgctccacgcaacaccccgtgcgcgtgcgcgggcacttccgcgctccctgggg cgccctcaagggccgcgtgcggtcgcgcaccaccgtcgacgacgtgatcgaccaggtggtggccgacgcgcgcaact acacccccgccgccgcgcccgtctccaccgtggacgccgtcatcgacagcgtggtggcCgacgcgcgccggtacgcc cgcgccaagagccggcggcggcgcatcgcccggcggcaccggagcacccccgccatgcgcgcggcgcgagccttg ctgcgcagggccaggcgcacgggacgcagggccatgctcagggcggccagacgcgcggcttcaggcgccagcgcc ggcaggacccggagacgcgcggccacggcggcggcagcggccatcgccagcatgtcccgcccgcggcgagggaa cgtgtactgggtgcgcgacgccgccaccggtgtgcgcgtgcccgtgcgcacccgcccccctcgcacttgaagatgttcact tcgcgatgttgatgtgtcccagcggcgaggaggatgtccaagcgcaaattcaaggaagagatgctccaggtcatcgcgc ctgagatctacggccctgcggtggtgaaggaggaaagaaagccccgcaaaatcaagcgggtcaaaaaggacaaaa aggaagaagaaagtgatgtggacggattggtggagtttgtgcgcgagttcgccccccggcggcgcgtgcagtggcgcg ggcggaaggtgcaaccggtgctgagacccggcaccaccgtggtcttcacgcccggcgagcgctccggcaccgcttcca agcgctcctacgacgaggtgtacggggatgatgatattctggagcaggcggccgagcgcctgggcgagtttgcttacggc aagcgcagccgttccgcaccgaaggaagaggcggtgtccatcccgctggaccacggcaaccccacgccgagcctca agcccgtgaccttgcagcaggtgctgccgaccgcggcgccgcgccgggggttcaagcgcgagggcgaggatctgtac cccaccatgcagctgatggtgcccaagcgccagaagctggaagacgtgctggagaccatgaaggtggacccggacgt gcagcccgaggtcaaggtgcggcccatcaagcaggtggccccgggcctgggcgtgcagaccgtggacatcaagattc ccacggagcccatggaaacgcagaccgagcccatgatcaagcccagcaccagcaccatggaggtgcagacggatcc ctggatgccatcggctcctagtcgaagaccccggcgcaagtacggcgcggccagcctgctgatgcccaactacgcgctg catccttccatcatccccacgccgggctaccgcggcacgcgcttctaccgcggtcataccagcagccgccgccgcaaga ccaccactcg ccg ccg ccg teg ccg caccg ccg ctg caaccacccctg ccg ccctg g tg egg ag ag tg taccg ccg eg g ccg eg cacctctg accctg ccg eg eg eg eg ctaccacccg ag catcg ccatttaaactttcg ccTg ctttg cag atcaat ggccctcacatgccgccttcgcgttcccattacgggctaccgaggaagaaaaccgcgccgtagaaggctggcggggaa cgggatgcgtcgccaccaccaccggcggcggcgcgccatcagcaagcggttggggggaggcttcctgcccgcgctgat ccccatcatcgccgcggcgatcggggcgatccccggcattgcttccgtggcggtgcaggcctctcagcgccactgagac acacttggaaacatcttgtaataaaccAatggactctgacgctcctggtcctgtgatgtgttttcgtagacagatggaagaca tcaatttttcgtccctggctccgcgacacggcacgcggccgttcatgggcacctggagcgacatcggcaccagccaactg aacgggggcgccttcaattggagcagtctctggagcgggcttaagaatttcgggtccacgcttaaaacctatggcagcaa ggcgtggaacagcaccacagggcaggcgctgagggataagctgaaagagcagaacttccagcagaaggtggtcgat gggctcgcctcgggcatcaacggggtggtggacctggccaaccaggccgtgcagcggcagatcaacagccgcctgga cccggtgccgcccgccggctccgtggagatgccgcaggtggaggaggagctgcctcccctggacaagcggggcgag aagcgaccccgccccgatgcggaggagacgctgctgacgcacacggacgagccgcccccgtacgaggaggcggtg aaactgggtctgcccaccacgcggcccatcgcgcccctggccaccggggtgctgaaacccgaaaagcccgcgaccct ggacttgcctcctccccagccttcccgcccctctacagtggctaagcccctgccgccggtggccgtggcccgcgcgcgac ccgggggcaccgcccgccctcatgcgaactggcagagcactctgaacagcatcgtgggtctgggagtgcagagtgtga agcgccgccgctgctattaaacctaccgtagcgcttaacttgcttgtctgtgtgtgtatgtattatgtcgccgccgccgctgtcc accagaaggaggagtgaagaggcgcgtcgccgagttgcaagatggccaccccatcgatgctgccccagtgggcgtac atgcacatcgccggacaggacgcttcggagtacctgagtccgggtctggtgcagtttgcccgcgccacagacacctacttc agtctggggaacaagtttaggaaccccacggtggcgcccacgcacgatgtgaccaccgaccgcagccagcggctgac gctgcgcttcgtgcccgtggaccgcgaggacaacacctactcgtacaaagtgcgctacacgctggccgtgggcgacaac cgcgtgctggacatggccagcacctactttgacatccgcggcgtgctggatcggggccctagcttcaaaccctactccggc accgcctacaacagtctggcccccaagggagcacccaacacttgtcagtggacatataaagccgatggtgaaactgcc acagaaaaaacctatacatatggaaatgcacccgtgcagggcattaacatcacaaaagatggtattcaacttggaactg acaccgatgatcagccaatctacgcagataaaacctatcagcctgaacctcaagtgggtgatgctgaatggcatgacatc actggtactgatgaaaagtatggaggcagagctcttaagcctgataccaaaatgaagccttgttatggttcttttgccaagcc tactaataaagaaggaggtcaggcaaatgtgaaaacaggaacaggcactactaaagaatatgacatagacatggctttc tttgacaacagaagtgcggctgctgctggcctagctccagaaattgttttgtatactgaaaatgtggatttggaaactccagat acccatattg tatacaaag cagg cacag atg acag cag ctcttctattaatttgg g tcag caag ccatg cccaacag acct aactacattggtttcagagacaactttatcgggctcatgtactacaacagcactggcaatatgggggtgctggccggtcagg cttctcagctgaatgctgtggttgacttgcaagacagaaacaccgagctgtcctaccagctcttgcttgactctctgggtgaca gaacccggtatttcagtatgtggaatcaggcggtggacagctatgatcctgatgtgcgcattattgaaaatcatggtgtggag gatgaacttcccaactattgtttccctctggatgctgttggcagaacagatacttatcagggaattaaggctaatggaactgat caaaccacatggaccaaagatgacagtgtcaatgatgctaatgagataggcaagggtaatccattcgccatggaaatca acatccaagccaacctgtggaggaacttcctctacgccaacgtggccctgtacctgcccgactcttacaagtacacgccg gccaatgttaccctgcccaccaacaccaacacctacgattacatgaacggccgggtggtggcgccctcgctggtggactc ctacatcaacatcggggcgcgctggtcgctggatcccatggacaacgtgaaccccttcaaccaccaccgcaatgcgggg ctgcgctaccgctccatgctcctgggcaacgggcgctacgtgcccttccacatccaggtgccccagaaatttttcgccatca ag ag cctcctg ctcctg cccgggtcctacacctacg agtgg aacttccg caagg acgtcaacatg atcctg cag ag ctcc ctcggcaacgacctgcgcacggacggggcctccatctccttcaccagcatcaacctctacgccaccttcttccccatggcg cacaacacggcctccacgctcgaggccatgctgcgcaacgacaccaacgaccagtccttcaacgactacctctcggcg g ccaacatg ctctaccccatcccg g ccaacg ccaccaacg tg cccatctccatcccctcg eg caactg g g ccg ccttccg cggctggtccttcacgcgtctcaagaccaaggagacgccctcgctgggctccgggttcgacccctacttcgtctactcggg ctccatcccctacctcgacggcaccttctacctcaaccacaccttcaagaaggtctccatcaccttcgactcctccgtcagct ggcccggcaacgaccggctcctgacgcccaacgagttcgaaatcaagcgcaccgtcgacggcgagggctacaacgtg gcccagtgcaacatgaccaaggactggttcctggtccagatgctggcccactacaacatcggctaccagggcttctacgt gcccgagggctacaaggaccgcatgtactccttcttccgcaacttccagcccatgagccgccaggtggtggacgaggtca actacaaggactaccaggccgtcaccctggcctaccagcacaacaactcgggcttcgtcggctacctcgcgcccaccat gcgccagggccagccctaccccgccaactacccctacccgctcatcggcaagagcgccgtcaccagcgtcacccaga aaaagttcctctgcgacagggtcatgtggcgcatccccttctccagcaacttcatgtccatgggcgcgctcaccgacctcgg ccag aacatg ctctatg ccaactccg cccacg eg ctag acatg aatttcg aag teg accccatg g atg ag tccacccttct ctatgttgtcttcgaagtcttcgacgtcgtccgagtgcaccagccccaccgcggcgtcatcgaggccgtctacctgcgcacc cccttctcggccggtaacgccaccacctaagctcttgcttcttgcaagccatggccgcgggctccggcgagcaggagctc agggccatcatccgcgacctgggctgcgggccctacttcctgggcaccttcgataagcgcttcccgggattcatggccccg cacaagctggcctgcgccatcgtcaacacggccggccgcgagaccgggggcgagcactggctggccttcgcctggaa cccgcgctcgaacacctgctacctcttcgaccccttcgggttctcggacgagcgcctcaagcagatctaccagttcgagtac gagggcctgctgcgccgcagcgccctggccaccgaggaccgctgcgtcaccctggaaaagtccacccagaccgtgca gggtccgcgctcggccgcctgcgggctcttctgctgcatgttcctgcacgccttcgtgcactggcccgaccgccccatggac aagaaccccaccatgaacttgctgacgggggtgcccaacggcatgctccagtcgccccaggtggaacccaccctgcgc cgcaaccaggaggcgctctaccgcttcctcaactcccactccgcctactttcgctcccaccgcgcgcgcatcgagaaggc caccgccttcgaccgcatgaatcaagacatgtaaaccgtgtgtgtatgttaaatgtctttaataaacagcactttcatgttaca catgcatctgagatgatttatttagaaatcgaaagggttctgccgggtctcggcatggcccgcgggcagggacacgttgcg gaactggtacttggccagccacttgaactcggggatcagcagtttgggcagcggggtgtcggggaaggagtcggtccac agcttccgcgtcagttgcagggcgcccagcaggtcgggcgcggagatcttgaaatcgcagttgggacccgcgttctgcgc gcgggagttgcggtacacggggttgcagcactggaacaccatcagggccgggtgcttcacgctcgccagcaccgtcgc gtcggtgatgctctccacgtcgaggtcctcggcgttggccatcccgaagggggtcatcttgcaggtctgccttcccatggtgg gcacgcacccgggcttgtggttgcaatcgcagtgcagggggatcagcatcatctgggcctggtcggcgttcatccccgggt acatgg ccttcatg aaag cctccaattg cctg aacg cctg ctgg g ccttg g ctccctcg gtg aag aag accccg cag g act tgctagagaactggttggtggcgcacccggcgtcgtgcacgcagcagcgcgcgtcgttgttggccagctgcaccacgctg cgcccccagcggttctgggtgatcttggcccggtcggggttctccttcagcgcgcgctgcccgttctcgctcgccacatccat ctcgatcatgtgctccttctggatcatggtggtcccgtgcaggcaccgcagcttgccctcggcctcggtgcacccgtgcagc cacagcgcgcacccggtgcactcccagttcttgtgggcgatctgggaatgcgcgtgcacgaagccctgcaggaagcgg cccatcatggtggtcagggtcttgttgctagtgaaggtcagcggaatgccgcggtgctcctcgttgatgtacaggtggcagat gcggcggtacacctcgccctgctcgggcatcagctggaagttggctttcaggtcggtctccacgcggtagcggtccatcag catagtcatgatttccatacccttctcccaggccgagacgatgggcaggctcatagggttcttcaccatcatcttagcgctag cagccgcggccagggggtcgctctcgtccagggtctcaaagctccgcttgccgtccttctcggtgatccgcaccggggggt agctgaagcccacggccgccagctcctcctcggcctgtctttcgtcctcgctgtcctggctgacgtcctgcaggaccacatg cttggtcttgcggggtttcttcttgggcggcagcggcggcggagatgttggagatggcgagggggagcgcgagttctcgctc accactactatctcttcctcttcttggtccgaggccacgcggcggtaggtatgtctcttcgggggcagaggcggaggcgacg ggctctcgccgccgcgacttggcggatggctggcagagccccttccgcgttcgggggtgcgctcccggcggcgctctgac tgacttcctccgcggccggccattgtgttctcctagggaggaacaacaagcatggagactcagccatcgccaacctcgcc atctg cccccaccg ccg acg ag aag cag cag cag cag aatg aaag cttaaccg ccccg ccg cccag ccccg ccacc tccgacgcggccgtcccagacatgcaagagatggaggaatccatcgagattgacctgggctatgtgacgcccgcggag cacgaggaggagctggcagtgcgcttttcacaagaagagatacaccaagaacagccagagcaggaagcagagaat gagcagagtcaggctgggctcgagcatgacggcgactacctccacctgagcgggggggaggacgcgctcatcaagca tctggcccggcaggccaccatcgtcaaggatgcgctgctcgaccgcaccgaggtgcccctcagcgtggaggagctcag ccg eg cctacg ag ttg aacctcttctcg ccg eg eg tg ccccccaag eg ccag cccaatg g cacctg eg ag cccaacccg eg cctcaacttctacccg g tcttcg eg g tg cccg ag g ccctgg ccacctaccacatctttttcaag aaccaaaag atccccg tctcctgccgcgccaaccgcacccgcgccgacgcccttttcaacctgggtcccggcgcccgcctacctgatatcgcctcctt ggaagaggttcccaagatcttcgagggtctgggcagcgacgagactcgggccgcgaacgctctgcaaggagaaggag gagagcatgagcaccacagcgccctggtcgagttggaaggcgacaacgcgcggctggcggtgctcaaacgcacggtc gagctgacccatttcgcctacccggctctgaacctgccccccaaagtcatgagcgcggtcatggaccaggtgctcatcaa gcgcgcgtcgcccatctccgaggacgagggcatgcaagactccgaggagggcaagcccgtggtcagcgacgagcag ctggcccggtggctgggtcctaatgctagtccccagagtttggaagagcggcgcaaactcatgatggccgtggtcctggtg accgtggagctggagtgcctgcgccgcttcttcgccgacgcggagaccctgcgcaaggtcgaggagaacctgcactacc tcttcaggcacgggttcgtgcgccaggcctgcaagatctccaacgtggagctgaccaacctggtctcctacatgggcatctt gcacgagaaccgcctggggcagaacgtgctgcacaccaccctgcgcggggaggcccggcgcgactacatccgcgac tgcgtctacctctacctctgccacacctggcagacgggcatgggcgtgtggcagcagtgtctggaggagcagaacctgaa agagctctgcaagctcctgcagaagaacctcaagggtctgtggaccgggttcgacgagcgcaccaccgcctcggacct g g ccg acctcattttccccg ag eg cctcag g ctg acg ctg eg caaegg cctg cccg actttatg ag ccaaag catg ttg ca aaactttcg ctctttcatcctcg aacg ctccg g aatcctg cccg ccacctg ctccg eg ctg ccctcg g acttcg tg ccg ctg a ccttccgcgagtgccccccgccgctgtggagccactgctacctgctgcgcctggccaactacctggcctaccactcggac gtgatcgaggacgtcagcggcgagggcctgctcgagtgccactgccgctgcaacctctgcacgccgcaccgctccctgg cctgcaacccccagctgctgagcgagacccagatcatcggcaccttcgagttgcaagggcccagcgaaggcgagggtt cagccgccaaggggggtctgaaactcaccccggggctgtggacctcggcctacttgcgcaagttcgtgcccgaggacta ccatcccttcgagatcaggttctacgaggaccaatcccatccgcccaaggccgagctgtcggcctgcgtcatcacccagg gggcgatcctggcccaattgcaagccatccagaaatcccgccaagaattcttgctgaaaaagggccgcggggtctacct cgacccccagaccggtgaggagctcaaccccggcttcccccaggatgccccgaggaaacaagaagctgaaagtgga gctgccgcccgtggaggatttggaggaagactgggagaacagcagtcaggcagaggaggaggagatggaggaaga ctgggacagcactcaggcagaggaggacagcctgcaagacagtctggaggaagacgaggaggaggcagaggagg aggtggaagaagcagccgccgccagaccgtcgtcctcggcgggggagaaagcaagcagcacggataccatctccgc tccgggtcggggtcccgctcgaccacacagtagatgggacgagaccggacgattcccgaaccccaccacccagaccg gtaagaaggagcggcagggatacaagtcctggcgggggcacaaaaacgccatcgtctcctgcttgcaggcctgcggg ggcaacatctccttcacccggcgctacctgctcttccaccgcggggtgaactttccccgcaacatcttgcattactaccgtca cctccacagcccctactacttccaagaagaggcagcagcagcagaaaaagaccagcagaaaaccagcagctagaa aatccacagcggcggcagcaggtggactgaggatcgcggcgaacgagccggcgcaaacccgggagctgaggaacc ggatctttcccaccctctatgccatcttccagcagagtcgggggcaggagcaggaactgaaagtcaagaaccgttctctgc gctcgctcacccgcagttgtctgtatcacaagagcgaagaccaacttcagcgcactctcgaggacgccgaggctctcttca acaagtactgcgcgctcactcttaaagagtagcccgcgcccgcccagtcgcagaaaaaggcgggaattacgtcacctgt g cccttcg ccctag ccg cctccacccatcatcatg ag caaag ag attcccacg ccttacatg tg g ag ctaccag ccccag atgggcctggccgccggtgccgcccaggactactccacccgcatgaattggctcagcgccgggcccgcgatgatctcac gggtgaatgacatccgcgcccaccgaaaccagatactcctagaacagtcagcgctcaccgccacgccccgcaatcacc tcaatccgcgtaattggcccgccgccctggtgtaccaggaaattccccagcccacgaccgtactacttccgcgagacgcc caggccgaagtccagctgactaactcaggtgtccagctggcgggcggcgccaccctgtgtcgtcaccgccccgctcagg gtataaagcggctggtgatccggggcagaggcacacagctcaacgacgaggtggtgagctcttcgctgggtctgcgacc tgacggagtcttccaactcgccggatcggggagatcttccttcacgcctcgtcaggccgtcctgactttggagagttcgtcctc gcagccccgctcgggtggcatcggcactctccagttcgtggaggagttcactccctcggtctacttcaaccccttctccggct cccccggccactacccggacgagttcatcccgaacttcgacgccatcagcgagtcggtggacggctacgattgaatgtcc catggtggcgcagctgacctagctcggcttcgacacctggaccactgccgccgcttccgctgcttcgctcgggatctcgccg agtttgcctactttgagctgcccgaggagcaccctcagggcccggcccacggagtgcggatcgtcgtcgaagggggcct cgactcccacctgcttcggatcttcagccagcgtccgatcctggtcgagcgcgagcaaggacagacccttctgactctgta ctgcatctgcaaccaccccggcctgcatgaaagtctttgttgtctgctgtgtactgagtataataaaagctgagatcagcgac tactccggacttccgtgtgttcctgaatccatcaaccagtctttgttcttcaccgggaacgagaccgagctccagctccagtgt aagccccacaagaagtacctcacctggctgttccagggctccccgatcgccgttgtcaaccactgcgacaacgacggag tcctgctgagcggccctgccaaccttactttttccacccgcagaagcaagctccagctcttccaacccttcctccccgggacc tatcag tg eg tctcg g g accctg