WO2014165349A1 - Compositions and methods for in vivo excision of hiv-1 proviral dna - Google Patents
Compositions and methods for in vivo excision of hiv-1 proviral dna Download PDFInfo
- Publication number
- WO2014165349A1 WO2014165349A1 PCT/US2014/031674 US2014031674W WO2014165349A1 WO 2014165349 A1 WO2014165349 A1 WO 2014165349A1 US 2014031674 W US2014031674 W US 2014031674W WO 2014165349 A1 WO2014165349 A1 WO 2014165349A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- hiv
- guide rna
- dna
- target
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1131—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against viruses
- C12N15/1132—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against viruses against retroviridae, e.g. HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
Definitions
- the repeat loci are typically composed of repetitive stretches of nucleotides with a length of 25 to 37 base pairs alternated by nonrepetitive DNA spacers of approximately equal length.
- RNA analysis indicates that CRISPR locus transcripts are cleaved within the repeat sequences to release ⁇ 60-nt to 70 -nt RNA intermediates that contain individual invader targeting sequences and flanking repeat fragments (Tang, et al. (2002) Proc. Natl. Acad. Sci .
- CRISPR/CRISPR-associated (Cas) system for synthetic biology, direct and multiplexed perturbation of gene networks and targeted ex vivo and in vivo gene therapy has been suggested (Mali, et al . (2013) Science 339:823-6) .
- particular molecules for targeting exogenous DNA integrated into the human genome have not been described.
- This invention is a method for inhibiting the function or presence of a target human immunodeficiency virus 1 (HIV-1) DNA sequence in a eukaryotic cell by contacting a eukaryotic cell harboring a target HIV-1 DNA sequence with (a) one or more guide RNA, or nucleic acids encoding said one or more guide RNA, and (b) a Clustered Regularly Interspaced Short Palindromic Repeats-Associated
- HIV-1 human immunodeficiency virus 1
- the target HIV-1 DNA sequence is selected from the group consisting of SEQ ID NO: 2-10.
- the cas protein is cas9, codon-optimized for expression in human cells and/or includes a nuclear localization sequence.
- a kit containing (a) one or more guide RNA, or nucleic acids encoding said one or more guide RNA, wherein said guide RNA hybridizes with a target HIV-1 DNA sequence; and (b) a cas protein; or a nucleic acid encoding said protein is also provided.
- the target HIV-1 DNA sequence is selected from the group consisting of SEQ ID NO: 2 -10.
- the cas protein is cas9, codon-optimized for expression in human cells and/or includes a nuclear localization sequence.
- a vector harboring nucleic acids encoding one or more guide RNA, wherein said guide RNA hybridizes with a target human immunodeficiency virus 1 DNA sequence selected from the group consisting of SEQ ID NO: 2-10 is further provided .
- Figure 1 depicts the secondary structure of a guide RNA transcript with the spacer sequence from HIV-1 LTR.
- Figure 2 shows the delivery of the guide RNA (gRNA) and cas protein with subsequent transcription, translation and cleavage of the HIV-1 target sequence.
- gRNA guide RNA
- Figure 3A shows the effect of HIV-specific guide RNA and hCas9 expression on the expression of endogenous LTR promoter-driven GFP expression.
- Transfection of an empty vector modestly activates expression of GFP (15% GFP+ cells versus 6% GFP+ cells in untreated controls) .
- Figure 3B shows the effect of HIV-specific guide RNA and hCas9 expression on the expression of endogenous LTR promoter-driven GFP expression in the presence of TNF- .
- This analysis indicated that moderate activation of J-Lat cells with exposure to 5 ng/ml TNF-a for only six hours did not alter the results presented in Figure 3A, indicating durable alterations in the integrity of the LTR resulting from specific guide RNA-guided cleavage. All transfections were performed in triplicate.
- FIG. 4A shows that specific guide RNA reduce GFP expression from a LTR . reporter plasmid.
- Jurkat cells were transfected with three plasmids : guide RNA, hCas and HIV-1 reporter plasmid in which an intact LTR and 5' sequence promote the expression of GFP.
- the results show a reduction in the percent of cells expressing GFP with several guide RNA plasmids, but not with guide RNA to U3C and TAR.
- Figure 4B shows the relative integrity of reporter plasmid LTR.