ccatcacaccttccacctg atcccg aataccacag eg teg ctccccg ctactaacaac caaactaacctccaccaacg ccaccg teg ctag g ccacaatacatg cccatattag actatg ag g ccg ag ccacag eg acccatgctccccgctattagttacttcaatctaaccggcggagatgactgacccactggccaacaacaacgtcaacgac cttctcctggacatggacggccgcgcctcggagcagcgactcgcccaacttcgcattcgccagcagcaggagagagcc gtcaaggagctgcaggatgcggtggccatccaccagtgcaagagaggcatcttctgcctggtgaaacaggccaagatct cctacgaggtcactccaaacgaccatcgcctctcctacgagctcctgcagcagcgccagaagttcacctgcctggtcgga gtcaaccccatcgtcatcacccagcagtctggcgataccaaggggtgcatccactgctcctgcgactcccccgactgcgtc cacactctg atcaag accctctg eg g cctccg eg acctcctccccatg aactaatcacccccttatccag tg aaataaag at catattg atg atg attttacag aaataaaaaataatcatttg atttg aaataaag atacaatcatattg atg atttg ag tttaaca aaaaaataaagaatcacttacttgaaatctgataccaggtctctgtccatgttttctgccaacaccacttcactcccctcttccc agctctggtactgcaggccccggcgggctgcaaacttcctccacacgctgaaggggatgtcaaattcctcctgtccctcaat cttcattttatcttctatcagatgtccaaaaagcgcgtccgggtggatgatgacttcgaccccgtctacccctacgatgcagac aacgcaccgaccgtgcccttcatcaacccccccttcgtctcttcagatggattccaagagaagcccctgggggtgttgtccc tgcgactggccgaccccgtcaccaccaagaacggggaaatcaccctcaagctgggagagggggtggacctcgattcct cgggaaaactcatctccaacacggccaccaaggccgccgcccctctcagtttttccaacaacaccatttcccttaacatgg atcaccccttttacactaaagatggaaaattatccttacaagtttctccaccattaaatatactgagaacaagcattctaaaca cactagctttaggttttggatcaggtttaggactccgtggctctgccttggcagtacagttagtctctccacttacatttgatactg atggaaacataaagcttaccttagacagaggtttgcatgttacaacaggagatgcaattgaaagcaacataagctgggct aaaggtttaaaatttgaagatggagccatagcaaccaacattggaaatgggttagagtttggaagcagtagtacagaaac aggtgttgatgatgcttacccaatccaagttaaacttggatctggccttagctttgacagtacaggagccataatggctggta acaaag aag acg ataaactcactttg tg g acaacacctg atccatcaccaaactg tcaaatactcg cag aaaatg atg c aaaactaacactttgcttgactaaatgtggtagtcaaatactggccactgtgtcagtcttagttgtaggaagtggaaacctaa accccattactggcaccgtaagcagtgctcaggtgtttctacgttttgatgcaaacggtgttcttttaacagaacattctacact aaaaaaatactgggggtataggcagggagatagcatagatggcactccatataccaatgctgtaggattcatgcccaattt aaaagcttatccaaagtcacaaagttctactactaaaaataatatagtagggcaagtatacatgaatggagatgtttcaaa acctatgcttctcactataaccctcaatggtactgatgacagcaacagtacatattcaatgtcattttcatacacctggactaat ggaagctatgttggagcaacatttggggctaactcttataccttctcatacatcgcccaagaatgaacactgtatcccaccct gcatgccaacccttcccaccccactctgtggaacaaactctgaaacacaaaataaaataaagttcaagtgttttattgattca acag ttttacagg attcg ag cag ttatttttcctccaccctcccag g acatg g aatacaccaccctctccccccg cacag cctt gaacatctgaatgccattggtgatggacatgcttttggtctccacgttccacacagtttcagagcgagccagtctcgggtcgg tcagggagatgaaaccctccgggcactcccgcatctgcacctcacagctcaacagctgaggattgtcctcggtggtcggg atcacggttatctggaagaagcagaagagcggcggtgggaatcatagtccgcgaacgggatcggccggtggtgtcgca tcaggccccgcagcagtcgctgccgccgccgctccgtcaagctgctgctcagggggtccgggtccagggactccctcag catgatgcccacggccctcagcatcagtcgtctggtgcggcgggcgcagcagcgcatgcggatctcgctcaggtcgctgc agtacgtgcaacacagaaccaccaggttgttcaacagtccatagttcaacacgctccagccgaaactcatcgcgggaag gatgctacccacgtggccgtcgtaccagatcctcaggtaaatcaagtggtgccccctccagaacacgctgcccacgtaca tgatctccttgggcatgtggcggttcaccacctcccggtaccacatcaccctctggttgaacatgcagccccggatgatcctg cggaaccacagggccagcaccgccccgcccgccatgcagcgaagagaccccgggtcccggcaatggcaatggagg acccaccgctcgtacccgtggatcatctgggagctgaacaagtctatgttggcacagcacaggcatatgctcatgcatctct tcagcactctcaactcctcgggggtcaaaaccatatcccagggcacggggaactcttgcaggacagcgaaccccgcag aacagggcaatcctcgcacagaacttacattgtgcatggacagggtatcgcaatcaggcagcaccgggtgatcctccac cagagaagcgcgggtctcggtctcctcacagcgtggtaagggggccggccgatacgggtgatggcgggacgcggctg atcgtgttcgcgaccgtgtcatgatgcagttgctttcggacattttcgtacttgctgtagcagaacctggtccgggcgctgcaca ccgatcgccggcggcggtctcggcgcttggaacgctcggtgttgaaattgtaaaacagccactctctcagaccgtgcagc agatctagggcctcaggagtgatgaagatcccatcatgcctgatggctctgatcacatcgaccaccgtggaatgggccag acccagccagatgatgcaattttgttgggtttcggtgacggcgggggagggaagaacaggaagaaccatgattaactttta atccaaacggtctcggagtacttcaaaatgaagatcgcggagatggcacctctcgcccccgctgtgttggtggaaaataa cagccaggtcaaaggtgatacggttctcgagatgttccacggtggcttccagcaaagcctccacgcgcacatccagaaa caagacaatagcgaaagcgggagggttctctaattcctcaatcatcatgttacactcctgcaccatccccagataattttcatt tttccagccttgaatgattcgaactagttcCtgaggtaaatccaagccagccatgataaagagctcgcgcagagcgccctc caccggcattcttaagcacaccctcataattccaagatattctgctcctggttcacctgcagcagattgacaagcggaatatc aaaatctctg ccg eg atccctg ag ctcctccctcag caataactg taag tactctttcatatcct ctccg aaattttt ag ccatag gaccaccaggaataagattagggcaagccacagtacagataaaccgaagtcctccccagtgagcattgccaaatgca agactgctataagcatgctggctagacccggtgatatcttccagataactggacagaaaatcgcccaggcaatttttaaga aaatcaacaaaagaaaaatcctccaggtggacgtttagagcctcgggaacaacgatgaagtaaatgcaagcggtgcgt tccagcatggttagttagctgatctgtagaaaaaacaaaaatgaacattaaaccatgctagcctggcgaacaggtgggta aatcgttctctccagcaccaggcaggccacggggtctccggcgcgaccctcgtaaaaattgtcgctatgattgaaaaccat cacagagagacgttcccggtggccggcgtgaatgattcgacaagatgaatacacccccggaacattggcgtccgcgagt gaaaaaaagcgcccgaggaagcaataaggcactacaatgctcagtctcaagtccagcaaagcgatgccatgcggatg aagcacaaaattctcaggtgcgtacaaaatgtaattactcccctcctgcacaggcagcaaagcccccgatccctccaggt acacatacaaagcctcagcgtccatagcttaccgagcagcagcacacaacaggcgcaagagtcagagaaaggctga gctctaacctgtccacccgctctctgctcaatatatagcccagatctacactgacgtaaaggccaaagtctaaaaatacccg ccaaataatcacacacg cccag cacacg cccag aaacegg tg acacactcaaaaaaatacg eg cacttcctcaaacg cccaaaactgccgtcatttccgggttcccacgctacgtcatcaaaacacgactttcaaattccgtcgaccgttaaaaacgtc acccg ccccg cccctaacgg teg cccgtctctcag ccaatcag eg ccccg catccccaaattcaaacacctcatttg cata ttaacg eg cacaaaaag tttg ag g tatattattg atg atg gTT A ATT A A SEQ ID NO:59: Nucleotide Seqeunce of Preferred EMCV IRES (pIRES)
TAACGTTACTGGCCGAAGCCGCTTGGAATAAGGCCGGTGTGCGTTTGTCTATATGT TATTTTCCACCATATTGCCGTCTTTTGGCAATGTGAGGGCCCGGAAACCTGGCCCT GTCTTCTTGACGAGCATTCCTAGGGGTCTTTCCCCTCTCGCCAAAGGAATGCAAGG TCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTGGAAGCTTCTTGAAGACAAACAA CGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCCACCTGGCGACAGGTGCCT CTGCGGCCAAAAGCCACGTGTATAAGATACACCTGCAAAGGCGGCACAACCCCAG TGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATGGCTCTCCTCAAGCGT ATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTGTATGGGATCTGATC TGGGGCCTCGGTGCACATGCTTTACATGTGTTTAGTCGAGGTTAAAAAACGTCTAG GCCCCCCGAACCACGGGGACGTGGTTTTCCTTTGAAAAACACGATGATAATATGGC CACAACCATG
(The minimal EMCV IRES (mIRES) lacks the underlined 15 nucleotides)
SEQ ID NO: 60. Amino Acid Sequence Comprising an Immunogenic PSA, PSCA, and PSMA Polypeptide (Encoded by by Plasmid 916 and Vectors AdC68- 734 and AdC68W-734)
MASIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRH SLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAV KVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTK FMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYR KWIKDTIVANPGSEGRGSLLTCGDVEENPGPASKAVLLALLMAGLALQPGTALLCYSCK AQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNIT CCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQLGSQTLNFDLLKLAGDVESNP GPMASARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKA ENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPN YISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFF KLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDG WNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQ KLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGT LRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFA SWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNL TKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRA RYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQD FDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDA LFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
SEQ ID N0:61. Nucleotide Sequence Encoding the Amino Acid Sequence of SEQ ID NO:60.
atggctagcatcgtcggagggtgggagtgcgaaaagcactcacagccatggcaggtcctggtcgcctcgcgcggacgc gccgtgtgtggaggtgtgctggtccacccgcagtgggtgttgactgcggcccattgcatcagaaataagtccgtgatcctctt ggggagacattccctgtttcaccccgaagatactggacaggtgttccaagtgagccactccttcccgcatccactgtacgac atgagcctgctgaagaaccgctttctgcggccaggggacgactcatcacacgatttgatgctgcttcggctctcggaaccg gccgagctcaccgacgcagtgaaggtcatggacctccctacgcaagagcctgctctcggtaccacttgttacgcatcggg atggggctccatcgagccggaagaattcctgaccccgaaaaagctgcagtgcgtggatctgcacgtgatttcgaatgacg tgtgcgcgcaagtgcatccacaaaaggtcactaagttcatgctgtgcgccggaaggtggaccggcggaaaatcgacctg ttccggcgacagcggaggcccactcgtgtgcaacggtgtgctgcagggcatcactagctggggatcagaaccgtgcgcg cttccggagcggccctcgctctacacgaaggtggtgcactaccgcaaatggattaaagataccatcgtcgcaaaccctgg atccgaaggtaggggttcattattgacctgtggagatgtcgaagaaaacccaggacccgctagcaaagcagtgctgctgg cgctcctgatggctggactcgcgctgcagcctggaaccgccctgctctgttactcgtgcaaggcccaagtctcgaatgagg actgtttgcaagtggaaaactgcacccagctcggagaacaatgctggactgcacggatccgcgctgtcggcctgctgacc gtgatctccaaagggtgctcattgaactgcgtggacgatagccaggactactacgtgggaaagaagaatatcacttgttgc g acacg g atctttg caacg eg tccg g ag eg cacg ccctg cag ccag cag ccg ccattctg g ccctg ettcegg ccctgg g gttgctgctctggggtccgggccagctcggatcccagaccctgaactttgatctgctgaaactggcaggcgatgtggaaag caacccaggcccaatggctagcgctcgcagaccgcggtggctgtgtgcaggggcgctcgtcctggcgggtggcttcttttt gctcggctttcttttcggatggttcatcaaatcgtcaaacgaagctaccaatatcaccccgaagcacaacatgaaggcctttc tggatgagctgaaggctgagaacattaagaagttcctctacaacttcacccagatcccacatttggcgggcactgagcag aactttcagttggctaagcagatccagagccagtggaaggaattcggcctggactccgtcgagctggcgcattacgatgtg ctgctgagctaccctaataagactcatccgaactatatctcgattatcaatgaggacggaaacgaaatctttaacacgtccct cttcgagccgccaccgcctggatacgagaacgtgtcagatatcgtgcctccgttctcggccttctcgccccagggaatgcc cgaaggggacctggtgtacgtgaactacgcaaggaccgaggacttcttcaagttggagcgggatatgaagatcaattgc agcggaaagatcgtcatcgcccgctacggcaaagtgttccgcggcaacaaggtgaagaatgcacagttggcaggcgc caagggcgtcatcctctactcggatcctgccgactacttcgctcctggcgtgaaatcctaccctgatggttggaatctgccag gaggaggggtgcagaggggaaatatcctgaacctgaacggtgccggtgacccacttactccgggttacccggccaacg aatacgcgtacaggcggggtatcgcggaagccgtcggactgccgtccatcccggtccatccgattggttactacgacgcc cagaagctcctcgaaaagatgggaggcagcgcccctccggactcgtcatggagaggctcgctgaaggtgccatacaac gtgggacccggattcactggaaatttcagcactcaaaaagtgaagatgcacattcactccactaacgaagtcaccaggat ctacaacgtcatcggaaccctccggggagcggtggaaccggaccgctacgtgatcctcggtggacaccgggatagctg ggtgttcggaggaatcgatcctcaatcgggcgcagccgtcgtccatgaaatcgtcaggtcctttggtactcttaagaaggag ggctggcgccctagacgcactattctgttcgcctcgtgggatgccgaagaatttggtctgctcggcagcaccgaatgggctg aggaaaactcccgcctgctccaagaacgcggagtggcgtacatcaatgccgactcatccatcgaaggaaactacacgc tgcgggtggactgcactccactgatgtactcgctcgtgcacaacctgaccaaagaactcaaatccccagacgaaggattc gagggaaaatcgctgtacgagtcgtggaccaagaagagcccatccccggagttcagcgggatgccgcggatctcaaa gctcggatcaggaaatgatttcgaagtgttctttcagaggctgggaattgcgtcgggaagggctcggtacacgaaaaactg ggaaactaacaagttctcgggatacccgctgtaccactcggtgtatgaaacttacgaactggtggagaaattctacgatcct atgtttaagtaccacctgactgtggcccaagtgagaggcggaatggtgttcgagttggccaattcaattgtgctgccattcgat tgccgcgactacgccgtggtgctgagaaagtacgcagacaaaatctactcaatcagcatgaagcacccacaagagatg aaaacctactcagtctccttcgactccctcttctccgcggtgaagaacttcaccgagatcgcgagcaaattctcggagcgcc ttcaag attttg acaaatccaatccg atcg tcctccg catg atg aatg accag ctcatg tttctcg aacgg g ccttcatcg ate cactgggacttccggaccggccgttttaccgccacgtgatctacgcgccctcgtcgcataacaagtatgctggagagagct tcccgggtatctacgacgcattgttcgacattgagtccaaggtggatccgtccaaagcctggggtgaagtgaagcgccaa atctacgtggcggcctttaccgtccaggcggcagcagaaaccttgagcgaggtggct
SEQ ID NO: 62. Nucleotide Sequence of Plasmid 916
ggcgtaatgctctgccagtgttacaaccaattaaccaattctgattagaaaaactcatcgagcatcaaatgaaactgcaattt attcatatcaggattatcaataccatatttttgaaaaagccgtttctgtaatgaaggagaaaactcaccgaggcagttccata ggatggcaagatcctggtatcggtctgcgattccgactcgtccaacatcaatacaacctattaatttcccctcgtcaaaaata aggttatcaagtgagaaatcaccatgagtgacgactgaatccggtgagaatggcaaaagcttatgcatttctttccagactt gttcaacaggccagccattacgctcgtcatcaaaatcactcgcatcaaccaaaccgttattcattcgtgattgcgcctgagc gagacgaaatacgcgatcgctgttaaaaggacaattacaaacaggaatcaaatgcaaccggcgcaggaacactgcca gcgcatcaacaatattttcacctgaatcaggatattcttctaatacctggaatgctgttttcccggggatcgcagtggtgagtaa ccatgcatcatcaggagtacggataaaatgcttgatggtcggaagaggcataaattccgtcagccagtttagtctgaccatc tcatctgtaacatcattggcaacgctacctttgccatgtttcagaaacaactctggcgcatcgggcttcccatacaatcgatag attgtcgcacctgattgcccgacattatcgcgagcccatttatacccatataaatcagcatccatgttggaatttaatcgcggc ctcgagcaagacgtttcccgttgaatatggctcataacaccccttgtattactgtttatgtaagcagacaggtcgacaatattg gctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctcatgtccaatatgaccgccatgttgacattg attattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggt aaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaa tagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaa gtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctactt ggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttg actcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaa tgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgttta gtgaaccgtcagatcgcctggagacgccatccacgctgttttgacctccatagaagacaccgggaccgatccagcctccg cggccgggaacggtgcattggaacgcggattccccgtgccaagagtgactcaccgtccggatctcagcaagcaggtatg tactctccagggtgggcctggcttccccagtcaagactccagggatttgagggacgctgtgggctcttctcttacatgtaccttt tgcttgcctcaaccctgactatcttccaggtcaggatcccagagtcaggggtctgtattttcctgctggtggctccagttcagga acagtaaaccctgctccgaatattgcctctcacatctcgtcaatctccgcgaggactggggaccctgtgacgaacatggct agcatcgtcggagggtgggagtgcgaaaagcactcacagccatggcaggtcctggtcgcctcgcgcggacgcgccgtg tgtggaggtgtgctggtccacccgcagtgggtgttgactgcggcccattgcatcagaaataagtccgtgatcctcttgggga gacattccctgtttcaccccgaagatactggacaggtgttccaagtgagccactccttcccgcatccactgtacgacatgag cctgctgaagaaccgctttctgcggccaggggacgactcatcacacgatttgatgctgcttcggctctcggaaccggccga gctcaccgacgcagtgaaggtcatggacctccctacgcaagagcctgctctcggtaccacttgttacgcatcgggatggg gctccatcgagccggaagaattcctgaccccgaaaaagctgcagtgcgtggatctgcacgtgatttcgaatgacgtgtgc gcgcaagtgcatccacaaaaggtcactaagttcatgctgtgcgccggaaggtggaccggcggaaaatcgacctgttccg gcgacagcggaggcccactcgtgtgcaacggtgtgctgcagggcatcactagctggggatcagaaccgtgcgcgcttcc ggagcggccctcgctctacacgaaggtggtgcactaccgcaaatggattaaagataccatcgtcgcaaaccctggatcc gaaggtaggggttcattattgacctgtggagatgtcgaagaaaacccaggacccgctagcaaagcagtgctgctggcgct cctgatggctggactcgcgctgcagcctggaaccgccctgctctgttactcgtgcaaggcccaagtctcgaatgaggactg tttgcaagtggaaaactgcacccagctcggagaacaatgctggactgcacggatccgcgctgtcggcctgctgaccgtga tctccaaagggtgctcattgaactgcgtggacgatagccaggactactacgtgggaaagaagaatatcacttgttgcgaca cggatctttgcaacgcgtccggagcgcacgccctgcagccagcagccgccattctggccctgcttccggccctggggttgc tgctctggggtccgggccagctcggatcccagaccctgaactttgatctgctgaaactggcaggcgatgtggaaagcaac ccaggcccaatggctagcgctcgcagaccgcggtggctgtgtgcaggggcgctcgtcctggcgggtggcttctttttgctcg gctttcttttcggatggttcatcaaatcgtcaaacgaagctaccaatatcaccccgaagcacaacatgaaggcctttctggat gagctgaaggctgagaacattaagaagttcctctacaacttcacccagatcccacatttggcgggcactgagcagaacttt cagttggctaagcagatccagagccagtggaaggaattcggcctggactccgtcgagctggcgcattacgatgtgctgct g ag ctaccctaataag actcatccg aactatatctcg attatcaatg agg acg g aaacg aaatctttaacacg tccctcttcg agccgccaccgcctggatacgagaacgtgtcagatatcgtgcctccgttctcggccttctcgccccagggaatgcccgaa ggggacctggtgtacgtgaactacgcaaggaccgaggacttcttcaagttggagcgggatatgaagatcaattgcagcg gaaagatcgtcatcgcccgctacggcaaagtgttccgcggcaacaaggtgaagaatgcacagttggcaggcgccaag ggcgtcatcctctactcggatcctgccgactacttcgctcctggcgtgaaatcctaccctgatggttggaatctgccaggagg aggggtgcagaggggaaatatcctgaacctgaacggtgccggtgacccacttactccgggttacccggccaacgaatac gcgtacaggcggggtatcgcggaagccgtcggactgccgtccatcccggtccatccgattggttactacgacgcccaga agctcctcgaaaagatgggaggcagcgcccctccggactcgtcatggagaggctcgctgaaggtgccatacaacgtgg gacccggattcactggaaatttcagcactcaaaaagtgaagatgcacattcactccactaacgaagtcaccaggatctac aacgtcatcggaaccctccggggagcggtggaaccggaccgctacgtgatcctcggtggacaccgggatagctgggtgt tcggaggaatcgatcctcaatcgggcgcagccgtcgtccatgaaatcgtcaggtcctttggtactcttaagaaggagggct ggcgccctagacgcactattctgttcgcctcgtgggatgccgaagaatttggtctgctcggcagcaccgaatgggctgagg aaaactcccgcctgctccaagaacgcggagtggcgtacatcaatgccgactcatccatcgaaggaaactacacgctgc gggtggactgcactccactgatgtactcgctcgtgcacaacctgaccaaagaactcaaatccccagacgaaggattcga gggaaaatcgctgtacgagtcgtggaccaagaagagcccatccccggagttcagcgggatgccgcggatctcaaagct cggatcaggaaatgatttcgaagtgttctttcagaggctgggaattgcgtcgggaagggctcggtacacgaaaaactggg aaactaacaagttctcgggatacccgctgtaccactcggtgtatgaaacttacgaactggtggagaaattctacgatcctat gtttaagtaccacctgactgtggcccaagtgagaggcggaatggtgttcgagttggccaattcaattgtgctgccattcgattg ccg eg actacg ccg tg g tg ctg ag aaag tacg cag acaaaatctactcaatcag catg aag cacccacaag ag atg a aaacctactcagtctccttcgactccctcttctccgcggtgaagaacttcaccgagatcgcgagcaaattctcggagcgcctt caagattttgacaaatccaatccgatcgtcctccgcatgatgaatgaccagctcatgtttctcgaacgggccttcatcgatcc actgggacttccggaccggccgttttaccgccacgtgatctacgcgccctcgtcgcataacaagtatgctggagagagctt cccgggtatctacgacgcattgttcgacattgagtccaaggtggatccgtccaaagcctggggtgaagtgaagcgccaaa tctacgtggcggcctttaccgtccaggcggcagcagaaaccttgagcgaggtggcttaaagatctgggccctaacaaaac aaaaagatggggttattccctaaacttcatgggttacgtaattggaagttgggggacattgccacaagatcatattgtacaaa agatcaaacactgttttagaaaacttcctgtaaacaggcctattgattggaaagtatgtcaaaggattgtgggtcttttgggcttt gctgctccatttacacaatgtggatatcctgccttaatgcctttgtatgcatgtatacaagctaaacaggctttcactttctcgcca acttacaaggcctttctaagtaaacagtacatgaacctttaccccgttgctcggcaacggcctggtctgtgccaagtgtttgct gacgcaacccccactggctggggcttggccataggccatcagcgcatgcgtggaacctttgtggctcctctgccgatccat actgcggaactcctagccgcttgttttgctcgcagccggtctggagcaaagctcataggaactgacaattctgtcgtcctctc gcggaaatatacatcgtttcgatctacgtatgatctttttccctctgccaaaaattatggggacatcatgaagccccttgagcat ctgacttctggctaataaaggaaatttattttcattgcaatagtgtgttggaattttttgtgtctctcactcggaaggaattctgcatt aatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctc ggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgca ggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccatag gctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagat accaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctccc ttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtg cacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgactta tcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtg gcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggt agctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaa ggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatg agattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaactt ggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactc SEQ ID NO:63. Complete Sequence of the AdC68W-734 Vector
ccatcttcaataatatacctcaaactttttgtgcgcgttaatatgcaaatgaggcgtttgaatttggggaggaagggcggtgatt ggtcgagggatgagcgaccgttaggggcggggcgagtgacgttttgatgacgtggttgcgaggaggagccagtttgcaa gttctcgtgggaaaagtgacgtcaaacgaggtgtggtttgaacacggaaatactcaattttcccgcgctctctgacaggaaa tgaggtgtttctgggcggatgcaagtgaaaacgggccattttcgcgcgaaaactgaatgaggaagtgaaaatctgagtaa tttcgcgtttatggcagggaggagtatttgccgagggccgagtagactttgaccgattacgtgggggtttcgattaccgtgttttt cacctaaatttccgcgtacggtgtcaaagtccggtgtttttactactgtaatagtaatcaattacggggtcattagttcatagccc atatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtc aataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgccc acttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattat gcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttg gcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgt tttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatgggcggtaggcgtgtac ggtgggaggtctatataagcagagctgtccctatcagtgatagagatctccctatcagtgatagagagtttagtgaaccgtc agatccgctagggtaccaacATGGCTAGCATCGTCGGAGGGTGGGAGTGCGAAAAGCACTC ACAGCCATGGCAGGTCCTGGTCGCCTCGCGCGGACGCGCCGTGTGTGGAGGTGT GCTGGTCCACCCGCAGTGGGTGTTGACTGCGGCCCATTGCATCAGAAATAAGTCC GTGATCCTCTTGGGGAGACATTCCCTGTTTCACCCCGAAGATACTGGACAGGTGTT CCAAGTGAGCCACTCCTTCCCGCATCCACTGTACGACATGAGCCTGCTGAAGAAC CGCTTTCTGCGGCCAGGGGACGACTCATCACACGATTTGATGCTGCTTCGGCTCT CGGAACCGGCCGAGCTCACCGACGCAGTGAAGGTCATGGACCTCCCTACGCAAG AGCCTGCTCTCGGTACCACTTGTTACGCATCGGGATGGGGCTCCATCGAGCCGGA AGAATTCCTGACCCCGAAAAAGCTGCAGTGCGTGGATCTGCACGTGATTTCGAATG ACGTGTGCGCGCAAGTGCATCCACAAAAGGTCACTAAGTTCATGCTGTGCGCCGG AAGGTGGACCGGCGGAAAATCGACCTGTTCCGGCGACAGCGGAGGCCCACTCGT GTGCAACGGTGTGCTGCAGGGCATCACTAGCTGGGGATCAGAACCGTGCGCGCTT CCGGAGCGGCCCTCGCTCTACACGAAGGTGGTGCACTACCGCAAATGGATTAAAG ATACCATCGTCGCAAACCCTggatccgaaggtaggggttcattattgacctgtggagatgtcgaagaaaacc caggacccGCTAGCAAAGCAGTGCTGCTGGCGCTCCTGATGGCTGGACTCGCGCTGC AGCCTGGAACCGCCCTGCTCTGTTACTCGTGCAAGGCCCAAGTCTCGAATGAGGA CTGTTTGCAAGTGGAAAACTGCACCCAGCTCGGAGAACAATGCTGGACTGCACGG ATCCGCGCTGTCGGCCTGCTGACCGTGATCTCCAAAGGGTGCTCATTGAACTGCG TGGACGATAGCCAGGACTACTACGTGGGAAAGAAGAATATCACTTGTTGCGACACG GATCTTTGCAACGCGTCCGGAGCGCACGCCCTGCAGCCAGCAGCCGCCATTCTGG CCCTGCTTCCGGCCCTGGGGTTGCTGCTCTGGGGTCCGGGCCAGCTCggatcccaga ccctgaactttgatctgctgaaactggcaggcgatgtggaaagcaacccaggcccaATGGCTAGCGCTCGCA GACCGCGGTGGCTGTGTGCAGGGGCGCTCGTCCTGGCGGGTGGCTTCTTTTTGCT CGGCTTTCTTTTCGGATGGTTCATCAAATCGTCAAACGAAGCTACCAATATCACCCC GAAGCACAACATGAAGGCCTTTCTGGATGAGCTGAAGGCTGAGAACATTAAGAAGT TCCTCTACAACTTCACCCAGATCCCACATTTGGCGGGCACTGAGCAGAACTTTCAG TTGGCTAAGCAGATCCAGAGCCAGTGGAAGGAATTCGGCCTGGACTCCGTCGAGC TGGCGCATTACGATGTGCTGCTGAGCTACCCTAATAAGACTCATCCGAACTATATC TCGATTATCAATGAGGACGGAAACGAAATCTTTAACACGTCCCTCTTCGAGCCGCC ACCGCCTGGATACGAGAACGTGTCAGATATCGTGCCTCCGTTCTCGGCCTTCTCG CCCCAGGGAATGCCCGAAGGGGACCTGGTGTACGTGAACTACGCAAGGACCGAG GACTTCTTCAAGTTGGAGCGGGATATGAAGATCAATTGCAGCGGAAAGATCGTCAT CGCCCGCTACGGCAAAGTGTTCCGCGGCAACAAGGTGAAGAATGCACAGTTGGCA GGCGCCAAGGGCGTCATCCTCTACTCGGATCCTGCCGACTACTTCGCTCCTGGCG TGAAATCCTACCCTGATGGTTGGAATCTGCCAGGAGGAGGGGTGCAGAGGGGAAA TATCCTGAACCTGAACGGTGCCGGTGACCCACTTACTCCGGGTTACCCGGCCAAC GAATACGCGTACAGGCGGGGTATCGCGGAAGCCGTCGGACTGCCGTCCATCCCG GTCCATCCGATTGGTTACTACGACGCCCAGAAGCTCCTCGAAAAGATGGGAGGCA GCGCCCCTCCGGACTCGTCATGGAGAGGCTCGCTGAAGGTGCCATACAACGTGG GACCCGGATTCACTGGAAATTTCAGCACTCAAAAAGTGAAGATGCACATTCACTCC ACTAACGAAGTCACCAGGATCTACAACGTCATCGGAACCCTCCGGGGAGCGGTGG AACCGGACCGCTACGTGATCCTCGGTGGACACCGGGATAGCTGGGTGTTCGGAG GAATCGATCCTCAATCGGGCGCAGCCGTCGTCCATGAAATCGTCAGGTCCTTTGGT ACTCTTAAGAAGGAGGGCTGGCGCCCTAGACGCACTATTCTGTTCGCCTCGTGGG ATGCCGAAGAATTTGGTCTGCTCGGCAGCACCGAATGGGCTGAGGAAAACTCCCG CCTGCTCCAAGAACGCGGAGTGGCGTACATCAATGCCGACTCATCCATCGAAGGA AACTACACGCTGCGGGTGGACTGCACTCCACTGATGTACTCGCTCGTGCACAACC TGACCAAAGAACTCAAATCCCCAGACGAAGGATTCGAGGGAAAATCGCTGTACGA GTCGTGGACCAAGAAGAGCCCATCCCCGGAGTTCAGCGGGATGCCGCGGATCTC AAAGCTCGGATCAGGAAATGATTTCGAAGTGTTCTTTCAGAGGCTGGGAATTGCGT CGGGAAGGGCTCGGTACACGAAAAACTGGGAAACTAACAAGTTCTCGGGATACCC GCTGTACCACTCGGTGTATGAAACTTACGAACTGGTGGAGAAATTCTACGATCCTA TGTTTAAGTACCACCTGACTGTGGCCCAAGTGAGAGGCGGAATGGTGTTCGAGTT GGCCAATTCAATTGTGCTGCCATTCGATTGCCGCGACTACGCCGTGGTGCTGAGA AAGTACGCAGACAAAATCTACTCAATCAGCATGAAGCACCCACAAGAGATGAAAAC CTACTCAGTCTCCTTCGACTCCCTCTTCTCCGCGGTGAAGAACTTCACCGAGATCG CGAGCAAATTCTCGGAGCGCCTTCAAGATTTTGACAAATCCAATCCGATCGTCCTC CGCATGATGAATGACCAGCTCATGTTTCTCGAACGGGCCTTCATCGATCCACTGGG ACTTCCGGACCGGCCGTTTTACCGCCACGTGATCTACGCGCCCTCGTCGCATAAC AAGTATGCTGGAGAGAGCTTCCCGGGTATCTACGACGCATTGTTCGACATTGAGTC CAAGGTGGATCCGTCCAAAGCCTGGGGTGAAGTGAAGCGCCAAATCTACGTGGCG GCCTTTACCGTCCAGGCGGCAGCAGAAACCTTGAGCGAGGTGGCTTGActcgagccta ag cttctag ataag atatccg atccaccg g atctag ataactg atcataatcag ccataccacatttg tag agg ttttacttg ct ttaaaaaacctcccacacctccccctg aacctg aaacataaaatg aatg caattg ttg ttg ttaacttg tttattg cag cttata atggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactc atcaatgtatcttatatgctggccaccgtacatgtggcttcccatgctcgcaagccctggcccgagttcgagcacaatgtcat gaccaggtgcaatatgcatctggggtcccgccgaggcatgttcatgccctaccagtgcaacctgaattatgtgaaggtgct gctggagcccgatgccatgtccagagtgagcctgacgggggtgtttgacatgaatgtggaggtgtggaagattctgagata tgatgaatccaagaccaggtgccgagcctgcgagtgcggagggaagcatgccaggttccagcccgtgtgtgtggatgtg acggaggacctgcgacccgatcatttggtgttgccctgcaccgggacggagttcggttccagcggggaagaatctgacta gagtgagtagtgttctggggcgggggaggacctgcatgagggccagaataactgaaatctgtgcttttctgtgtgttgcagc agcatgagcggaagcggctcctttgagggaggggtattcagcccttatctgacggggcgtctcccctcctgggcgggagt gcgtcagaatgtgatgggatccacggtggacggccggcccgtgcagcccgcgaactcttcaaccctgacctatgcaacc ctgagctcttcgtcgttggacgcagctgccgccgcagctgctgcatctgccgccagcgccgtgcgcggaatggccatggg cgccggctactacggcactctggtggccaactcgagttccaccaataatcccgccagcctgaacgaggagaagctgttgc tgctgatggcccagctcgaggccttgacccagcgcctgggcgagctgacccagcaggtggctcagctgcaggagcaga cgcgggccgcggttgccacggtgaaatccaaataaaaaatgaatcaataaataaacggagacggttgttgattttaacac agagtctgaatctttatttgatttttcgcgcgcggtaggccctggaccaccggtctcgatcattgagcacccggtggatcttttcc aggacccggtagaggtgggcttggatgttgaggtacatgggcatgagcccgtcccgggggtggaggtagctccattgca gggcctcgtgctcgggggtggtgttgtaaatcacccagtcatagcaggggcgcagggcatggtgttgcacaatatctttgag gaggagactgatggccacgggcagccctttggtgtaggtgtttacaaatctgttgagctgggagggatgcatgcgggggg agatgaggtgcatcttggcctggatcttgagattggcgatgttaccgcccagatcccgcctggggttcatgttgtgcaggacc accagcacggtgtatccggtgcacttggggaatttatcatgcaacttggaagggaaggcgtgaaagaatttggcgacgcc tttgtgcccgcccaggttttccatgcactcatccatgatgatggcgatgggcccgtgggcggcggcctgggcaaagacgttt cgggggtcggacacatcatagttgtggtcctgggtgaggtcatcataggccattttaatgaatttggggcggagggtgccgg actgggggacaaaggtaccctcgatcccgggggcgtagttcccctcacagatctgcatctcccaggctttgagctcggag ggggggatcatgtccacctgcggggcgataaagaacacggtttccggggcgggggagatgagctgggccgaaagca agttccggagcagctgggacttgccgcagccggtggggccgtagatgaccccgatgaccggctgcaggtggtagttgag ggagagacagctgccgtcctcccggaggaggggggccacctcgttcatcatctcgcgcacgtgcatgttctcgcgcacca gttccgccaggaggcgctctccccccagggataggagctcctggagcgaggcgaagtttttcagcggcttgagtccgtcg gccatgggcattttggagagggtttgttgcaagagttccaggcggtcccagagctcggtgatgtgctctacggcatctcgatc cagcagacctcctcgtttcgcgggttgggacggctgcgggagtagggcaccagacgatgggcgtccagcgcagccagg