- Jurkat cells were transfected with three plasmids: guide RNA, hCas and HIV-1 reporter plasmid in which an intact LTR and 5' sequence promote the expression of GFP.
- Total DNA was isolated and assayed for integrity of the recovered reporter plasmid by real-time PCR using primers flanking the binding sites of U3B through GAG guide RNAs .
- This invention provides methods and kits for using the CRISPR system to interfere with the function and/or presence of segments of human immunodeficiency virus type-1 (HIV-1) DNA, which are integrated into the host cell genome (e.g., located in vitro or in a subject) and are the source of new viral particles. Without this integrated segment of viral DNA, the infected cell cannot produce new viral particles, thus reducing viral burden in an infected person .
- HSV-1 human immunodeficiency virus type-1
- this invention is a method for inhibiting the function and/or presence of a target HIV-1 DNA sequence in a eukaryotic cell by administering one or more guide RNA and a cas protein, or nucleic acids encoding said guide RNA or cas protein, to a eukaryotic cell harboring a target HIV-1 DNA sequence, wherein said guide RNA hybridizes with said target HIV-1 DNA sequence thereby interfering with the function and/or presence of said target HIV-1 DNA sequence.
- the function of an HIV-1 DNA target sequence is inhibited when, e.g., the target sequence is no longer transcribed and/or translated.
- the HIV-1 DNA target can be mutated or excised.
- the presence of an HIV-1 DNA target sequence is inhibited when the target sequence is, e.g., excised from the host genome .
- CRISPR clustered regularly interspaced short palindromic repeats
- Cas CRISPR-associated
- CRISPR defense involves acquisition and integration of new targeting "spacers” from invading virus or plasmid DNA into the CRISPR locus, expression and processing of short guiding CRISPR RNAs (crRNAs) composed of spacer-repeat units, and cleavage of nucleic acids (most commonly DNA) complementary to the spacer.
- Type II CRISPR systems Three classes of CRISPR systems have been described (Type I, II and III) .
- the Type II CRISPR system is employed as it uses a single effector enzyme, Cas9, to cleave dsDNA, whereas Type I and Type III systems require multiple distinct effectors acting as a complex (Makarova, et al . (2011) Nat. .Rev. Microbiol . 9:467) .
- the Type II effector system is composed of a long pre-crRNA transcribed from the spacer- containing CRISPR locus, the multifunctional Cas9 protein, and a tracrRNA for gRNA processing.
- tracrRNAs hybridize to the repeat regions separating the spacers of the pre- crRNA, initiating dsRNA cleavage by endogenous RNase III, which is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9.
- a tracrRNA : crRNA fusion termed a guide RNA (gRNA) can function in vitro, obviating the need for RNase III and the crRNA processing in general (Jinek, et al . (2012) Science 337:816) .
- a guide RNA molecule is used to target a HIV-1 DNA sequence.
- Guide RNA molecules of this invention can range in size from 80 to 130 nucleotides, 90 to 120 nucleotides or 100 to 110 nucleotides in length and be composed of a combination of RNA and DNA.
- the guide RNA has the sequence R-GU UUU AGA GCU AGA AAU AGC AAG UUA AAA UAA GGC UAG UCC GUU AUC AAC UUG AAA AAG UGG CAC CGA GUC GGU GCT TTT TT (SEQ ID N0:1), wherein R is a spacer sequence that specifically hybridizes to an HIV-1 DNA target sequence.
- Type II CRISPR interference is a result of Cas9 unwinding the DNA duplex and searching for sequences matching the crRNA to cleave. Target recognition occurs upon detection of complementarity between a "protospacer" sequence in the target DNA and the remaining spacer sequence in the crRNA. Cas9 cuts the DNA only if a correct protospacer-adj acent motif (PAM) is also present at the 3' end.
- PAM protospacer-adj acent motif
- Different Type II systems have differing PAM requirements.
- the S. pyogenes system requires an NGG sequence, where N can be any nucleotide (Mali, et al . (2013) Science 339:823-6).
- thermophilus Type II systems require NGGNG (Horvath & Barrangou (2010) Science 327:167) and NAGAAW (Deveau, et al . (2008) J. Bacterid . 190:1390), respectively, while different S. mutans systems tolerate NGG or NAAR (van der Ploeg, et al . (2009) Microbiology 155 : 1966) .