gtccggtccttccagggtcgcagcgtccgcgtcagggtggtctccgtcacggtgaaggggtgcgcgccgggctgggcgct tgcgagggtgcgcttcaggctcatccggctggtcgaaaaccgctcccgatcggcgccctgcgcgtcggccaggtagcaat tgaccatgagttcgtagttgagcgcctcggccgcgtggcctttggcgcggagcttacctttggaagtctgcccgcaggcggg acagaggagggacttgagggcgtagagcttgggggcgaggaagacggactcgggggcgtaggcgtccgcgccgca gtgggcgcagacggtctcgcactccacgagccaggtgaggtcgggctggtcggggtcaaaaaccagtttcccgccgttct ttttgatgcgtttcttacctttggtctccatgagctcgtgtccccgctgggtgacaaagaggctgtccgtgtccccgtagaccga ctttatgggccggtcctcgagcggtgtgccgcggtcctcctcgtagaggaaccccgcccactccgagacgaaagcccgg gtccaggccagcacgaaggaggccacgtgggacgggtagcggtcgttgtccaccagcgggtccaccttttccagggtat gcaaacacatgtccccctcgtccacatccaggaaggtgattggcttgtaagtgtaggccacgtgaccgggggtcccggcc gggggggtataaaagggtgcgggtccctgctcgtcctcactgtcttccggatcgctgtccaggagcgccagctgttggggt aggtattccctctcgaaggcgggcatgacctcggcactcaggttgtcagtttctagaaacgaggaggatttgatattgacggt gccggcggagatgcctttcaagagcccctcgtccatctggtcagaaaagacgatctttttgttgtcgagcttggtggcgaag gagccgtagagggcgttggagaggagcttggcgatggagcgcatggtctggtttttttccttgtcggcgcgctccttggcggc gatgttgagctgcacgtactcgcgcgccacgcacttccattcggggaagacggtggtcagctcgtcgggcacgattctgac ctgccagccccgattatgcagggtgatgaggtccacactggtggccacctcgccgcgcaggggctcattagtccagcag aggcgtccgcccttgcgcgagcagaaggggggcagggggtccagcatgacctcgtcgggggggtcggcatcgatggt gaagatgccgggcaggaggtcggggtcaaagtagctgatggaagtggccagatcgtccagggcagcttgccattcgcg cacggccagcgcgcgctcgtagggactgaggggcgtgccccagggcatgggatgggtaagcgcggaggcgtacatg ccgcagatgtcgtagacgtagaggggctcctcgaggatgccgatgtaggtggggtagcagcgccccccgcggatgctg gcgcgcacgtagtcatacagctcgtgcgagggggcgaggagccccgggcccaggttggtgcgactgggcttttcggcgc ggtagacgatctggcggaaaatggcatgcgagttggaggagatggtgggcctttggaagatgttgaagtgggcgtgggg cagtccgaccgagtcgcggatgaagtgggcgtaggagtcttgcagcttggcgacgagctcggcggtgactaggacgtcc agagcgcagtagtcgagggtctcctggatgatgtcatacttgagctgtcccttttgtttccacagctcgcggttgagaaggaa ctcttcgcggtccttccagtactcttcgagggggaacccgtcctgatctgcacggtaagagcctagcatgtagaactggttga cggccttgtaggcgcagcagcccttctccacggggagggcgtaggcctgggcggccttgcgcagggaggtgtgcgtgag ggcgaaagtgtccctgaccatgaccttgaggaactggtgcttgaagtcgatatcgtcgcagcccccctgctcccagagctg gaagtccgtgcgcttcttgtaggcggggttgggcaaagcgaaagtaacatcgttgaagaggatcttgcccgcgcggggca taaagttgcgagtgatgcggaaaggttggggcacctcggcccggttgttgatgacctgggcggcgagcacgatctcgtcg aagccgttgatgttgtggcccacgatgtagagttccacgaatcgcggacggcccttgacgtggggcagtttcttgagctcctc gtaggtgagctcgtcggggtcgctgagcccgtgctgctcgagcgcccagtcggcgagatgggggttggcgcggaggaa ggaagtccagagatccacggccagggcggtttgcagacggtcccggtactgacggaactgctgcccgacggccatttttt cgggggtgacgcagtagaaggtgcgggggtccccgtgccagcgatcccatttgagctggagggcgagatcgagggcg agctcgacgagccggtcgtccccggagagtttcatgaccagcatgaaggggacgagctgcttgccgaaggaccccatc caggtgtaggtttccacatcgtaggtgaggaagagcctttcggtgcgaggatgcgagccgatggggaagaactggatctc ctgccaccaattggaggaatggctgttgatgtgatggaagtagaaatgccgacggcgcgccgaacactcgtgcttgtgttta tacaagcggccacagtgctcgcaacgctgcacgggatgcacgtgctgcacgagctgtacctgagttcctttgacgaggaa tttcagtgggaagtggagtcgtggcgcctgcatctcgtgctgtactacgtcgtggtggtcggcctggccctcttctgcctcgatg gtggtcatgctgacgagcccgcgcgggaggcaggtccagacctcggcgcgagcgggtcggagagcgaggacgagg gcgcgcaggccggagctgtccagggtcctgagacgctgcggagtcaggtcagtgggcagcggcggcgcgcggttgact tgcaggagtttttccagggcgcgcgggaggtccagatggtacttgatctccaccgcgccattggtggcgacgtcgatggctt gcagggtcccgtgcccctggggtgtgaccaccgtcccccgtttcttcttgggcggctggggcgacgggggcggtgcctcttc catggttagaagcggcggcgaggacgcgcgccgggcggcaggggcggctcggggcccggaggcaggggcggcag gggcacgtcggcgccgcgcgcgggtaggttctggtactgcgcccggagaagactggcgtgagcgacgacgcgacggtt gacgtcctggatctgacgcctctgggtgaaggccacgggacccgtgagtttgaacctgaaagagagttcgacagaatca atctcggtatcgttgacggcggcctgccgcaggatctcttgcacgtcgcccgagttgtcctggtaggcgatctcggtcatgaa ctgctcgatctcctcctcttgaaggtctccgcggccggcgcgctccacggtggccgcgaggtcgttggagatgcggcccat gagctgcgagaaggcgttcatgcccgcctcgttccagacgcggctgtagaccacgacgccctcgggatcgcGggcgcg catgaccacctgggcgaggttgagctccacgtggcgcgtgaagaccgcgtagttgcagaggcgctggtagaggtagttg agcgtggtggcgatgtgctcggtgacgaagaaatacatgatccagcggcggagcggcatctcgctgacgtcgcccagc gcctccaaacgttccatggcctcgtaaaagtccacggcgaagttgaaaaactgggagttgcgcgccgagacggtcaact cctcctccagaagacggatgagctcggcgatggtggcgcgcacctcgcgctcgaaggcccccgggagttcctccacttc ctcttcttcctcctccactaacatctcttctacttcctcctcaggcggcagtggtggcgggggagggggcctgcgtcgccggc ggcgcacgggcagacggtcgatgaagcgctcgatggtctcgccgcgccggcgtcgcatggtctcggtgacggcgcgcc cgtcctcgcggggccgcagcgtgaagacgccgccgcgcatctccaggtggccgggggggtccccgttgggcagggag agggcgctgacgatgcatcttatcaattgccccgtagggactccgcgcaaggacctgagcgtctcgagatccacgggatc tgaaaaccgctgaacgaaggcttcgagccagtcgcagtcgcaaggtaggctgagcacggtttcttctggcgggtcatgttg gttgggagcggggcgggcgatgctgctggtgatgaagttgaaataggcggttctgagacggcggatggtggcgaggag caccaggtctttgggcccggcttgctggatgcgcagacggtcggccatgccccaggcgtggtcctgacacctggccaggt ccttgtagtagtcctgcatgagccgctccacgggcacctcctcctcgcccgcgcggccgtgcatgcgcgtgagcccgaag ccgcgctggggctggacgagcgccaggtcggcgacgacgcgctcggcgaggatggcttgctggatctgggtgagggtg gtctggaagtcatcaaagtcgacgaagcggtggtaggctccggtgttgatggtgtaggagcagttggccatgacggacca gttgacggtctggtggcccggacgcacgagctcgtggtacttgaggcgcgagtaggcgcgcgtgtcgaagatgtagtcgtt gcaggtgcgcaccaggtactggtagccgatgaggaagtgcggcggcggctggcggtagagcggccatcgctcggtgg cgggggcgccgggcgcgaggtcctcgagcatggtgcggtggtagccgtagatgtacctggacatccaggtgatgccgg cggcggtggtggaggcgcgcgggaactcgcggacgcggttccagatgttgcgcagcggcaggaagtagttcatggtgg gcacggtctggcccgtgaggcgcgcgcagtcgtggatgctctatacgggcaaaaacgaaagcggtcagcggctcgact ccgtggcctggaggctaagcgaacgggttgggctgcgcgtgtaccccggttcgaatctcgaatcaggctggagccgcag ctaacgtggtattggcactcccgtctcgacccaagcctgcaccaaccctccaggatacggaggcgggtcgttttgcaactttt ttttggaggccggatgagactagtaagcgcggaaagcggccgaccgcgatggctcgctgccgtagtctggagaagaatc gccagggttgcgttgcggtgtgccccggttcgaggccggccggattccgcggctaacgagggcgtggctgccccgtcgttt ccaagaccccatagccagccgacttctccagttacggagcgagcccctcttttgttttgtttgtttttgccagatgcatcccgtac tg eg g cag atg eg cccccaccaccctccaccg caacaacag ccccctccacag ccg g eg cttctg cccccg ccccag c agcaacttccagccacgaccgccgcggccgccgtgagcggggctggacagagttatgatcaccagctggccttggaag agggcgaggggctggcgcgcctgggggcgtcgtcgccggagcggcacccgcgcgtgcagatgaaaagggacgctcg cgaggcctacgtgcccaagcagaacctgttcagagacaggagcggcgaggagcccgaggagatgcgcgcggcccg gttccacgcggggcgggagctgcggcgcggcctggaccgaaagagggtgctgagggacgaggatttcgaggcggac gagctgacggggatcagccccgcgcgcgcgcacgtggccgcggccaacctggtcacggcgtacgagcagaccgtga aggaggagagcaacttccaaaaatccttcaacaaccacgtgcgcaccctgatcgcgcgcgaggaggtgaccctgggc ctgatgcacctgtgggacctgctggaggccatcgtgcagaaccccaccagcaagccgctgacggcgcagctgttcctggt ggtgcagcatagtcgggacaacgaagcgttcagggaggcgctgctgaatatcaccgagcccgagggccgctggctcct ggacctggtgaacattctgcagagcatcgtggtgcaggagcgcgggctgccgctgtccgagaagctggcggccatcaac ttctcggtgctgagtttgggcaagtactacgctaggaagatctacaagaccccgtacgtgcccatagacaaggaggtgaa gatcgacgggttttacatgcgcatgaccctgaaagtgctgaccctgagcgacgatctgggggtgtaccgcaacgacagg atgcaccgtgcggtgagcgccagcaggcggcgcgagctgagcgaccaggagctgatgcatagtctgcagcgggccct gaccggggccgggaccgagggggagagctactttgacatgggcgcggacctgcactggcagcccagccgccgggcc ttggaggcggcggcaggaccctacgtagaagaggtggacgatgaggtggacgaggagggcgagtacctggaagact gatggcgcgaccgtatttttgctagatgcaacaacaacagccacctcctgatcccgcgatgcgggcggcgctgcagagc cagccgtccggcattaactcctcggacgattggacccaggccatgcaacgcatcatggcgctgacgacccgcaacccc gaagcctttagacagcagccccaggccaaccggctctcggccatcctggaggccgtggtgccctcgcgctccaacccca cgcacgagaaggtcctggccatcgtgaacgcgctggtggagaacaaggccatccgcggcgacgaggccggcctggtg tacaacgcgctgctggagcgcgtggcccgctacaacagcaccaacgtgcagaccaacctggaccgcatggtgaccga cgtgcgcgaggccgtggcccagcgcgagcggttccaccgcgagtccaacctgggatccatggtggcgctgaacgccttc ctcagcacccagcccgccaacgtgccccggggccaggaggactacaccaacttcatcagcgccctgcgcctgatggtg accgaggtgccccagagcgaggtgtaccagtccgggccggactacttcttccagaccagtcgccagggcttgcagaccg tgaacctgagccaggctttcaagaacttgcagggcctgtggggcgtgcaggccccggtcggggaccgcgcgacggtgtc gagcctgctgacgccgaactcgcgcctgctgctgctgctggtggcccccttcacggacagcggcagcatcaaccgcaac tcgtacctgggctacctgattaacctgtaccgcgaggccatcggccaggcgcacgtggacgagcagacctaccaggag atcacccacgtgagccgcgccctgggccaggacgacccgggcaacctggaagccaccctgaactttttgctgaccaac cggtcgcagaagatcccgccccagtacgcgctcagcaccgaggaggagcgcatcctgcgttacgtgcagcagagcgt gggcctgttcctgatgcaggagggggccacccccagcgccgcgctcgacatgaccgcgcgcaacatggagcccagca tg tacg ccag caaccg cccg ttcatcaataaactg atg g actacttg catcg g g egg ccg ccatg aactctg actatttcac caacgccatcctgaatccccactggctcccgccgccggggttctacacgggcgagtacgacatgcccgaccccaatgac gggttcctgtgggacgatgtggacagcagcgtgttctccccccgaccgggtgctaacgagcgccccttgtggaagaagga aggcagcgaccgacgcccgtcctcggcgctgtccggccgcgagggtgctgccgcggcggtgcccgaggccgccagtc ctttcccgagcttgcccttctcgctgaacagtatccgcagcagcgagctgggcaggatcacgcgcccgcgcttgctgggcg aagaggagtacttgaatgactcgctgttgagacccgagcgggagaagaacttccccaataacgggatagaaagcctgg tggacaagatgagccgctggaagacgtatgcgcaggagcacagggacgatccccgggcgtcgcagggggccacga gccggggcagcgccgcccgtaaacgccggtggcacgacaggcagcggggacagatgtgggacgatgaggactccg ccgacgacagcagcgtgttggacttgggtgggagtggtaacccgttcgctcacctgcgcccccgtatcgggcgcatgatgt aagagaaaccgaaaataaatgatactcaccaaggccatggcgaccagcgtgcgttcgtttcttctctgttgttgttgtatctag tatgatgaggcgtgcgtacccggagggtcctcctccctcgtacgagagcgtgatgcagcaggcgatggcggcggcggcg atgcagcccccgctggaggctccttacgtgcccccgcggtacctggcgcctacggaggggcggaacagcattcgttactc ggagctggcacccttgtacgataccacccggttgtacctggtggacaacaagtcggcggacatcgcctcgctgaactacc agaacgaccacagcaacttcctgaccaccgtggtgcagaacaatgacttcacccccacggaggccagcacccagacc atcaactttgacgagcgctcgcggtggggcggccagctgaaaaccatcatgcacaccaacatgcccaacgtgaacgag ttcatgtacagcaacaagttcaaggcgcgggtgatggtctcccgcaagacccccaatggggtgacagtgacagaggatt atgatggtagtcaggatgagctgaagtatgaatgggtggaatttgagctgcccgaaggcaacttctcggtgaccatgacca tcgacctgatgaacaacgccatcatcgacaattacttggcggtggggcggcagaacggggtgctggagagcgacatcg gcgtgaagttcgacactaggaacttcaggctgggctgggaccccgtgaccgagctggtcatgcccggggtgtacaccaa cgaggctttccatcccgatattgtcttgctgcccggctgcggggtggacttcaccgagagccgcctcagcaacctgctgggc attcgcaagaggcagcccttccaggaaggcttccagatcatgtacgaggatctggaggggggcaacatccccgcgctcc tggatgtcgacgcctatgagaaaagcaaggaggatgcagcagctgaagcaactgcagccgtagctaccgcctctaccg aggtcaggggcgataattttgcaagcgccgcagcagtggcagcggccgaggcggctgaaaccgaaagtaagatagtc attcagccggtggagaaggatagcaagaacaggagctacaacgtactaccggacaagataaacaccgcctaccgca gctggtacctagcctacaactatggcgaccccgagaagggcgtgcgctcctggacgctgctcaccacctcggacgtcac ctgcggcgtggagcaagtctactggtcgctgcccgacatgatgcaagacccggtcaccttccgctccacgcgtcaagttag caactacccggtggtgggcgccgagctcctgcccgtctactccaagagcttcttcaacgagcaggccgtctactcgcagc ag ctg eg eg ccttcacctcg cttacg cacg tcttcaaccg cttccccg ag aaccag atcctcg tccg cccg cccg eg ccca ccattaccaccgtcagtgaaaacgttcctgctctcacagatcacgggaccctgccgctgcgcagcagtatccggggagtc cagcgcgtgaccgttactgacgccagacgccgcacctgcccctacgtctacaaggccctgggcatagtcgcgccgcgcg tcctctcg ag ccg caccttctaaatg tccattctcatctcg cccag taataacacegg ttg g gg cctg eg eg eg cccag caa gatgtacggaggcgctcgccaacgctccacgcaacaccccgtgcgcgtgcgcgggcacttccgcgctccctggggcgc cctcaagggccgcgtgcggtcgcgcaccaccgtcgacgacgtgatcgaccaggtggtggccgacgcgcgcaactaca cccccgccgccgcgcccgtctccaccgtggacgccgtcatcgacagcgtggtggcCgacgcgcgccggtacgcccgc gccaagagccggcggcggcgcatcgcccggcggcaccggagcacccccgccatgcgcgcggcgcgagccttgctgc gcagggccaggcgcacgggacgcagggccatgctcagggcggccagacgcgcggcttcaggcgccagcgccggca ggacccggagacgcgcggccacggcggcggcagcggccatcgccagcatgtcccgcccgcggcgagggaacgtgt actgggtgcgcgacgccgccaccggtgtgcgcgtgcccgtgcgcacccgcccccctcgcacttgaagatgttcacttcgc gatgttgatgtgtcccagcggcgaggaggatgtccaagcgcaaattcaaggaagagatgctccaggtcatcgcgcctga gatctacggccctgcggtggtgaaggaggaaagaaagccccgcaaaatcaagcgggtcaaaaaggacaaaaagga agaagaaagtgatgtggacggattggtggagtttgtgcgcgagttcgccccccggcggcgcgtgcagtggcgcgggcgg aaggtgcaaccggtgctgagacccggcaccaccgtggtcttcacgcccggcgagcgctccggcaccgcttccaagcgc tcctacgacgaggtgtacggggatgatgatattctggagcaggcggccgagcgcctgggcgagtttgcttacggcaagcg cagccgttccgcaccgaaggaagaggcggtgtccatcccgctggaccacggcaaccccacgccgagcctcaagcccg tgaccttgcagcaggtgctgccgaccgcggcgccgcgccgggggttcaagcgcgagggcgaggatctgtaccccacca tgcagctgatggtgcccaagcgccagaagctggaagacgtgctggagaccatgaaggtggacccggacgtgcagccc gaggtcaaggtgcggcccatcaagcaggtggccccgggcctgggcgtgcagaccgtggacatcaagattcccacgga gcccatggaaacgcagaccgagcccatgatcaagcccagcaccagcaccatggaggtgcagacggatccctggatg ccatcggctcctagtcgaagaccccggcgcaagtacggcgcggccagcctgctgatgcccaactacgcgctgcatccttc catcatccccacgccgggctaccgcggcacgcgcttctaccgcggtcataccagcagccgccgccgcaagaccaccac tcgccgccgccgtcgccgcaccgccgctgcaaccacccctgccgccctggtgcggagagtgtaccgccgcggccgcgc acctctg accctg ccg eg eg eg eg ctaccacccg ag catcg eeatttaaaettteg ccTg etttg cag ateaatg g ccct ca catgccgccttcgcgttcccattacgggctaccgaggaagaaaaccgcgccgtagaaggctggcggggaacgggatgc gtcgccaccaccaccggcggcggcgcgccatcagcaagcggttggggggaggcttcctgcccgcgctgatccccatca tcgccgcggcgatcggggcgatccccggcattgcttccgtggcggtgcaggcctctcagcgccactgagacacacttgga aacatcttgtaataaaccAatggactctgacgctcctggtcctgtgatgtgttttcgtagacagatggaagacatcaatttttcg