- the guide RNA targets one site in the HIV-1 DNA sequence. In other embodiments, more than one guide RNA is used to target multiple sites within the HIV-1 DNA sequence. In certain embodiments, the spacer of the guide RNA has a target sequence selected from those presented in Table 1. However, bioinformatic analyses have generated extensive databases of CRISPR loci in a variety of bacteria and are of use in determining PAMs and identifying addition CRISPR- targetable HIV-1 sequences (Rho, et al. (2012) PLoS Genet. 8:el002441; Pride, et al . (2011) Genome Res. 21:126) .
- LTR long terminal repeat
- u3 a control element
- TAR Tat activating region
- U5 a control element
- UT untranslated sequence of Gag
- N-term N-terminal portion of Gag
- coding within protein coding sequence of Gag.
- Underlined nucleotides indicate a protospacer-adj acent motif (PAM) .
- the guide RNA targets the LTR portion of the HIV-1 DNA.
- the LTR functions to promote and regulate the transcription of the genes that are essential for assembling new virions, as well as transcribing the entire HIV-1 genome, which is packaged into infectious particles. There are two copies of the LTR in the integrated provirus, thereby doubling the size of the instant target.
- the above identified LTR target sequences have the required PAM sequence and are unique to HIV-1, having no cross-reacting homologies in the human genome. This is of particular importance because the human genome contains many other retroviruses with LTR- like sequences. Thus, very low or no cytotoxicity is expected in uninfected cells.
- the Type II CRISPR systems include the HNH' -type system (Streptococcus-like; also known as the Nmeni subtype, for Neisseria meningitidis serogroup A str. Z2491, or CASS4) , in which Cas9 is sufficient for generating crRNA and cleaving the target DNA.
- Cas9 contains at least two nuclease domains, a RuvC-like nuclease domain near the amino terminus and the HNH (or McrA-like) nuclease domain in the middle of the protein. Given that the HNH nuclease domain is abundant in restriction enzymes and possesses endonuclease activity (Kleanthous, et al . (1999) Nat.
- the cas protein used in the cleavage of the HIV-1 target sequence is a Type II cas protein.
- the cas protein is a Type II cas protein isolated from Streptococcus thermophilus, Listeria innocua, Neisseria meningitidis or S. pyogenes .
- the cas protein is a cas9 protein isolated from Streptococcus thermophilus (See GENBANK Accession No. YP_820832), Listeria innocua (See GENBANK Accession No. NP_472073) , Neisseria meningitidis (See GENBANK Accession No. YP_002342100) or S. pyogenes (See GENBANK Accession Nos. AAK33936 and NP_269215) .
- the cas9 protein has been codon-optimized for expression in human (SEQ ID N0:11) .
- Plasmids harboring nucleic acids encoding cas9 proteins are available from repository sources such as Addgene (Cambridge, MA) . Examples of such plasmids include pMJ806 (S. pyogenes cas9) , pMJ823 (L. innocua cas9) , pMJ824 (S. thermophilus cas9) , pMJ839 (N. meningitides cas9) , and pMJ920 (human codon-optimized cas9) .
- the cas protein of the invention can include a nuclear localization sequence (NLS) .
- NLS nuclear localization sequence
- nuclear localization sequence means an amino acid sequence that induces transport of molecules having such sequences or linked to such sequences into the nucleus of eukaryotic cells.
- the term “having” preferably means that the nuclear localization sequence forms part of the molecule, i.e. that it is linked to the remaining parts of the molecule by covalent bonds, e.g., an in-frame protein fusion.
- linked in this context means any possible linkage between the nuclear localization sequence and another molecule to be introduced into the nucleus of a eukaryotic cell, e.g., by covalent bonds, hydrogen bonds or ionic interactions.
- transport into the nucleus in this context means that the molecule is translocated into the nucleus.
- Nuclear translocation can be detected by direct and indirect means.
- direct observation can be achieved by fluorescence or confocal laser scanning microscopy when the nuclear localization sequence or the translocated molecule ⁇ e.g., the cas protein or guide RNA) are labeled with a fluorescent dye (labeling kits are commercially available, e.g., from Pierce or Molecular Probes) .
- Translocation can also be assessed by electron microscopy if the nuclear localization sequence or the translocated molecule (e.g., the cas protein or guide RNA) are labeled with an electron-dense material such as colloidal gold (Oliver (1999) Methods Mol. Biol. 115:341- 345) .
- Translocation can be assessed in indirect ways, e.g., by measuring cleavage of a target HIV-1 DNAs sequence.
- nuclear localization sequences have been described in the art . These include the nuclear localization sequence of the SV40 virus large T-antigen, the minimal functional unit of which is the seven amino acid sequence PKKKRKV (SEQ ID NO: 12). Other examples of nuclear localization sequences include the nucleoplasmin bipartite NLS with the sequence NLSKRPAAIKKAGQAK KK (SEQ ID NO: 13) (Michaud & Goldfarb (1991) J. Cell Biol.
- the c-myct nuclear localization sequence having the amino acid sequence PAAKRVKLD (SEQ ID NO: 14) or RQRRNELKRSF (SEQ ID NO: 15) (Chesky, et al . (1989) Mol. Cell Biol. 9:2487-2492) and the hRNPAI M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 16) (Siomi & Dreyfuss (1995) J " . Cell Biol. 129:551-560) .
- NLSs include the sequences RMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 17) of the IBB domain from importin-alpha (Gorlich, et al . (1995) Nature 377:246-248); VSRKRPRP (SEQ ID NO:18) and PPKKARED (SEQ ID NO: 19) of the myoma T protein; PQPKKKPL (SEQ ID NO: 20) from human p53; SALIKKKKKMAP (SEQ ID NO: 21) from mouse c-abl IV (Van Etten, et al .
- the NLS is located at the N-terminus of the cas protein. In other embodiments, the NLS is located the C-terminus of the cas protein.
- an isolated molecule e.g., an isolated nucleic acid such as DNA, RNA or an isolated polypeptide
- an isolated molecule means a molecule separated or substantially free from at least some of the other components of the naturally occurring organism, such as for example, the cell structural components or other polypeptides or nucleic acids commonly found associated with the molecule.
- an isolated molecule is at least about 25%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more pure (w/w) .
- the one or more guide RNA and cas protein can be provided to a cell or subject via isolated nucleic acids that encode the guide RNA and cas protein, respectively.
- the isolated nucleic acids encoding the guide RNA and cas protein are provided as naked DNA.
- the isolated nucleic acids encoding the guide RNA and cas protein are incorporated into a gene delivery vector.
- the vector is an expression vector.
- Exemplary vectors include plasmids, lipid vectors and viral vectors.
- the methods of the present invention provide a means for delivering, and expressing, nucleic acids encoding a guide RNA and cas protein in human cells.
- the nucleic acids are expressed transiently in the target cell.
- the nucleic acids are stably incorporated into the target cell, for example, by integration into the genome of the cell or by persistent expression from stably maintained episomes (e.g., derived from Epstein Barr Virus) .
- the isolated nucleic acids, vectors, methods and kits of the invention find use in a method of administering a guide RNA and cas protein to a subject.
- the guide RNA and cas protein can thus be produced in vivo in the subject.
- the subject can have, or be at risk of having an HIV-1 infection such that the guide RNA and cas protein impart a therapeutic effect, e.g., reducing viral burden or spread.
- any suitable vector can be used to deliver the isolated nucleic acids of this invention to the target cell (s) or subject of interest.
- the choice of delivery vector can be made based on a number of factors known in the art, including age and species of the target host, level and persistence of expression desired, the target cell or organ, route of delivery, size of the isolated nucleic acid, safety concerns, and the like.
- Suitable vectors include virus vectors (e.g., retrovirus, alphavirus; vaccinia virus; adenovirus, adeno- associated virus, or herpes simplex virus), lipid vectors, poly-lysine vectors, synthetic polyamino polymer vectors, plasmids, and the like.
- virus vectors e.g., retrovirus, alphavirus; vaccinia virus; adenovirus, adeno- associated virus, or herpes simplex virus
- lipid vectors e.g., poly-lysine vectors, synthetic polyamino polymer vectors, plasmids, and the like.
- viral vector or viral delivery vector can refer to a virus particle that functions as a nucleic acid delivery vehicle, and which contains the vector genome packaged within a virion. Alternatively, these terms can be used to refer to the vector genome when used as a nucleic acid delivery vehicle in the absence of the virion.
- viral vectors include, for example, retrovirus, adenovirus, AAV, herpes virus, and poxvirus vectors.
- the delivery vector is an adenovirus vector.