tccctggctccgcgacacggcacgcggccgttcatgggcacctggagcgacatcggcaccagccaactgaacggggg cgccttcaattggagcagtctctggagcgggcttaagaatttcgggtccacgcttaaaacctatggcagcaaggcgtggaa cagcaccacagggcaggcgctgagggataagctgaaagagcagaacttccagcagaaggtggtcgatgggctcgcct cgggcatcaacggggtggtggacctggccaaccaggccgtgcagcggcagatcaacagccgcctggacccggtgcc gcccgccggctccgtggagatgccgcaggtggaggaggagctgcctcccctggacaagcggggcgagaagcgaccc cgccccgatgcggaggagacgctgctgacgcacacggacgagccgcccccgtacgaggaggcggtgaaactgggtc tgcccaccacgcggcccatcgcgcccctggccaccggggtgctgaaacccgaaaagcccgcgaccctggacttgcctc ctccccagccttcccgcccctctacagtggctaagcccctgccgccggtggccgtggcccgcgcgcgacccgggggcac cgcccgccctcatgcgaactggcagagcactctgaacagcatcgtgggtctgggagtgcagagtgtgaagcgccgccg ctgctattaaacctaccgtagcgcttaacttgcttgtctgtgtgtgtatgtattatgtcgccgccgccgctgtccaccagaagga ggagtgaagaggcgcgtcgccgagttgcaagatggccaccccatcgatgctgccccagtgggcgtacatgcacatcgc cggacaggacgcttcggagtacctgagtccgggtctggtgcagtttgcccgcgccacagacacctacttcagtctgggga acaagtttaggaaccccacggtggcgcccacgcacgatgtgaccaccgaccgcagccagcggctgacgctgcgcttcg tgcccgtggaccgcgaggacaacacctactcgtacaaagtgcgctacacgctggccgtgggcgacaaccgcgtgctgg acatggccagcacctactttgacatccgcggcgtgctggatcggggccctagcttcaaaccctactccggcaccgcctac aacagtctggcccccaagggagcacccaacacttgtcagtggacatataaagccgatggtgaaactgccacagaaaa aacctatacatatggaaatgcacccgtgcagggcattaacatcacaaaagatggtattcaacttggaactgacaccgatg atcagccaatctacgcagataaaacctatcagcctgaacctcaagtgggtgatgctgaatggcatgacatcactggtactg atgaaaagtatggaggcagagctcttaagcctgataccaaaatgaagccttgttatggttcttttgccaagcctactaataaa gaaggaggtcaggcaaatgtgaaaacaggaacaggcactactaaagaatatgacatagacatggctttctttgacaaca gaagtgcggctgctgctggcctagctccagaaattgttttgtatactgaaaatgtggatttggaaactccagatacccatattg tatacaaagcaggcacagatgacagcagctcttctattaatttgggtcagcaagccatgcccaacagacctaactacattg gtttcagagacaactttatcgggctcatgtactacaacagcactggcaatatgggggtgctggccggtcaggcttctcagct gaatgctgtggttgacttgcaagacagaaacaccgagctgtcctaccagctcttgcttgactctctgggtgacagaacccgg tatttcagtatgtggaatcaggcggtggacagctatgatcctgatgtgcgcattattgaaaatcatggtgtggaggatgaactt cccaactattgtttccctctggatgctgttggcagaacagatacttatcagggaattaaggctaatggaactgatcaaaccac atggaccaaagatgacagtgtcaatgatgctaatgagataggcaagggtaatccattcgccatggaaatcaacatccaa gccaacctgtggaggaacttcctctacgccaacgtggccctgtacctgcccgactcttacaagtacacgccggccaatgtt accctgcccaccaacaccaacacctacgattacatgaacggccgggtggtggcgccctcgctggtggactcctacatca acatcggggcgcgctggtcgctggatcccatggacaacgtgaaccccttcaaccaccaccgcaatgcggggctgcgcta ccgctccatgctcctgggcaacgggcgctacgtgcccttccacatccaggtgccccagaaatttttcgccatcaagagcctc ctgctcctgcccgggtcctacacctacgagtggaacttccgcaaggacgtcaacatgatcctgcagagctccctcggcaa eg acctg eg cacgg acg g gg cctccatctccttcaccag catcaacctctacg ccaccttcttccccatg gcgcacaacac ggcctccacgctcgaggccatgctgcgcaacgacaccaacgaccagtccttcaacgactacctctcggcggccaacatg ctctaccccatcccggccaacgccaccaacgtgcccatctccatcccctcgcgcaactgggccgccttccgcggctggtc cttcacgcgtctcaagaccaaggagacgccctcgctgggctccgggttcgacccctacttcgtctactcgggctccatcccc tacctcgacggcaccttctacctcaaccacaccttcaagaaggtctccatcaccttcgactcctccgtcagctggcccggca acgaccggctcctgacgcccaacgagttcgaaatcaagcgcaccgtcgacggcgagggctacaacgtggcccagtgc aacatgaccaaggactggttcctggtccagatgctggcccactacaacatcggctaccagggcttctacgtgcccgaggg ctacaaggaccgcatgtactccttcttccgcaacttccagcccatgagccgccaggtggtggacgaggtcaactacaagg actaccaggccgtcaccctggcctaccagcacaacaactcgggcttcgtcggctacctcgcgcccaccatgcgccaggg ccag ccctaccccg ccaactacccctacccg ctcatcg g caag ag eg ccg tcaccag eg tcacccag aaaaag tt cctc tgcgacagggtcatgtggcgcatccccttctccagcaacttcatgtccatgggcgcgctcaccgacctcggccagaacatg ctctatg ccaactccg cccacg eg ctag acatg aatttcg aag teg accccatgg atg ag tccacccttctctatg ttg tcttc gaagtcttcgacgtcgtccgagtgcaccagccccaccgcggcgtcatcgaggccgtctacctgcgcacccccttctcggc cggtaacgccaccacctaagctcttgcttcttgcaagccatggccgcgggctccggcgagcaggagctcagggccatcat ccgcgacctgggctgcgggccctacttcctgggcaccttcgataagcgcttcccgggattcatggccccgcacaagctgg cctgcgccatcgtcaacacggccggccgcgagaccgggggcgagcactggctggccttcgcctggaacccgcgctcg aacacctgctacctcttcgaccccttcgggttctcggacgagcgcctcaagcagatctaccagttcgagtacgagggcctg ctgcgccgcagcgccctggccaccgaggaccgctgcgtcaccctggaaaagtccacccagaccgtgcagggtccgcg ctcggccgcctgcgggctcttctgctgcatgttcctgcacgccttcgtgcactggcccgaccgccccatggacaagaaccc caccatgaacttgctgacgggggtgcccaacggcatgctccagtcgccccaggtggaacccaccctgcgccgcaacca g g ag g eg ctctaccg cttcctcaactcccactccg cctactttcg ctcccaccg eg eg eg catcg ag aagg ccaccg cctt cgaccgcatgaatcaagacatgtaaaccgtgtgtgtatgttaaatgtctttaataaacagcactttcatgttacacatgcatctg agatgatttatttagaaatcgaaagggttctgccgggtctcggcatggcccgcgggcagggacacgttgcggaactggtac ttggccagccacttgaactcggggatcagcagtttgggcagcggggtgtcggggaaggagtcggtccacagcttccgcgt cagttgcagggcgcccagcaggtcgggcgcggagatcttgaaatcgcagttgggacccgcgttctgcgcgcgggagttg cggtacacggggttgcagcactggaacaccatcagggccgggtgcttcacgctcgccagcaccgtcgcgtcggtgatgc tctccacgtcgaggtcctcggcgttggccatcccgaagggggtcatcttgcaggtctgccttcccatggtgggcacgcaccc gggcttgtggttgcaatcgcagtgcagggggatcagcatcatctgggcctggtcggcgttcatccccgggtacatggccttc atgaaagcctccaattgcctgaacgcctgctgggccttggctccctcggtgaagaagaccccgcaggacttgctagagaa ctggttggtggcgcacccggcgtcgtgcacgcagcagcgcgcgtcgttgttggccagctgcaccacgctgcgcccccag cggttctgggtgatcttggcccggtcggggttctccttcagcgcgcgctgcccgttctcgctcgccacatccatctcgatcatgt gctccttctggatcatggtggtcccgtgcaggcaccgcagcttgccctcggcctcggtgcacccgtgcagccacagcgcgc acccggtgcactcccagttcttgtgggcgatctgggaatgcgcgtgcacgaagccctgcaggaagcggcccatcatggtg gtcagggtcttgttgctagtgaaggtcagcggaatgccgcggtgctcctcgttgatgtacaggtggcagatgcggcggtaca cctcgccctgctcgggcatcagctggaagttggctttcaggtcggtctccacgcggtagcggtccatcagcatagtcatgatt tccatacccttctcccaggccgagacgatgggcaggctcatagggttcttcaccatcatcttagcgctagcagccgcggcc agggggtcgctctcgtccagggtctcaaagctccgcttgccgtccttctcggtgatccgcaccggggggtagctgaagccc acggccgccagctcctcctcggcctgtctttcgtcctcgctgtcctggctgacgtcctgcaggaccacatgcttggtcttgcgg ggtttcttcttgggcggcagcggcggcggagatgttggagatggcgagggggagcgcgagttctcgctcaccactactatc tcttcctcttcttggtccgaggccacgcggcggtaggtatgtctcttcgggggcagaggcggaggcgacgggctctcgccg ccgcgacttggcggatggctggcagagccccttccgcgttcgggggtgcgctcccggcggcgctctgactgacttcctccg cggccggccattgtgttctcctagggaggaacaacaagcatggagactcagccatcgccaacctcgccatctgccccca ccg ccg acg ag aag cag cag cag cag aatg aaag cttaaccg ccccg ccg cccag ccccg ccacctccg acg egg ccgtcccagacatgcaagagatggaggaatccatcgagattgacctgggctatgtgacgcccgcggagcacgaggag gagctggcagtgcgcttttcacaagaagagatacaccaagaacagccagagcaggaagcagagaatgagcagagtc aggctgggctcgagcatgacggcgactacctccacctgagcgggggggaggacgcgctcatcaagcatctggcccgg caggccaccatcgtcaaggatgcgctgctcgaccgcaccgaggtgcccctcagcgtggaggagctcagccgcgcctac g ag ttg aacctcttctcg ccg eg eg tg ccccccaag eg ccag cccaatg g cacctg eg ag cccaacccg eg cctcaact tctacccggtcttcgcggtgcccgaggccctggccacctaccacatctttttcaagaaccaaaagatccccgtctcctgccg cgccaaccgcacccgcgccgacgcccttttcaacctgggtcccggcgcccgcctacctgatatcgcctccttggaagagg ttcccaagatcttcgagggtctgggcagcgacgagactcgggccgcgaacgctctgcaaggagaaggaggagagcat gagcaccacagcgccctggtcgagttggaaggcgacaacgcgcggctggcggtgctcaaacgcacggtcgagctgac ccatttcgcctacccggctctgaacctgccccccaaagtcatgagcgcggtcatggaccaggtgctcatcaagcgcgcgt cgcccatctccgaggacgagggcatgcaagactccgaggagggcaagcccgtggtcagcgacgagcagctggcccg gtggctgggtcctaatgctagtccccagagtttggaagagcggcgcaaactcatgatggccgtggtcctggtgaccgtgga gctggagtgcctgcgccgcttcttcgccgacgcggagaccctgcgcaaggtcgaggagaacctgcactacctcttcaggc acgggttcgtgcgccaggcctgcaagatctccaacgtggagctgaccaacctggtctcctacatgggcatcttgcacgag aaccgcctggggcagaacgtgctgcacaccaccctgcgcggggaggcccggcgcgactacatccgcgactgcgtcta cctctacctctgccacacctggcagacgggcatgggcgtgtggcagcagtgtctggaggagcagaacctgaaagagctc tgcaagctcctgcagaagaacctcaagggtctgtggaccgggttcgacgagcgcaccaccgcctcggacctggccgac ctcattttccccg ag eg cctcag g ctg acg ctg eg caacg g cctg cccg actttatg ag ccaaag catg ttg caaaactttc gctctttcatcctcgaacgctccggaatcctgcccgccacctgctccgcgctgccctcggacttcgtgccgctgaccttccgc gagtgccccccgccgctgtggagccactgctacctgctgcgcctggccaactacctggcctaccactcggacgtgatcga ggacgtcagcggcgagggcctgctcgagtgccactgccgctgcaacctctgcacgccgcaccgctccctggcctgcaac ccccagctgctgagcgagacccagatcatcggcaccttcgagttgcaagggcccagcgaaggcgagggttcagccgcc aaggggggtctgaaactcaccccggggctgtggacctcggcctacttgcgcaagttcgtgcccgaggactaccatcccttc gagatcaggttctacgaggaccaatcccatccgcccaaggccgagctgtcggcctgcgtcatcacccagggggcgatcc tggcccaattgcaagccatccagaaatcccgccaagaattcttgctgaaaaagggccgcggggtctacctcgaccccca gaccggtgaggagctcaaccccggcttcccccaggatgccccgaggaaacaagaagctgaaagtggagctgccgcc cgtggaggatttggaggaagactgggagaacagcagtcaggcagaggaggaggagatggaggaagactgggacag cactcaggcagaggaggacagcctgcaagacagtctggaggaagacgaggaggaggcagaggaggaggtggaag aagcagccgccgccagaccgtcgtcctcggcgggggagaaagcaagcagcacggataccatctccgctccgggtcgg ggtcccgctcgaccacacagtagatgggacgagaccggacgattcccgaaccccaccacccagaccggtaagaagg agcggcagggatacaagtcctggcgggggcacaaaaacgccatcgtctcctgcttgcaggcctgcgggggcaacatct ccttcacccgg eg ctacctg ctcttccaccg eg g gg tg aactttccccg caacatcttg cattactaccg tcacctccacagc ccctactacttccaag aag ag g cag cag cag cag aaaaag accag cag aaaaccag cag ctag aaaatccacag c ggcggcagcaggtggactgaggatcgcggcgaacgagccggcgcaaacccgggagctgaggaaccggatctttccc accctctatgccatcttccagcagagtcgggggcaggagcaggaactgaaagtcaagaaccgttctctgcgctcgctcac ccgcagttgtctgtatcacaagagcgaagaccaacttcagcgcactctcgaggacgccgaggctctcttcaacaagtact gcgcgctcactcttaaagagtagcccgcgcccgcccagtcgcagaaaaaggcgggaattacgtcacctgtgcccttcgc cctagccgcctccacccatcatcatgagcaaagagattcccacgccttacatgtggagctaccagccccagatgggcctg gccgccggtgccgcccaggactactccacccgcatgaattggctcagcgccgggcccgcgatgatctcacgggtgaatg acatccg eg cccaccgaaaccag atactcctag aacagtcag eg ctcaccg ccacg ccccg caatcacctcaatccg c gtaattggcccgccgccctggtgtaccaggaaattccccagcccacgaccgtactacttccgcgagacgcccaggccga agtccagctgactaactcaggtgtccagctggcgggcggcgccaccctgtgtcgtcaccgccccgctcagggtataaagc ggctggtgatccggggcagaggcacacagctcaacgacgaggtggtgagctcttcgctgggtctgcgacctgacggagt cttccaactcgccggatcggggagatcttccttcacgcctcgtcaggccgtcctgactttggagagttcgtcctcgcagcccc gctcgggtggcatcggcactctccagttcgtggaggagttcactccctcggtctacttcaaccccttctccggctcccccggc cactacccggacgagttcatcccgaacttcgacgccatcagcgagtcggtggacggctacgattgaatgtcccatggtgg cgcagctgacctagctcggcttcgacacctggaccactgccgccgcttccgctgcttcgctcgggatctcgccgagtttgcct actttgagctgcccgaggagcaccctcagggcccggcccacggagtgcggatcgtcgtcgaagggggcctcgactccc acctgcttcggatcttcagccagcgtccgatcctggtcgagcgcgagcaaggacagacccttctgactctgtactgcatctg caaccaccccggcctgcatgaaagtctttgttgtctgctgtgtactgagtataataaaagctgagatcagcgactactccgg acttccgtgtgttcctgaatccatcaaccagtctttgttcttcaccgggaacgagaccgagctccagctccagtgtaagcccc acaagaagtacctcacctggctgttccagggctccccgatcgccgttgtcaaccactgcgacaacgacggagtcctgctg ag egg ccctg ccaaccttactttttccacccg cag aag caag ctccag ctcttccaacccttcctccccg gg acctatcag t g eg tctcg g g accctg ccatcacaccttccacctg atcccg aataccacag eg teg ctccccg ctactaacaaccaaact aacctccaccaacg ccaccg teg ctag g ccacaatacatg cccatattag actatg ag g ccg ag ccacag eg acccat gctccccgctattagttacttcaatctaaccggcggagatgactgacccactggccaacaacaacgtcaacgaccttctcct ggacatggacggccgcgcctcggagcagcgactcgcccaacttcgcattcgccagcagcaggagagagccgtcaag gagctgcaggatgcggtggccatccaccagtgcaagagaggcatcttctgcctggtgaaacaggccaagatctcctacg aggtcactccaaacgaccatcgcctctcctacgagctcctgcagcagcgccagaagttcacctgcctggtcggagtcaac cccatcgtcatcacccagcagtctggcgataccaaggggtgcatccactgctcctgcgactcccccgactgcgtccacact ctg atcaag accctctg eg g cctccg eg acctcctccccatg aactaatcacccccttatccag tg aaataaag atcatatt g atg atg attttacag aaataaaaaataatcatttg atttg aaataaag atacaatcatattg atg atttg ag tttaacaaaaa aataaag aatcacttacttg aaatctg ataccagg tctctg tccatg ttttctg ccaacaccacttcactcccctcttcccag etc tggtactgcaggccccggcgggctgcaaacttcctccacacgctgaaggggatgtcaaattcctcctgtccctcaatcttcat tttatcttctatcagatgtccaaaaagcgcgtccgggtggatgatgacttcgaccccgtctacccctacgatgcagacaacg caccgaccgtgcccttcatcaacccccccttcgtctcttcagatggattccaagagaagcccctgggggtgttgtccctgcg actggccgaccccgtcaccaccaagaacggggaaatcaccctcaagctgggagagggggtggacctcgattcctcgg gaaaactcatctccaacacggccaccaaggccgccgcccctctcagtttttccaacaacaccatttcccttaacatggatca ccccttttacactaaag atgg aaaattatccttacaag tttctccaccattaaatatactg ag aacaag cattctaaacacact agctttaggttttggatcaggtttaggactccgtggctctgccttggcagtacagttagtctctccacttacatttgatactgatgg aaacataaagcttaccttagacagaggtttgcatgttacaacaggagatgcaattgaaagcaacataagctgggctaaag gtttaaaatttgaagatggagccatagcaaccaacattggaaatgggttagagtttggaagcagtagtacagaaacaggt gttgatgatgcttacccaatccaagttaaacttggatctggccttagctttgacagtacaggagccataatggctggtaacaa agaagacgataaactcactttgtggacaacacctgatccatcaccaaactgtcaaatactcgcagaaaatgatgcaaaa ctaacactttgcttgactaaatgtggtagtcaaatactggccactgtgtcagtcttagttgtaggaagtggaaacctaaacccc attactggcaccgtaagcagtgctcaggtgtttctacgttttgatgcaaacggtgttcttttaacagaacattctacactaaaaa aatactgggggtataggcagggagatagcatagatggcactccatataccaatgctgtaggattcatgcccaatttaaaag