- adenovirus as used herein, is intended to encompass all adenoviruses, including the Mastadenovirus and
- the adenovirus is a human serogroup C adenovirus
- the adenovirus is serotype 2 (Ad2) or serotype 5 (Ad5) or simian adenovirus such as AdC68.
- vectors can be modified or targeted as described in Douglas, et al . (1996) Nature Biotechnology 14:1574 and US 5,922,315; US 5,770,442 and/or US 5,712,136.
- An adenovirus genome can be manipulated such that it encodes and expresses a nucleic acid of interest but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle. See, for example, Berkner, et al . (1988) BioTechniques 6:616; Rosenfeld, et al . (1991) Science 252:431-434; and Rosenfeld et al . (1992) Cell 68 : 143-155.
- Recombinant adenoviruses can be advantageous in certain circumstances in that they are not capable of infecting nondividing cells and can be used to infect a wide variety of cell types. Furthermore, the virus particle is relatively stable and amenable to purification and concentration, and can be modified so as to affect the spectrum of infectivity. Additionally, introduced adenoviral DNA (and foreign DNA contained therein) is not integrated into the genome of a host cell but remains episomal, thereby avoiding potential problems that can occur as a result of insertional mutagenesis in situations where introduced DNA becomes integrated into the host genome (e.g., as occurs with retroviral DNA) . Moreover, the carrying capacity of the adenoviral genome for foreign DNA is large relative to other delivery vectors (Haj -Ahmand and Graham (1986) J. Virol. 57:267) .
- the adenovirus genome contains a deletion therein, so that at least one of the adenovirus genomic regions does not encode a functional protein.
- an adenovirus vectors can have El genes and packaged using a cell that expresses the El proteins (e.g., 293 cells) .
- the E3 region is also frequently deleted as well, as there is no need for complementation of this deletion.
- deletions in the E4, E2a, protein IX, and fiber protein regions have been described, e.g., by Armentano, et al . (1997) J. Virology 71:2408; Gao, et al . (1996) J. Virology 70:8934; Dedieu, et al . (1997) J. Virology 71:4626; Wang, et al .
- deletions are selected to avoid toxicity to the packaging cell. Combinations of deletions that avoid toxicity or other deleterious effects on the host cell can be routinely selected by those skilled in the art .
- the present invention can also be practiced with gutted adenovirus vectors (as that term is understood in the art, see e.g., Lieber, et al . (1996) J " . Virol. 70:8944- 60) in which essentially all of the adenovirus genomic sequences are deleted.
- Adeno-associated viruses have also been employed as nucleic acid delivery vectors.
- AAV are among the few viruses that can integrate their DNA into non-dividing cells, and exhibit a high frequency of stable integration into human chromosome 19 (see, for example, Flotte, et al . (1992) Am. J. Respir. Cell. Mol. Biol. 7:349-356; Samulski, et al . , (1989) J " Virol. 63:3822-3828; McLaughlin, et al . (1989) J. Virol.
- a variety of nucleic acids have been introduced into different cell types using AAV vectors (see, for example, Hermonat, et al . (1984) Proc . Natl. Acad. Sci. USA 81:6466-6470; Tratschin, et al . (1985) Mol. Cell. Biol. 4:2072-2081; Wondisford, et al . (1988) Mol. Endocrinol. 2:32-39; Tratschin, et al . (1984) J " . Virol. 51:611-619; and Flotte, et al . (1993) J. Biol. Chem. 268 :3781-3790) .
- AAV stocks can be produced by co- transfection of a rep/cap vector encoding AAV packaging functions and the template encoding the AAV vDNA into human cells infected with the helper adenovirus (Samulski, et al . (1989) J " . Virology 63:3822) .
- the AAV rep and/or cap genes can alternatively be provided by a packaging cell that stably expresses the genes (see, e.g., Gao, et al . (1998) Human Gene Therapy 9:2353; Inoue, et al . (1998) J " . Virol. 72:7024; US 5,837,484; WO 98/27207; US 5,658,785; WO 96/17947) .
- HSV Herpes Simplex Virus
- HSV can be modified for the delivery of nucleic acids to cells by producing a vector that exhibits only the latent function for long-term gene maintenance.
- HSV vectors are useful for nucleic acid delivery because they allow for a large DNA insert of up to or greater than 20 kilobases; they can be produced with extremely high titers; and they have been shown to express nucleic acids for a long period of time in the central nervous system as long as the lytic cycle does not occur.