cttatccaaagtcacaaagttctactactaaaaataatatagtagggcaagtatacatgaatggagatgtttcaaaacctatg cttctcactataaccctcaatggtactgatgacagcaacagtacatattcaatgtcattttcatacacctggactaatggaagc tatgttggagcaacatttggggctaactcttataccttctcatacatcgcccaagaatgaacactgtatcccaccctgcatgcc aacccttcccaccccactctgtggaacaaactctgaaacacaaaataaaataaagttcaagtgttttattgattcaacagtttt acagg attcg ag cag ttatttttcctccaccctcccag g acatg g aatacaccaccctctccccccg cacag ccttg aacat ctgaatgccattggtgatggacatgcttttggtctccacgttccacacagtttcagagcgagccagtctcgggtcggtcaggg agatgaaaccctccgggcactcccgcatctgcacctcacagctcaacagctgaggattgtcctcggtggtcgggatcacg gttatctggaagaagcagaagagcggcggtgggaatcatagtccgcgaacgggatcggccggtggtgtcgcatcaggc cccgcagcagtcgctgccgccgccgctccgtcaagctgctgctcagggggtccgggtccagggactccctcagcatgat gcccacggccctcagcatcagtcgtctggtgcggcgggcgcagcagcgcatgcggatctcgctcaggtcgctgcagtac gtgcaacacagaaccaccaggttgttcaacagtccatagttcaacacgctccagccgaaactcatcgcgggaaggatgc tacccacgtggccgtcgtaccagatcctcaggtaaatcaagtggtgccccctccagaacacgctgcccacgtacatgatct ccttgggcatgtggcggttcaccacctcccggtaccacatcaccctctggttgaacatgcagccccggatgatcctgcgga accacagggccagcaccgccccgcccgccatgcagcgaagagaccccgggtcccggcaatggcaatggaggaccc accgctcgtacccgtggatcatctgggagctgaacaagtctatgttggcacagcacaggcatatgctcatgcatctcttcag cactctcaactcctcgggggtcaaaaccatatcccagggcacggggaactcttgcaggacagcgaaccccgcagaaca gggcaatcctcgcacagaacttacattgtgcatggacagggtatcgcaatcaggcagcaccgggtgatcctccaccaga gaagcgcgggtctcggtctcctcacagcgtggtaagggggccggccgatacgggtgatggcgggacgcggctgatcgt gttcgcgaccgtgtcatgatgcagttgctttcggacattttcgtacttgctgtagcagaacctggtccgggcgctgcacaccga tcgccggcggcggtctcggcgcttggaacgctcggtgttgaaattgtaaaacagccactctctcagaccgtgcagcagatc tagggcctcaggagtgatgaagatcccatcatgcctgatggctctgatcacatcgaccaccgtggaatgggccagaccca gccagatgatgcaattttgttgggtttcggtgacggcgggggagggaagaacaggaagaaccatgattaacttttaatcca aacggtctcggagtacttcaaaatgaagatcgcggagatggcacctctcgcccccgctgtgttggtggaaaataacagcc aggtcaaaggtgatacggttctcgagatgttccacggtggcttccagcaaagcctccacgcgcacatccagaaacaaga caatagcgaaagcgggagggttctctaattcctcaatcatcatgttacactcctgcaccatccccagataattttcatttttcca g ccttg aatg attcg aactag ttcCtg agg taaatccaag ccag ccatg ataaag ag ctcg eg cag ag eg ccctccacc ggcattcttaagcacaccctcataattccaagatattctgctcctggttcacctgcagcagattgacaagcggaatatcaaaa tctctg ccg eg atccctg ag ctcctccctcag caataactg taag tactctttcatatcctctccg aaatttttag ccatag g acc accaggaataagattagggcaagccacagtacagataaaccgaagtcctccccagtgagcattgccaaatgcaagact gctataagcatgctggctagacccggtgatatcttccagataactggacagaaaatcgcccaggcaatttttaagaaaatc aacaaaagaaaaatcctccaggtggacgtttagagcctcgggaacaacgatgaagtaaatgcaagcggtgcgttccag catggttagttagctgatctgtagaaaaaacaaaaatgaacattaaaccatgctagcctggcgaacaggtgggtaaatcgt tctctccagcaccaggcaggccacggggtctccggcgcgaccctcgtaaaaattgtcgctatgattgaaaaccatcacag agagacgttcccggtggccggcgtgaatgattcgacaagatgaatacacccccggaacattggcgtccgcgagtgaaa aaaagcgcccgaggaagcaataaggcactacaatgctcagtctcaagtccagcaaagcgatgccatgcggatgaagc acaaaattctcaggtgcgtacaaaatgtaattactcccctcctgcacaggcagcaaagcccccgatccctccaggtacac atacaaagcctcagcgtccatagcttaccgagcagcagcacacaacaggcgcaagagtcagagaaaggctgagctct aacctg tccacccg ctctctg ctcaatatatag cccag atctacactg acg taaagg ccaaag tctaaaaatacccg ccaa ataatcacacacg cccag cacacg cccag aaaccg gtg acacactcaaaaaaatacg eg cacttcctcaa acg ccca aaactgccgtcatttccgggttcccacgctacgtcatcaaaacacgactttcaaattccgtcgaccgttaaaaacgtcaccc g ccccg cccctaacg g teg cccg tct ctcag ccaatcag eg ccccg catccccaaattcaaacG cctcatttg catattaa cgcgcacaaaaagtttgaggtatattattgatgatgg SEQ ID NO:64. Amino Acid Sequence Comprising an Immunogenic PSA, PSMA, and PSCA Polypeptide (Encoded by Plasmid 457 and Vector AdC68X-733)
MASIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRH SLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAV KVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTK FMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYR KWIKDTIVANPGSQTLNFDLLKLAGDVESNPGPMASARRPRWLCAGALVLAGGFFLLG FLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQI QSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVS DIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKV KNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPG YPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNV GPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDP QSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERG VAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPE FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVE KFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQE MKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLG LPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTV QAAAETLSEVAGSEGRGSLLTCGDVEENPGPASKAVLLALLMAGLALQPGTALLCYSC KAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNI TCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
SEQ ID NO:65. Nucleotide Sequence Encoding the Amino Acid Sequence of SEQ ID NO:64
ATGGCTAGCATCGTCGGAGGGTGGGAGTGCGAAAAGCACTCACAGCCATGGCAG GTCCTGGTCGCCTCGCGCGGACGCGCCGTGTGTGGAGGTGTGCTGGTCCACCCG CAGTGGGTGTTGACTGCGGCCCATTGCATCAGAAATAAGTCCGTGATCCTCTTGGG GAGACATTCCCTGTTTCACCCCGAAGATACTGGACAGGTGTTCCAAGTGAGCCACT CCTTCCCGCATCCACTGTACGACATGAGCCTGCTGAAGAACCGCTTTCTGCGGCC AGGGGACGACTCATCACACGATTTGATGCTGCTTCGGCTCTCGGAACCGGCCGAG CTCACCGACGCAGTGAAGGTCATGGACCTCCCTACGCAAGAGCCTGCTCTCGGTA CCACTTGTTACGCATCGGGATGGGGCTCCATCGAGCCGGAAGAATTCCTGACCCC GAAAAAGCTGCAGTGCGTGGATCTGCACGTGATTTCGAATGACGTGTGCGCGCAA GTGCATCCACAAAAGGTCACTAAGTTCATGCTGTGCGCCGGAAGGTGGACCGGCG GAAAATCGACCTGTTCCGGCGACAGCGGAGGCCCACTCGTGTGCAACGGTGTGCT GCAGGGCATCACTAGCTGGGGATCAGAACCGTGCGCGCTTCCGGAGCGGCCCTC GCTCTACACGAAGGTGGTGCACTACCGCAAATGGATTAAAGATACCATCGTCGCAA ACCCTggatcccagaccctgaactttgatctgctgaaactggcaggcgatgtggaaagcaacccaggcccaATGG CTAGCGCTCGCAGACCGCGGTGGCTGTGTGCAGGGGCGCTCGTCCTGGCGGGTG GCTTCTTTTTGCTCGGCTTTCTTTTCGGATGGTTCATCAAATCGTCAAACGAAGCTA CCAATATCACCCCGAAGCACAACATGAAGGCCTTTCTGGATGAGCTGAAGGCTGA GAACATTAAGAAGTTCCTCTACAACTTCACCCAGATCCCACATTTGGCGGGCACTG AGCAGAACTTTCAGTTGGCTAAGCAGATCCAGAGCCAGTGGAAGGAATTCGGCCT GGACTCCGTCGAGCTGGCGCATTACGATGTGCTGCTGAGCTACCCTAATAAGACT CATCCGAACTATATCTCGATTATCAATGAGGACGGAAACGAAATCTTTAACACGTCC CTCTTCGAGCCGCCACCGCCTGGATACGAGAACGTGTCAGATATCGTGCCTCCGT TCTCGGCCTTCTCGCCCCAGGGAATGCCCGAAGGGGACCTGGTGTACGTGAACTA CGCAAGGACCGAGGACTTCTTCAAGTTGGAGCGGGATATGAAGATCAATTGCAGC GGAAAGATCGTCATCGCCCGCTACGGCAAAGTGTTCCGCGGCAACAAGGTGAAGA ATGCACAGTTGGCAGGCGCCAAGGGCGTCATCCTCTACTCGGATCCTGCCGACTA CTTCGCTCCTGGCGTGAAATCCTACCCTGATGGTTGGAATCTGCCAGGAGGAGGG GTGCAGAGGGGAAATATCCTGAACCTGAACGGTGCCGGTGACCCACTTACTCCGG GTTACCCGGCCAACGAATACGCGTACAGGCGGGGTATCGCGGAAGCCGTCGGAC TGCCGTCCATCCCGGTCCATCCGATTGGTTACTACGACGCCCAGAAGCTCCTCGA AAAGATGGGAGGCAGCGCCCCTCCGGACTCGTCATGGAGAGGCTCGCTGAAGGT GCCATACAACGTGGGACCCGGATTCACTGGAAATTTCAGCACTCAAAAAGTGAAGA TGCACATTCACTCCACTAACGAAGTCACCAGGATCTACAACGTCATCGGAACCCTC CGGGGAGCGGTGGAACCGGACCGCTACGTGATCCTCGGTGGACACCGGGATAGC TGGGTGTTCGGAGGAATCGATCCTCAATCGGGCGCAGCCGTCGTCCATGAAATCG TCAGGTCCTTTGGTACTCTTAAGAAGGAGGGCTGGCGCCCTAGACGCACTATTCTG TTCGCCTCGTGGGATGCCGAAGAATTTGGTCTGCTCGGCAGCACCGAATGGGCTG AGGAAAACTCCCGCCTGCTCCAAGAACGCGGAGTGGCGTACATCAATGCCGACTC ATCCATCGAAGGAAACTACACGCTGCGGGTGGACTGCACTCCACTGATGTACTCG CTCGTGCACAACCTGACCAAAGAACTCAAATCCCCAGACGAAGGATTCGAGGGAA AATCGCTGTACGAGTCGTGGACCAAGAAGAGCCCATCCCCGGAGTTCAGCGGGAT GCCGCGGATCTCAAAGCTCGGATCAGGAAATGATTTCGAAGTGTTCTTTCAGAGGC TGGGAATTGCGTCGGGAAGGGCTCGGTACACGAAAAACTGGGAAACTAACAAGTT CTCGGGATACCCGCTGTACCACTCGGTGTATGAAACTTACGAACTGGTGGAGAAAT TCTACGATCCTATGTTTAAGTACCACCTGACTGTGGCCCAAGTGAGAGGCGGAATG GTGTTCGAGTTGGCCAATTCAATTGTGCTGCCATTCGATTGCCGCGACTACGCCGT GGTGCTGAGAAAGTACGCAGACAAAATCTACTCAATCAGCATGAAGCACCCACAAG AGATGAAAACCTACTCAGTCTCCTTCGACTCCCTCTTCTCCGCGGTGAAGAACTTC ACCGAGATCGCGAGCAAATTCTCGGAGCGCCTTCAAGATTTTGACAAATCCAATCC GATCGTCCTCCGCATGATGAATGACCAGCTCATGTTTCTCGAACGGGCCTTCATCG ATCCACTGGGACTTCCGGACCGGCCGTTTTACCGCCACGTGATCTACGCGCCCTC GTCGCATAACAAGTATGCTGGAGAGAGCTTCCCGGGTATCTACGACGCATTGTTCG ACATTGAGTCCAAGGTGGATCCGTCCAAAGCCTGGGGTGAAGTGAAGCGCCAAAT CTACGTGGCGGCCTTTACCGTCCAGGCGGCAGCAGAAACCTTGAGCGAGGTGGCT
ggatccgaaggtaggggttcattattgacctgtggagatgtcgaagaaaacccaggacccGCTAGCAAAGCAG TGCTGCTGGCGCTCCTGATGGCTGGACTCGCGCTGCAGCCTGGAACCGCCCTGCT CTGTTACTCGTGCAAGGCCCAAGTCTCGAATGAGGACTGTTTGCAAGTGGAAAACT GCACCCAGCTCGGAGAACAATGCTGGACTGCACGGATCCGCGCTGTCGGCCTGCT GACCGTGATCTCCAAAGGGTGCTCATTGAACTGCGTGGACGATAGCCAGGACTAC TACGTGGGAAAGAAGAATATCACTTGTTGCGACACGGATCTTTGCAACGCGTCCGG AGCGCACGCCCTGCAGCCAGCAGCCGCCATTCTGGCCCTGCTTCCGGCCCTGGG GTTGCTGCTCTGGGGTCCGGGCCAGCTC
SEQ ID NO:66. Nucleotide Sequence of the Multi-antigen Construct (PSCA- F2A-PSMA-mlRES-PSA) Incorporated in Plasmid 459 and Vector AdC68X-735
ATGGCTAGCAAAGCAGTGCTGCTGGCGCTCCTGATGGCTGGACTCGCGCTGCAGC CTGGAACCGCCCTGCTCTGTTACTCGTGCAAGGCCCAAGTCTCGAATGAGGACTG TTTGCAAGTGGAAAACTGCACCCAGCTCGGAGAACAATGCTGGACTGCACGGATC CGCGCTGTCGGCCTGCTGACCGTGATCTCCAAAGGGTGCTCATTGAACTGCGTGG ACGATAGCCAGGACTACTACGTGGGAAAGAAGAATATCACTTGTTGCGACACGGAT CTTTGCAACGCGTCCGGAGCGCACGCCCTGCAGCCAGCAGCCGCCATTCTGGCC CTGCTTCCGGCCCTGGGGTTGCTGCTCTGGGGTCCGGGCCAGCTCggatcccagaccct gaactttgatctgctgaaactggcaggcgatgtggaaagcaacccaggcccaATGGCTAGCGCTCGCAGA CCGCGGTGGCTGTGTGCAGGGGCGCTCGTCCTGGCGGGTGGCTTCTTTTTGCTC GGCTTTCTTTTCGGATGGTTCATCAAATCGTCAAACGAAGCTACCAATATCACCCCG AAGCACAACATGAAGGCCTTTCTGGATGAGCTGAAGGCTGAGAACATTAAGAAGTT CCTCTACAACTTCACCCAGATCCCACATTTGGCGGGCACTGAGCAGAACTTTCAGT TGGCTAAGCAGATCCAGAGCCAGTGGAAGGAATTCGGCCTGGACTCCGTCGAGCT GGCGCATTACGATGTGCTGCTGAGCTACCCTAATAAGACTCATCCGAACTATATCT CGATTATCAATGAGGACGGAAACGAAATCTTTAACACGTCCCTCTTCGAGCCGCCA CCGCCTGGATACGAGAACGTGTCAGATATCGTGCCTCCGTTCTCGGCCTTCTCGC CCCAGGGAATGCCCGAAGGGGACCTGGTGTACGTGAACTACGCAAGGACCGAGG ACTTCTTCAAGTTGGAGCGGGATATGAAGATCAATTGCAGCGGAAAGATCGTCATC GCCCGCTACGGCAAAGTGTTCCGCGGCAACAAGGTGAAGAATGCACAGTTGGCAG GCGCCAAGGGCGTCATCCTCTACTCGGATCCTGCCGACTACTTCGCTCCTGGCGT GAAATCCTACCCTGATGGTTGGAATCTGCCAGGAGGAGGGGTGCAGAGGGGAAAT ATCCTGAACCTGAACGGTGCCGGTGACCCACTTACTCCGGGTTACCCGGCCAACG AATACGCGTACAGGCGGGGTATCGCGGAAGCCGTCGGACTGCCGTCCATCCCGG TCCATCCGATTGGTTACTACGACGCCCAGAAGCTCCTCGAAAAGATGGGAGGCAG CGCCCCTCCGGACTCGTCATGGAGAGGCTCGCTGAAGGTGCCATACAACGTGGGA CCCGGATTCACTGGAAATTTCAGCACTCAAAAAGTGAAGATGCACATTCACTCCAC TAACGAAGTCACCAGGATCTACAACGTCATCGGAACCCTCCGGGGAGCGGTGGAA CCGGACCGCTACGTGATCCTCGGTGGACACCGGGATAGCTGGGTGTTCGGAGGA ATCGATCCTCAATCGGGCGCAGCCGTCGTCCATGAAATCGTCAGGTCCTTTGGTAC TCTTAAGAAGGAGGGCTGGCGCCCTAGACGCACTATTCTGTTCGCCTCGTGGGAT GCCGAAGAATTTGGTCTGCTCGGCAGCACCGAATGGGCTGAGGAAAACTCCCGCC TGCTCCAAGAACGCGGAGTGGCGTACATCAATGCCGACTCATCCATCGAAGGAAA CTACACGCTGCGGGTGGACTGCACTCCACTGATGTACTCGCTCGTGCACAACCTG ACCAAAGAACTCAAATCCCCAGACGAAGGATTCGAGGGAAAATCGCTGTACGAGTC GTGGACCAAGAAGAGCCCATCCCCGGAGTTCAGCGGGATGCCGCGGATCTCAAA GCTCGGATCAGGAAATGATTTCGAAGTGTTCTTTCAGAGGCTGGGAATTGCGTCGG GAAGGGCTCGGTACACGAAAAACTGGGAAACTAACAAGTTCTCGGGATACCCGCT GTACCACTCGGTGTATGAAACTTACGAACTGGTGGAGAAATTCTACGATCCTATGTT TAAGTACCACCTGACTGTGGCCCAAGTGAGAGGCGGAATGGTGTTCGAGTTGGCC AATTCAATTGTGCTGCCATTCGATTGCCGCGACTACGCCGTGGTGCTGAGAAAGTA CGCAGACAAAATCTACTCAATCAGCATGAAGCACCCACAAGAGATGAAAACCTACT CAGTCTCCTTCGACTCCCTCTTCTCCGCGGTGAAGAACTTCACCGAGATCGCGAGC AAATTCTCGGAGCGCCTTCAAGATTTTGACAAATCCAATCCGATCGTCCTCCGCAT GATGAATGACCAGCTCATGTTTCTCGAACGGGCCTTCATCGATCCACTGGGACTTC CGGACCGGCCGTTTTACCGCCACGTGATCTACGCGCCCTCGTCGCATAACAAGTA TGCTGGAGAGAGCTTCCCGGGTATCTACGACGCATTGTTCGACATTGAGTCCAAG GTGGATCCGTCCAAAGCCTGGGGTGAAGTGAAGCGCCAAATCTACGTGGCGGCCT TTACCGTCCAGGCGGCAGCAGAAACCTTGAGCGAGGTGGCTTGAagatctgaccccctaa cgttactggccgaagccgcttggaataaggccggtgtgcgtttgtctatatgttattttccaccatattgccgtcttttggcaatgt gagggcccggaaacctggccctgtcttcttgacgagcattcctaggggtctttcccctctcgccaaaggaatgcaaggtctg ttgaatgtcgtgaaggaagcagttcctctggaagcttcttgaagacaaacaacgtctgtagcgaccctttgcaggcagcgg aaccccccacctggcgacaggtgcctctgcggccaaaagccacgtgtataagatacacctgcaaaggcggcacaacc ccagtgccacgttgtgagttggatagttgtggaaagagtcaaatggctctcctcaagcgtattcaacaaggggctgaagga tgcccagaaggtaccccattgtatgggatctgatctggggcctcggtgcacatgctttacatgtgtttagtcgaggttaaaaaa cgtctaggccccccgaaccacggggacgtggttttcctttgaaaaacacgatgataatATGGCTAGCATCGTCG GAGGGTGGGAGTGCGAAAAGCACTCACAGCCATGGCAGGTCCTGGTCGCCTCGC GCGGACGCGCCGTGTGTGGAGGTGTGCTGGTCCACCCGCAGTGGGTGTTGACTG CGGCCCATTGCATCAGAAATAAGTCCGTGATCCTCTTGGGGAGACATTCCCTGTTT CACCCCGAAGATACTGGACAGGTGTTCCAAGTGAGCCACTCCTTCCCGCATCCACT GTACGACATGAGCCTGCTGAAGAACCGCTTTCTGCGGCCAGGGGACGACTCATCA CACGATTTGATGCTGCTTCGGCTCTCGGAACCGGCCGAGCTCACCGACGCAGTGA AGGTCATGGACCTCCCTACGCAAGAGCCTGCTCTCGGTACCACTTGTTACGCATCG GGATGGGGCTCCATCGAGCCGGAAGAATTCCTGACCCCGAAAAAGCTGCAGTGCG TGGATCTGCACGTGATTTCGAATGACGTGTGCGCGCAAGTGCATCCACAAAAGGTC ACTAAGTTCATGCTGTGCGCCGGAAGGTGGACCGGCGGAAAATCGACCTGTTCCG GCGACAGCGGAGGCCCACTCGTGTGCAACGGTGTGCTGCAGGGCATCACTAGCT GGGGATCAGAACCGTGCGCGCTTCCGGAGCGGCCCTCGCTCTACACGAAGGTGG TGCACTACCGCAAATGGATTAAAGATACCATCGTCGCAAACCCT