- the delivery vector of interest is a retrovirus.
- the development of specialized cell lines (termed packaging cells) which produce only replication-defective retroviruses has increased the utility of retroviruses for gene therapy, and defective retroviruses are characterized for use in gene transfer for gene therapy purposes (for a review, see Miller (1990) Blood 76:271) .
- a replication-defective retrovirus can be packaged into virions which can be used to infect a target cell through the use of a helper virus by standard techniques .
- non-viral methods can also be employed. Many non-viral methods of nucleic acid transfer rely on normal mechanisms used by mammalian cells for the uptake and intracellular transport of macromolecules . In particular embodiments, non-viral nucleic acid delivery systems rely on endocytic pathways for the uptake of the nucleic acid molecule by the targeted cell. Exemplary nucleic acid delivery systems of this type include liposomal -derived systems, poly- lysine conjugates, and artificial viral envelopes.
- plasmid vectors are used in the practice of this invention. Naked plasmids can be introduced into cells by injection into the tissue. Expression can extend over many months, although the number of positive cells is typically low (Wolff, et al . (1989) Science 247:247) . Cationic lipids have been demonstrated to aid in introduction of nucleic acids into some cells in culture (Feigner and Ringold (1989) Nature 337:387) . Injection of cationic lipid plasmid DNA complexes into the circulation of mice has been shown to result in expression of the DNA in lung (Brigham, et al . (1989) Am. J. Med. Sci. 298:278). One advantage of plasmid DNA is that it can be introduced into non-replicating cells.
- a nucleic acid molecule e.g., a plasmid
- a lipid particle bearing positive charges on its surface and, optionally, tagged with antibodies against cell-surface antigens of the target tissue (Mizuno, et al . (1992) No Shinkei Geka 20:547; WO 91/06309; JP 1047381) .
- Liposomes that are composed of amphiphilic cationic molecules are useful non-viral vectors for nucleic acid delivery in vitro and in vivo (reviewed in Crystal (1995) Science 270:404-410; Blaese, et al . (1995) Cancer Gene Ther. 2:291-297; Behr, et al . (1994) Bioconjugate Chew. 5:382-389; Remy, et al . (1994) Bioconjugate Chem. 5:647- 654; and Gao, et al . (1995) Gene Therapy 2:710-722) .
- the positively charged liposomes are believed to complex with negatively charged nucleic acids via electrostatic interactions to form lipid : nucleic acid complexes.
- the lipid : nucleic acid complexes have several advantages as nucleic acid transfer vectors. Unlike viral vectors, the lipid : nucleic acid complexes can be used to transfer expression cassettes of essentially unlimited size. Since the complexes lack proteins, they can evoke fewer immunogenic and inflammatory responses. Moreover, they cannot replicate or recombine to form an infectious agent and have low integration frequency.
- a number of publications have demonstrated that amphiphilic cationic lipids can mediate nucleic acid delivery in vivo and in vitro (Feigner, et al . (1987) Proc . Natl.
- an expression vector can be incorporated into an expression vector (viral or nonviral as described herein) .
- Expression vectors compatible with various host cells are well-known in the art and contain suitable elements for transcription and translation of nucleic acids.
- an expression vector contains an expression cassette, which includes, in the 5' to 3' direction, a promoter, a coding sequence encoding one or more guide RNA and/or one or more cas protein operatively associated with the promoter, and, optionally, a termination sequence including a stop signal for RNA polymerase and a polyadenylation signal for polyadenylase .
- Nucleic acids encoding one or more guide RNA and one or more cas protein can be transcribed as independent molecules (e.g., via independent promoters in independent vectors or the same vector) or on the same molecule, e.g., as bi- or pluri-cistronic mRNA separated by internal ribosomal entry sites (IRESs) .
- independent molecules e.g., via independent promoters in independent vectors or the same vector
- IVSs internal ribosomal entry sites
- Isolated cas proteins and/or guide RNA, or nucleic acids or vectors encoding said proteins and/or RNA of the invention can be conveniently used or administered in a composition containing the active agents in combination with a carrier.
- Such compositions can be prepared by methods and contain carriers which are well-known in the art. A generally recognized compendium of such methods and ingredients is Remington: The Science and Practice of Pharmacy, Alfonso R. Gennaro, editor, 20th ed. Lippincott Williams & Wilkins: Philadelphia, PA, 2000.