Claims

1 . A C68 vector comprising:
(a) a C68 nucleotide sequence; and
(b) a multi-antigen construct that comprises at least one nucleotide sequence encoding an immunogenic PSA polypeptide, at least one nucleotide sequence encoding an immunogenic PSCA polypeptide, and at least one nucleotide sequence encoding an immunogenic PSMA polypeptide.
2. The C68 vector according to claim 1 , wherein the C68 nucleotide sequence is the sequence of SEQ ID NO: 57 lacking at least one gene selected from the group consisting of E1 A, E1 B, E2A, E2B, E3, E4, L1 , L2, L3, L4 and L5 genes, wherein the immunogenic PSA polypeptide comprises amino acids 27-263 of SEQ ID NO:15 or amino acids 4 - 240 of SEQ ID NO:17, wherein the immunogenic PSCA polypeptide comprises the amino acid sequence of SEQ ID NO:21 or amino acids 4-125 Of SEQ ID NO:21 , and wherein the immunogenic PSMA polypeptide is selected from the group consisting of:
1 ) a polypeptide comprising amino acids 15-750 of SEQ ID NO: 1 ;
2) a polypeptide comprising the amino acid sequence of SEQ ID NO:3;
3) a polypeptide comprising the amino acid sequence of SEQ ID NO:5;
4) a polypeptide comprising the amino acid sequence of SEQ ID NO:7;
5) a polypeptide comprising the amino acids 4 - 739 of SEQ ID NO:9;
6) a polypeptide comprising the amino acids 4 - 739 of SEQ ID NO:3;
7) a polypeptide comprising the amino acids 4 - 739 of SEQ ID NO:5;
8) a polypeptide comprising the amino acids 4 - 739 of SEQ ID NO:7; and
9) a polypeptide comprising the amino acid sequence of SEQ ID NO: 9.
3. The C68 vector according to claim 2, wherein the C68 nucleotide sequence is the sequence of SEQ ID NO: 57 lacking the genes of E1 A, E1 B, and E3, and wherein the multi-antigen construct further comprises a separator sequence between two nucleotide sequences encoding two different immunogenic polyppetides and has the structure of formula (I):
1 . PAA1 -SS1 -PAA2-SS2-PAA3 (I)
2. wherein in formula (I):
(i) PAA1 , PAA2, and PAA3 each is a nucleotide sequence encoding an immunogenic PSA polypeptide, a nucleotide sequence encoding immunogenic PSCA polypeptide, or a nucleotide sequence encoding immunogenic PSMA polypeptide, provided the PAA1 , PAA2, and PAA3 encode different PAA polypeptides, and
(ii) SS1 and SS2 are separator sequences and can be the same or different.
4. The C68 vector according to claim 3, wherein the separator sequences are selected from 2A peptide sequences and IRESs.
5. The C68 vector according to claim 4, wherein the 2A peptide sequence is selected from the group consisting of the 2A-peptide sequence of FMDV, ERAV, PTV1 , EMC-B, EMCV, TME-GD7, ERBV, TaV, DrosC, CrPV, ABPV, IFV, Porcine rotavirus, human rotavirus, T brucei TSR1 , and T cruzi AP endonuclease; and wherein the IRES is a EMCV IRES.
6. The vector according to claim 5, wherein PAA1 in formula (I) is a nucleotide sequence encoding the immunogenic PSA polypeptide or a nucleotide sequence encoding the immunogenic PSCA polypeptide.
7. The vector according to claim 6, wherein:
(i) PAA1 is a nucleotide sequence encoding the immunogenic PSA polypeptide;
(ii) PAA2 is a nucleotide sequence encoding an immunogenic PSCA or PSMA polypeptide;
(iii) SS1 is a 2A-peptide sequence; and
(iv) SS2 is a 2A-peptide sequence or an EMCV IRES.
8. The C68 vector according to claim 7, wherein the 2A-peptide sequence is the FMDV 2A-peptide sequence or the TAV 2A-peptide sequence.
9. The C68 vector according to claim 8, wherein:
(1 ) the nucleotide sequence encoding the immunogenic PSA polypeptide is selected from the group consisting of: (i) the nucleotide sequence of SEQ ID NO: 18; (ii) the nucleotide sequence of SEQ ID NO: 20; (iii) the nucleotide sequence comprising nucleotides 10-720 of SEQ ID NO:18; (iv) the nucleotide sequence comprising nucleotides 1 1 15-1825 of SEQ ID NO:58; and (v) the nucleotide sequence comprising nucleotides 1 106-1825 of SEQ ID NO:58;
(2) the nucleotide sequence encoding the immunogenic PSCA polypeptide is selected from the group consisting of: (i) the nucleotide sequence of SEQ ID NO:22; (ii) a nucleotide sequence comprising nucleotides 10- 372 of SEQ ID NO:22; (iii) a nucleotide sequence comprising nucleotides 1892-2257 of SEQ ID NO:58; and (iv) a nucleotide sequence comprising nucleotides 1886-2257 of SEQ ID NO:58; and (3) the nucleotide sequence encoding the immunogenic PSMA polypeptide is selected from the group consisting of: (i) the nucleotide sequence comprising nucleotides 43-2250 of SEQ ID NO:2; (ii) the nucleotide sequence of SEQ ID NO:4; (iii) the nucleotide sequence of SEQ ID NO:6; (iv) the nucleotide sequence of SEQ ID NO:8; (v) the nucleotide sequence of SEQ ID NO:10; (vi) a nucleotide sequence comprising nucleotides 10 - 2217 of SEQ ID NO:4; (vii) a nucleotide sequence comprising nucleotides 10 - 2217 of SEQ ID NO:6; (viii) a nucleotide sequence comprising nucleotides 10 - 2217 of SEQ ID NO:8; (ix) a nucleotide sequence comprising nucleotides 10 - 2217 of SEQ ID NO:10; (x) a nucleotide sequence comprising nucleotides 2333-4543 of SEQ ID NO:58; and (xi) a nucleotide sequence comprising nucleotides 2324-4543 of SEQ ID NO:58.
10. The C68 vector according to claim 3, wherein in formula (I):
(1 ) PAA1 is a nucleotide sequence encoding an immunogenic PSA polypeptide and comprises nucleotides 1 1 15-1825 of SEQ ID NO: 58 or comprises 1 106-1 1 14 of SEQ ID NO: 58;
(2) PAA2 is a nucleotide sequence encoding an immunogenic PSCA polypeptide and comprises nucleotides 1892-2257 of SEQ ID NO: 58 or comprises 1886-2257 of SEQ ID NO: 58;
(3) PAA3 is a nucleotide sequence encoding an immunogenic PSMA polypeptide and comprises nucleotides 2333-4543 of SEQ ID NO: 58 or comprises 2324-4543 of
SEQ ID NO: 58;
(4) SS1 is a nucleotide sequence encoding T2A; and
(5) SS2 is a nucleotide sequence encoding F2A.
1 1 . The C68 vector according to claim 1 , wherein the multi-antigen construct comprises a nucleotide sequence encoding the amino acid sequence of SEQ ID NO:60 or SEQ ID NO:64.
12. The C68 vector according to claim 1 , wherein the multi-antigen construct comprises a nucleotide sequence of SEQ ID NO:61 , SEQ ID NO:65, SEQ ID NO:66, or a degenerate variant of the nucleotide sequence of SEQ ID NO:61 , SEQ ID NO:65, SEQ ID NO:66.
13. The C68 vector according to claim 1 1 or claim 12, further comprising a CMV promoter.
14. The C68 vector according to claim 1 , which comprises the nucleotide sequence of SEQ ID NO:58, nucleotides 9-3481 1 of SEQ ID NO:58, or the nucleotide sequence of SEQ ID NO:63.
15. A composition comprising a C68 vector according to any one of claims 1 - 14.
16. A cell comprising a C68 vector according to any one of claims 1 -14.
17. A pharmaceutical composition comprising a vector according to any one of claims 1 -14 and a pharmaceutically acceptable excipient.
18. A method of treating prostate cancer in a human, comprising administering to the human an effective amount of the pharmaceutical composition according to claim
17.
19. The method according to claim 18, further comprising administering to the human an effective amount of an immune modulator.
20. The method according to claim 18, further comprising administering to the human (a) an effective amount of at least one immune- suppressive-cell inhibitor and (b) an effective amount of at least one immune-effector-cell enhancer.
21 . The method according to claim 20, wherein the immune-suppressive-cell inhibitor is selected from the group consisting of a protein kinase inhibitor, a COX-2 inhibitor, and a PDE5 inhibitor, and wherein the immune-effector-cell enhancer is selected from the group consisting of a CTLA-4 inhibitor, a CD40 agonist, a TLR agonist, a 4-1 BB agonist, a OX40 agonist, a GITR agonist, a PD-1 antagonist, and a PD-L1 antagonist.
22. The method according to claim 21 , wherein:
(1 ) the protein kinase inhibitor is selected from the group consisting of imatinib, sorafenib, lapatinib, zactima MP-412, dasatinib, lestaurtinib, sunitinib malate, axitinib, erlotinib, gefitinib, bosutinib, temsirolismus, and nilotinib;
(2) the CTLA-4 inhibitor is selected from the group consisting of ipilimumab and tremelimumab;
(3) the CD40 agonist is an anti-CD40 antibody selected from the group consisting of G28-5, mAb89, EA-5 , S2C6, CP870893, and dacetuzumab; and
(4) the TLR agonist is a CpG oligonucleotide selected from the group consisting of CpG 24555, CpG 10103, CpG7909, and CpG1018.
23. The method according to claim 22, wherein the immune-suppressive-cell inhibitor is a protein kinase inhibitor selected from the group consisting of sorafenib, dasatinib, imatinib, axitinib, and sunitinib malate, and wherein the immune-effector-cell enhancer is tremelimumab.
24. The method according to claim 22, wherein the immune-suppressive-cell inhibitor is a protein kinase inhibitor selected from the group consisting of sorafenib, dasatinib, imatinib, axitinib, and sunitinib malate, and wherein the immune-effector-cell enhancer is a CpG oligonucleotide selected from the group consisting of CpG24555, CpG10103, CpG7909, and CpG1018.
PCT/IB2014/065419 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens Ceased WO2015063647A1 (en)

Priority Applications (22)

Application Number Priority Date Filing Date Title
ES14802175T ES2715890T3 (en) 2013-11-01 2014-10-17 Expression vectors of prostate associated antigens
SI201431100T SI3062815T1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
DK14802175.1T DK3062815T3 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
JP2016526872A JP2016535989A (en) 2013-11-01 2014-10-17 Vector for expressing prostate-related antigen
MX2016005656A MX2016005656A (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens.
EP18207060.7A EP3524262A1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
NZ718652A NZ718652A (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
RU2016114416A RU2650860C2 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
CA2928908A CA2928908C (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
KR1020167014145A KR102006527B1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
AU2014343321A AU2014343321B2 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
MYPI2016701396A MY182168A (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
CN201480059609.4A CN105682679B (en) 2013-11-01 2014-10-17 Vectors for Expression of Prostate-Associated Antigen
BR112016008806A BR112016008806A2 (en) 2013-11-01 2014-10-17 VECTORS FOR EXPRESSION OF PROSTATE-ASSOCIATED ANTIGENS
PL14802175T PL3062815T3 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
KR1020197021909A KR102196884B1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
EP14802175.1A EP3062815B1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
SG11201602625YA SG11201602625YA (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens
IL244897A IL244897A0 (en) 2013-11-01 2016-04-04 Vectors for expression of prostate-associated antigens
PH12016500673A PH12016500673B1 (en) 2013-11-01 2016-04-12 Vectors for expression of prostate-associated antigens
AU2020202114A AU2020202114A1 (en) 2013-11-01 2020-03-25 Vectors for expression of prostate-associated antigens
PH12020551666A PH12020551666A1 (en) 2013-11-01 2020-10-08 Vectors for expression of prostate-associated antigens

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361898966P 2013-11-01 2013-11-01
US61/898,966 2013-11-01

Publications (1)

Publication Number Publication Date
WO2015063647A1 true WO2015063647A1 (en) 2015-05-07

Family

ID=51945953

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2014/065419 Ceased WO2015063647A1 (en) 2013-11-01 2014-10-17 Vectors for expression of prostate-associated antigens

Country Status (27)

Country Link
US (3) US9402901B2 (en)
EP (2) EP3524262A1 (en)
JP (3) JP2016535989A (en)
KR (2) KR102196884B1 (en)
CN (1) CN105682679B (en)
AR (2) AR098256A1 (en)
AU (2) AU2014343321B2 (en)
BR (1) BR112016008806A2 (en)
CA (1) CA2928908C (en)
DK (1) DK3062815T3 (en)
ES (1) ES2715890T3 (en)
HU (1) HUE043042T2 (en)
IL (1) IL244897A0 (en)
MX (2) MX2016005656A (en)
MY (2) MY182168A (en)
NZ (1) NZ718652A (en)
PE (1) PE20171142A1 (en)
PH (2) PH12016500673B1 (en)
PL (1) PL3062815T3 (en)
PT (1) PT3062815T (en)
RU (2) RU2018108259A (en)
SA (1) SA516371030B1 (en)
SG (2) SG10201910889VA (en)
SI (1) SI3062815T1 (en)
TR (1) TR201903074T4 (en)
TW (2) TWI572717B (en)
WO (1) WO2015063647A1 (en)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016092419A1 (en) 2014-12-09 2016-06-16 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2017125844A1 (en) 2016-01-19 2017-07-27 Pfizer Inc. Cancer vaccines
WO2017191147A1 (en) * 2016-05-04 2017-11-09 Transgene Sa Combination therapy with cpg tlr9 ligand
WO2017221031A1 (en) * 2016-06-23 2017-12-28 Oxford University Innovation Limited Adenoviral vector
WO2018069316A3 (en) * 2016-10-10 2018-05-24 Transgene Sa Immunotherapeutic product and mdsc modulator combination therapy
US10092636B2 (en) 2013-11-01 2018-10-09 Pfizer Inc. Vectors for expression of prostate-associated antigens
WO2018170238A3 (en) * 2017-03-15 2018-10-18 Novavax, Inc. Methods and compositions for inducing immune responses against clostridium difficile
WO2019012371A1 (en) 2017-07-11 2019-01-17 Pfizer Inc. Immunogenic compositions comprising cea muc1 and tert
EP3430148A4 (en) * 2016-03-18 2020-01-01 Nantcell, Inc. MULTIMODAL VECTOR FOR DENDRITIC CELL INFECTION
EP3463450A4 (en) * 2016-06-03 2020-07-29 Etubics Corporation COMPOSITIONS AND METHODS FOR TUMOR VACCINATION WITH PROSTATE CANCER-ASSOCIATED ANTIGENS
EP3408394B1 (en) * 2016-01-27 2020-08-12 Total Raffinage Chimie Multigene expression in microalgae
US12275796B2 (en) 2019-12-03 2025-04-15 Evotec International Gmbh Interferon-associated antigen binding proteins and uses thereof

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106459992A (en) 2014-03-17 2017-02-22 塔皮穆内公司 Nucleic acid molecule vaccine composition and use thereof
IL256652B2 (en) * 2015-06-29 2026-03-01 Verastem Inc Defactinib in combination with anti-pd-1 antibody, anti-pd-l1 antibody, or anti-pd-1 ligand for use in the treatment of cancer
KR102883915B1 (en) 2015-12-16 2025-11-18 시애틀 프로젝트 코포레이션 Identification, production, and use of neoantigens
MA46904A (en) * 2016-11-23 2019-10-02 Gritstone Oncology Inc VIRAL ADMINISTRATION OF NEO-ANTIGENS
TW201907937A (en) 2017-05-08 2019-03-01 美商葛利史東腫瘤科技公司 Alpha virus new antigen vector
WO2019075112A1 (en) 2017-10-10 2019-04-18 Gritstone Oncology, Inc. Neoantigen identification using hotspots
KR20260008173A (en) 2017-11-22 2026-01-15 시애틀 프로젝트 코포레이션 Reducing junction epitope presentation for neoantigens
JP7653013B2 (en) 2018-01-04 2025-03-28 アイコニック セラピューティクス リミテッド ライアビリティ カンパニー Anti-Tissue Factor Antibodies, Antibody Drug Conjugates, and Related Methods
TW202039535A (en) 2018-12-18 2020-11-01 德商英麥提克生物技術股份有限公司 Immunotherapy with b*08 restricted peptides and combination of peptides against cancers and related methods
MX2021014525A (en) 2019-05-30 2022-03-17 Gritstone Bio Inc MODIFIED ADENOVIRUSES.
EP4125973A4 (en) * 2019-11-04 2024-03-13 Gritstone bio, Inc. Neoantigen vaccine therapy
RU2726541C1 (en) * 2019-11-19 2020-07-14 Федеральное государственное бюджетное учреждение науки Институт химической биологии и фундаментальной медицины Сибирского отделения Российской академии наук (ИХБФМ СО РАН) Recombinant human breast cancer cell line brcch4e-134, expressing human prostate-specific membrane antigen
WO2021138391A1 (en) 2019-12-30 2021-07-08 Tyra Biosciences, Inc. Indazole compounds
CN113088530A (en) * 2020-01-08 2021-07-09 怡道生物科技(苏州)有限公司 Expression vector based on chimpanzee ChAd63 adenovirus and construction method thereof
EP4192496A4 (en) 2020-08-06 2025-01-01 Gritstone bio, Inc. MULTIPLE EPITOPE VACCINE CASSETTES
US11873296B2 (en) 2022-06-07 2024-01-16 Verastem, Inc. Solid forms of a dual RAF/MEK inhibitor
CN119506295B (en) * 2025-01-21 2025-05-30 上海皓鸿生物医药科技有限公司 Preparation method of prostate specific membrane antigen

Citations (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US628371A (en) 1898-09-10 1899-07-04 Clark W Thomas Machine for making berry-boxes.
WO1998037919A1 (en) 1997-02-28 1998-09-03 University Of Iowa Research Foundation USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998052581A1 (en) 1997-05-20 1998-11-26 Ottawa Civic Hospital Loeb Research Institute Vectors and methods for immunization or therapeutic protocols
WO1998055495A2 (en) 1997-06-06 1998-12-10 Dynavax Technologies Corporation Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof
WO1999011241A1 (en) 1997-09-05 1999-03-11 Smithkline Beecham Biologicals S.A. Oil in water emulsions containing saponins
US5981724A (en) 1991-10-25 1999-11-09 Immunex Corporation DNA encoding CD40 ligand, a cytokine that binds CD40
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6083716A (en) 1996-09-06 2000-07-04 The Trustees Of The University Of Pennsylvania Chimpanzee adenovirus vectors
US6194388B1 (en) 1994-07-15 2001-02-27 The University Of Iowa Research Foundation Immunomodulatory oligonucleotides
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6482411B1 (en) 1999-08-27 2002-11-19 Board Of Regents, The University Of Texas System Methods of reducing bone loss with CD40 ligand
US20030069298A1 (en) 2001-08-15 2003-04-10 Pharmacia & Upjohn Company Crystals including a malic acid salt of a 3-pyrrole substituted 2-indolinone, and compositions thereof
WO2003041070A1 (en) 2001-11-05 2003-05-15 Tdk Corporation Method for manufacturing stamper for information medium and device for manufacturing stamper for information medium
US6573293B2 (en) 2000-02-15 2003-06-03 Sugen, Inc. Pyrrole substituted 2-indolinone protein kinase inhibitors
US20030229229A1 (en) 2002-02-15 2003-12-11 Qingwu Jin Process for preparing indolinone derivatives
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
WO2004024127A2 (en) 2002-09-10 2004-03-25 Pharmacia Italia S.P.A. Solid formulations comprising an indolinone compound
US20050059824A1 (en) 2003-09-11 2005-03-17 Pharmacia & Upjohn Company Method for catalyzing amidation reactions
WO2007067959A2 (en) 2005-12-07 2007-06-14 Medarex, Inc. Ctla-4 antibody dosage escalation regimens
WO2009046739A1 (en) * 2007-10-09 2009-04-16 Curevac Gmbh Composition for treating prostate cancer (pca)

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6833438B1 (en) 1999-06-01 2004-12-21 Agensys, Inc. Serpentine transmembrane antigens expressed in human cancers and uses thereof
EP1159429A2 (en) 1999-02-18 2001-12-05 Compugen Ltd. Psa and klk-2 splicing variants
EP1276896B1 (en) * 2000-04-28 2010-07-21 Mannkind Corporation Epitope synchronization in antigen presenting cells
RU2192889C1 (en) * 2001-03-16 2002-11-20 Эпштейн Олег Ильич Medicinal preparation and method for treating prostatic diseases
EP1903054A3 (en) 2001-06-05 2008-07-23 CureVac GmbH Pharmaceutical compound containing a stabilised mRNA which is optimised for translation in its coded areas
AU2002322285A1 (en) 2001-06-22 2003-01-08 The Trustees Of The University Of Pennsylvania Method for rapid screening of bacterial transformants and novel simian adenovirus proteins
CZ304169B6 (en) 2001-06-22 2013-12-04 The Wistar Institute Of Anatomy And Biology Replication defective simian adenoviral vector, process for its preparation and medicament, immunogenic composition and vaccine comprising a recombinant adenovirus
CA2452015C (en) * 2001-07-05 2012-07-03 Chiron Corporation Polynucleotides encoding antigenic hiv type c polypeptides, polypeptides and uses thereof
US20030198621A1 (en) 2001-07-05 2003-10-23 Megede Jan Zur Polynucleotides encoding antigenic HIV type B and/or type C polypeptides, polypeptides and uses thereof
WO2003031569A2 (en) * 2001-10-10 2003-04-17 Centocor, Inc. Nucleic acid vaccines using tumor antigen encoding nucleic acids with cytokine adjuvant encoding nucleic acid
HU230364B1 (en) * 2001-11-21 2016-03-29 The Trustees Of The University Of Pennsylvania Simian adeniovirus nucleic acid and amino acid sequences, vectors containing same, and methods of use
CA2514419A1 (en) 2003-01-28 2004-08-12 Proscan Rx Pharma Inc. Prostate cancer diagnosis and treatment
KR101291787B1 (en) * 2003-05-30 2013-08-07 어젠시스 인코포레이티드 Prostate stem cell antigen (psca) variants and subsequences thereof
DE10335833A1 (en) 2003-08-05 2005-03-03 Curevac Gmbh Transfection of blood cells with mRNA for immune stimulation and gene therapy
GB0321615D0 (en) * 2003-09-15 2003-10-15 Glaxo Group Ltd Improvements in vaccination
SI2163260T1 (en) * 2004-01-23 2017-07-31 Msd Italia S.R.L. Chimpanzee adenovirus vaccine carriers
CA2563538C (en) 2004-04-28 2013-12-17 The Trustees Of The University Of Pennsylvania Sequential delivery of immunogenic molecules via adenovirus and adeno-associated virus-mediated administrations
DE102004035227A1 (en) 2004-07-21 2006-02-16 Curevac Gmbh mRNA mixture for vaccination against tumor diseases
ES2494843T3 (en) 2005-09-19 2014-09-16 Janssen Diagnostics, Llc Methods and materials to identify the origin of a carcinoma of unknown primary origin
EP2012822B1 (en) 2006-04-28 2010-01-20 The Trustees of the University of Pennsylvania Modified adenovirus hexon protein and uses thereof
GB0706914D0 (en) 2007-04-10 2007-05-16 Isis Innovation Novel adenovirus vectors
US7867483B2 (en) * 2007-10-18 2011-01-11 Bn Immunotherapeutics, Inc. Use of MVA to treat prostate cancer
AU2010291939B2 (en) * 2009-09-14 2012-11-15 Baylor Research Institute Vaccines directed to Langerhans cells
MX346784B (en) * 2010-11-12 2017-03-31 Inovio Pharmaceuticals Inc PROSTATIC ANTIGENS OF CONSENSUS, NUCLEIC ACID MOLECULA THAT CODIFIES AND VACCINES AND USES THAT UNDERSTAND THEM.
WO2012116714A1 (en) * 2011-03-02 2012-09-07 Curevac Gmbh Vaccination in elderly patients
AU2012243039B2 (en) * 2011-04-08 2017-07-13 Immune Design Corp. Immunogenic compositions and methods of using the compositions for inducing humoral and cellular immune responses
CN102294025B (en) * 2011-08-10 2013-06-05 中国人民解放军第三军医大学第三附属医院 Compound of prostate stem cell antigen polypeptide and nucleic acid and preparation method and application thereof
RU2737765C2 (en) * 2012-05-04 2020-12-02 Пфайзер Инк. Prostate-associated antigens and immunotherapeutic regimens based on vaccines
HUE043042T2 (en) 2013-11-01 2019-07-29 Pfizer Vectors for expression of prostate-associated antigens

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US628371A (en) 1898-09-10 1899-07-04 Clark W Thomas Machine for making berry-boxes.
US6410711B1 (en) 1991-10-25 2002-06-25 Immunex Corporation DNA encoding CD40 ligand, a cytokine that binds CD40
US6391637B1 (en) 1991-10-25 2002-05-21 Richard J. Armitage Use of CD40 ligand, a cytokine that binds CD40, to stimulate hybridoma cells
US5981724A (en) 1991-10-25 1999-11-09 Immunex Corporation DNA encoding CD40 ligand, a cytokine that binds CD40
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6194388B1 (en) 1994-07-15 2001-02-27 The University Of Iowa Research Foundation Immunomodulatory oligonucleotides
US6083716A (en) 1996-09-06 2000-07-04 The Trustees Of The University Of Pennsylvania Chimpanzee adenovirus vectors
US6214806B1 (en) 1997-02-28 2001-04-10 University Of Iowa Research Foundation Use of nucleic acids containing unmethylated CPC dinucleotide in the treatment of LPS-associated disorders
WO1998037919A1 (en) 1997-02-28 1998-09-03 University Of Iowa Research Foundation USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998052581A1 (en) 1997-05-20 1998-11-26 Ottawa Civic Hospital Loeb Research Institute Vectors and methods for immunization or therapeutic protocols
US6339068B1 (en) 1997-05-20 2002-01-15 University Of Iowa Research Foundation Vectors and methods for immunization or therapeutic protocols
WO1998055495A2 (en) 1997-06-06 1998-12-10 Dynavax Technologies Corporation Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof
WO1999011241A1 (en) 1997-09-05 1999-03-11 Smithkline Beecham Biologicals S.A. Oil in water emulsions containing saponins
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
US6482411B1 (en) 1999-08-27 2002-11-19 Board Of Regents, The University Of Texas System Methods of reducing bone loss with CD40 ligand
US6573293B2 (en) 2000-02-15 2003-06-03 Sugen, Inc. Pyrrole substituted 2-indolinone protein kinase inhibitors
US20030069298A1 (en) 2001-08-15 2003-04-10 Pharmacia & Upjohn Company Crystals including a malic acid salt of a 3-pyrrole substituted 2-indolinone, and compositions thereof
WO2003041070A1 (en) 2001-11-05 2003-05-15 Tdk Corporation Method for manufacturing stamper for information medium and device for manufacturing stamper for information medium
US20030229229A1 (en) 2002-02-15 2003-12-11 Qingwu Jin Process for preparing indolinone derivatives
WO2004024127A2 (en) 2002-09-10 2004-03-25 Pharmacia Italia S.P.A. Solid formulations comprising an indolinone compound
US20050059824A1 (en) 2003-09-11 2005-03-17 Pharmacia & Upjohn Company Method for catalyzing amidation reactions
WO2007067959A2 (en) 2005-12-07 2007-06-14 Medarex, Inc. Ctla-4 antibody dosage escalation regimens
WO2009046739A1 (en) * 2007-10-09 2009-04-16 Curevac Gmbh Composition for treating prostate cancer (pca)

Non-Patent Citations (20)

* Cited by examiner, † Cited by third party
Title
ANDREA L. SZYMCZAK; DARRIO AA VIGNALI: "Development of 2A peptide-based strategies in the design of multicistronic vectors", EXPERT OPINION BIOL. THER, vol. 5, no. 5, 2005, pages 627 - 638, XP055378453, DOI: doi:10.1517/14712598.5.5.627
ANDREA L. SZYMCZAK; DARRIO AA VIGNALI: "Development of 2A peptide-based strategies in the design of multicistronic vectors", EXPERT OPINION BIOL. THER., vol. 5, no. 5, 2005, pages 627 - 638, XP055378453, DOI: doi:10.1517/14712598.5.5.627
BERNADETTE FERRARO ET AL: "Co-delivery of PSA and PSMA DNA vaccines with electroporation induces potent immune responses", HUMAN VACCINES, LANDES BIOSCIENCE, GEORGETOWN, TX, US, vol. /, no. Supplement, 1 January 2011 (2011-01-01), pages 120 - 127, XP007922265, ISSN: 1554-8600, DOI: 10.4161/HV.7.0.14574 *
BOCHKOV, Y. A.; A. C. PALMENBERG: "Translational efficiency of EMCV IRES in bicistronic vectors is dependent upon IRES sequence and gene location.", BIOTECHNIQUES, vol. 41, no. 3, 2006, pages 283 - 284,286,288, XP001536676, DOI: doi:10.2144/000112243
BONNAL, S.; C. BOUTONNET ET AL.: "IRESdb: the Internal Ribosome Entry Site database.", NUCLEIC ACIDS RES, vol. 31, no. 1, 2003, pages 427 - 428
COHEN C J ET AL: "Chimpanzee adenovirus CV-68 adapted as a gene delivery vector interacts with the coxsackievirus and adenovirus receptor", JOURNAL OF GENERAL VIROLOGY, SOCIETY FOR GENERAL MICROBIOLOGY, SPENCERS WOOD, GB, vol. 83, no. 1, 1 January 2002 (2002-01-01), pages 151 - 155, XP002331619, ISSN: 0022-1317 *
FANG, J.; S. YI ET AL.: "An antibody delivery system for regulated expression of therapeutic levels of monoclonal antibodies in vivo.", MOL THER, vol. 15, no. 6, 2007, pages 1153 - 1159, XP002560535, DOI: doi:10.1038/SJ.MT.6300142
J. M. MANLEY; M. J. KALMAN; B. G. CONWAY; C. C. BALL; J. L HAVENS; R. VAIDYANATHAN: "Early Amidation Approach to 3-[(4-amido)pyrrol-2-yl]-2-indolinones", J. ORG. CHEW., vol. 68, 2003, pages 6447 - 6450
JENS RUTER ET AL.: "Immune modulation with weekly dosing of an agonist CD40 antibody in a phase I study of patients with advanced solid tumors", CANCER BIOLOGY & THERAPY, vol. 10, no. 10, 15 November 2010 (2010-11-15), pages 983 - 993
KARAN DEV ET AL: "Cancer immunotherapy: a paradigm shift for prostate cancer treatment.", NATURE REVIEWS. UROLOGY JUL 2012, vol. 9, no. 7, July 2012 (2012-07-01), pages 376 - 385, XP002735888, ISSN: 1759-4820 *
KRIEG, CURR OPIN MOL THER, vol. 3, 2001, pages 15 - 24
KRIEG, VACCINE, vol. 19, 2000, pages 618 - 622
LUKE, G. A.; P. DE FELIPE ET AL.: "Occurrence, function and evolutionary origins of '2A-like' sequences in virus genomes.", J GEN VIROL, vol. 89, 2008, pages 1036 - 1042, XP002552736, DOI: doi:10.1099/vir.0.83428-0
MARRARI, A.; M. LERO ET AL.: "Vaccination therapy in prostate cancer.", CANCER LMMUNOL LMMUNOTHER, vol. 56, no. 4, 2007, pages 429 - 45, XP019489792
MENDEL, D.; LAIRD, D. ET AL.: "In vivo antitumor activity of SU11248, a novel tyrosine kinase inhibitor targeting vascular endothelial growth factor and platelet-derived growth factor receptors: determination of a pharmacokinetic/pharmacodynamic relationship", CLINICAL CANCER RESEARCH, vol. 203, no. 9, pages 327 - 337
PERUZZI D ET AL: "A novel Chimpanzee serotype-based adenoviral vector as delivery tool for cancer vaccines", VACCINE, ELSEVIER LTD, GB, vol. 27, no. 9, 25 February 2009 (2009-02-25), pages 1293 - 1300, XP026194421, ISSN: 0264-410X, [retrieved on 20090120], DOI: 10.1016/J.VACCINE.2008.12.051 *
ROSHORM, Y.; M. G. COTTINGHAM ET AL.: "T cells induced by recombinant chimpanzee adenovirus alone and in prime-boost regimens decrease chimeric EcoHIV/NDK challenge virus load.", EUR J IMMUNOL, vol. 42, no. 12, 2012, pages 3243 - 3255, XP002751729, DOI: doi:10.1002/eji.201242624
TATSIS, N.; L. TESEMA ET AL.: "Chimpanzee-origin adenovirus vectors as vaccine carriers", GENE THER., vol. 13, 2006, pages 421 - 429, XP002527576, DOI: doi:10.1038/sj.gt.3302675
YING WAECKERLE-MEN ET AL: "Dendritic cell-based multi-epitope immunotherapy of hormone-refractory prostate carcinoma", CANCER IMMUNOLOGY, IMMUNOTHERAPY, SPRINGER, BERLIN, DE, vol. 55, no. 12, 13 April 2006 (2006-04-13), pages 1524 - 1533, XP019422513, ISSN: 1432-0851, DOI: 10.1007/S00262-006-0157-3 *
ZENT, CLIVE S ET AL.: "Phase I clinical trial of CpG 7909 (PF-03512676) in patients with previously treated chronic lymphocytic leukemia", LEUKEMIA AND LYMPHOMA, vol. 53, no. 2, 2012, pages 211 - 217

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10092636B2 (en) 2013-11-01 2018-10-09 Pfizer Inc. Vectors for expression of prostate-associated antigens
US11173196B2 (en) 2013-11-01 2021-11-16 Pfizer Inc. Vectors for expression of prostate-associated antigens
EP4166572A1 (en) 2014-12-09 2023-04-19 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2016092419A1 (en) 2014-12-09 2016-06-16 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2017125844A1 (en) 2016-01-19 2017-07-27 Pfizer Inc. Cancer vaccines
US11058753B2 (en) 2016-01-19 2021-07-13 Pfizer Inc. Cancer vaccines
US10251944B2 (en) 2016-01-19 2019-04-09 Pfizer Inc. Cancer vaccines
EP3733201A1 (en) 2016-01-19 2020-11-04 Pfizer Inc Cancer vaccines
EP3408394B1 (en) * 2016-01-27 2020-08-12 Total Raffinage Chimie Multigene expression in microalgae
EP3430148A4 (en) * 2016-03-18 2020-01-01 Nantcell, Inc. MULTIMODAL VECTOR FOR DENDRITIC CELL INFECTION
WO2017191147A1 (en) * 2016-05-04 2017-11-09 Transgene Sa Combination therapy with cpg tlr9 ligand
US20190134190A1 (en) * 2016-05-04 2019-05-09 Transgene Sa Combination therapy with cpg tlr9 ligand
TWI731095B (en) * 2016-06-03 2021-06-21 美商依圖比克斯公司 Compositions and methods for tumor vaccination using prostate cancer-associated antigens
EP3463450A4 (en) * 2016-06-03 2020-07-29 Etubics Corporation COMPOSITIONS AND METHODS FOR TUMOR VACCINATION WITH PROSTATE CANCER-ASSOCIATED ANTIGENS
EP3943604A1 (en) * 2016-06-23 2022-01-26 Oxford University Innovation Limited Adenoviral vector
US11306325B2 (en) 2016-06-23 2022-04-19 Oxford University Innovation Limited Adenoviral vector
WO2017221031A1 (en) * 2016-06-23 2017-12-28 Oxford University Innovation Limited Adenoviral vector
US11970709B2 (en) 2016-06-23 2024-04-30 Oxford University Innovation Limited Adenoviral vector
US12365920B2 (en) 2016-06-23 2025-07-22 Oxford University Innovation Limited Adenoviral vector
WO2018069316A3 (en) * 2016-10-10 2018-05-24 Transgene Sa Immunotherapeutic product and mdsc modulator combination therapy
US11123419B2 (en) 2017-03-15 2021-09-21 Novavax, Inc. Methods and compositions for inducing immune responses against Clostridium difficile
WO2018170238A3 (en) * 2017-03-15 2018-10-18 Novavax, Inc. Methods and compositions for inducing immune responses against clostridium difficile
IL269258B1 (en) * 2017-03-15 2023-05-01 Novavax Inc Methods and compositions for inducing immune responses against clostridium difficile
IL269258B2 (en) * 2017-03-15 2023-09-01 Novavax Inc Methods and compositions for inducing immune responses against clostridium difficile
US11938179B2 (en) 2017-03-15 2024-03-26 Novavax, Inc. Methods and compositions for inducing immune responses against Clostridium difficile
WO2019012371A1 (en) 2017-07-11 2019-01-17 Pfizer Inc. Immunogenic compositions comprising cea muc1 and tert
US12275796B2 (en) 2019-12-03 2025-04-15 Evotec International Gmbh Interferon-associated antigen binding proteins and uses thereof

Also Published As

Publication number Publication date
CA2928908A1 (en) 2015-05-07
HUE043042T2 (en) 2019-07-29
RU2018108259A3 (en) 2021-07-05
US11173196B2 (en) 2021-11-16
KR102196884B1 (en) 2020-12-30
JP2020096588A (en) 2020-06-25
MX2020001813A (en) 2020-07-13
PT3062815T (en) 2019-03-27
RU2650860C2 (en) 2018-04-17
PE20171142A1 (en) 2017-08-10
TR201903074T4 (en) 2019-03-21
AU2014343321B2 (en) 2020-02-06
US20160235829A1 (en) 2016-08-18
KR20190090885A (en) 2019-08-02
SG11201602625YA (en) 2016-05-30
SI3062815T1 (en) 2019-05-31
RU2018108259A (en) 2019-02-25
KR102006527B1 (en) 2019-08-02
AU2020202114A1 (en) 2020-04-16
MX2016005656A (en) 2016-07-14
CA2928908C (en) 2021-01-12
JP6621560B2 (en) 2019-12-18
MY182168A (en) 2021-01-18
TWI650418B (en) 2019-02-11
ES2715890T3 (en) 2019-06-06
US20150125465A1 (en) 2015-05-07
MY196581A (en) 2023-04-19
BR112016008806A2 (en) 2017-10-03
TW201716579A (en) 2017-05-16
AU2014343321A1 (en) 2016-04-28
NZ718652A (en) 2019-06-28
EP3524262A1 (en) 2019-08-14
SA516371030B1 (en) 2021-01-20
EP3062815A1 (en) 2016-09-07
CN105682679A (en) 2016-06-15
DK3062815T3 (en) 2019-03-11
TW201529852A (en) 2015-08-01
PH12016500673A1 (en) 2016-05-30
AR118725A2 (en) 2021-10-27
AR098256A1 (en) 2016-05-18
RU2016114416A (en) 2017-12-06
PH12016500673B1 (en) 2016-05-30
SG10201910889VA (en) 2020-01-30
PH12020551666A1 (en) 2021-05-10
US9402901B2 (en) 2016-08-02
KR20160068974A (en) 2016-06-15
JP2016535989A (en) 2016-11-24
EP3062815B1 (en) 2019-01-16
IL244897A0 (en) 2016-05-31
JP2019205443A (en) 2019-12-05
JP7014764B2 (en) 2022-02-01
TWI572717B (en) 2017-03-01
US10092636B2 (en) 2018-10-09
US20180369352A1 (en) 2018-12-27
PL3062815T3 (en) 2019-07-31
CN105682679B (en) 2020-12-08

Similar Documents

Publication Publication Date Title
US11173196B2 (en) Vectors for expression of prostate-associated antigens
US11110158B2 (en) Prostate-associated antigens and vaccine-based immunotherapy regimens
HK1224563A1 (en) Vectors for expression of prostate-associated antigens

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14802175

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 244897

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12016500673

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2928908

Country of ref document: CA

Ref document number: 2016526872

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014343321

Country of ref document: AU

Date of ref document: 20141017

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 000569-2016

Country of ref document: PE

WWE Wipo information: entry into national phase

Ref document number: 16110994

Country of ref document: CO

Ref document number: IDP00201602945

Country of ref document: ID

Ref document number: MX/A/2016/005656

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2014802175

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016008806

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2014802175

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20167014145

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2016114416

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112016008806

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20160420

WWR Wipo information: refused in national office

Ref document number: 519401726

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 519401726

Country of ref document: SA

Ref document number: 516371030

Country of ref document: SA