- a carrier, pharmaceutically acceptable carrier, or vehicle such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, is involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- the protein, RNA, nucleic acids or vectors of the invention can be administered via any route including, but not limited to, oral, rectal, topical, buccal (e.g., sublingual), vaginal, parenteral (e.g., subcutaneous, intramuscular including skeletal muscle, diaphragm muscle and smooth muscle, intradermal, intravenous, intraperitoneal), topical (i.e., both skin and mucosal surfaces, including airway surfaces), intranasal, transdermal, intraarticular, intrathecal and inhalation administration, administration to the liver by intraportal delivery, as well as direct organ injection.
- the most suitable route in any given case will depend on the subject being treated and on the nature of the particular molecule which is being used.
- Eukaryotic cells of interest in the methods of this invention are preferably mammalian cells, especially HIV-1- positive human immune cells such as helper T cells
- the one or more guide RNA and cas protein into the bloodstream of an HIV-1 infected subject will result in transfection of cells in the bloodstream. If a cell is not HIV-l-infected, there will be no damage to the cell as the guiding RNA will not bind. In contrast, if a cell is infected with HIV-1, the guide RNA will hybridize with the target HIV-1 DNA via the spacer sequence, and the cas protein will cleave the target HIV-1 DNA thereby inhibiting the function ⁇ e.g., production of new virions/infectious particles) the HIV-1 DNA. In this respect, inhibition of HIV-1 function, using the guide RNA molecules and cas proteins of this invention, is of use in treating or preventing the spread of an HIV-1 infection.
- this invention also provides a method for treating or preventing the spread of an HIV-1 infection by administering, to a subject infected by HIV-1, one or more guide RNA and cas protein, or nucleic acid sequences encoding said one or more guide RNA or cas protein, thereby inhibiting the function and/or presence of the HIV-1.
- the one or more guide RNA and cas protein, or nucleic acids encoding said one or more guide RNA or cas protein can be administered simultaneously or sequentially.
- the guide RNA or cas proteins (or nucleic acids encoding the same) can be administered in a single formulation or separate formulations. Further, it is contemplated that various combinations of guide RNA and cas proteins can be used.
- one or more isolated guide RNA molecules can be administered in combination with nucleic acids encoding a cas protein ⁇ e.g., in a vector) .
- one or more guide RNA molecules can be administered in a vector in combination with an isolated cas protein.
- isolated guide RNA molecules can be administered in combination with an isolated cas protein and/or one or more vectors harboring nucleic acids encoding guide RNA molecules can be administered in combination with a vector harboring nucleic acids encoding a cas protein.
- Subjects benefiting from such treatment include those identified as being HIV-l-positive as well as subjects at risk of being infected with HIV-1 (e.g., health care workers that may have been exposed to a HIV virus through a needle stick or other patient contact, or patients involved in high-risk activities such as intravenous drug use) .
- Use of the compositions and methods of this invention can decrease viral load and/or prevent the spread of HIV-1 within a subject or from subject to subj ect .
- this invention also provides a kit.
- the kit contains one or more guide RNA according to the invention, a cas protein as described herein, or nucleic acids encoding the guide RNA or cas protein, e.g., in one or more vectors.
- the guide RNA has the sequence as set forth in SEQ ID NO : 1.
- the spacer of the guide RNA targets HIV-1 DNA selected from the group of SEQ ID NO: 2 -10.
- the cas protein is a cas9 protein, in particular a human codon-optimized cas9 protein, e.g., as set forth in SEQ ID NO: 11.
- the kit can also include a pharmaceutically acceptable carrier as well as, optionally, technical instructions with information on the administration and dosage of the guide RNA and cas protein invention can be used alone or in combination or concurrently with other conventional HIV treatments including, but not limited to highly active ant i -retroviral treatments (HAART) , e.g., non-nucleoside reverse transcriptase inhibitors (NNRTIs) such as efavirenz, etravirine and nevirapine; nucleoside reverse transcriptase inhibitors (NRTIs) such as Abacavir, and the combination drugs emtricitabine and tenofovir, and lamivudine and zidovudine; protease inhibitors (Pis) such as atazanavir, darunavir, fosamprenavir and ritonavir; entry or fusion inhibitors such as enfuvirtide and maraviroc; and integrase inhibitors such as raltegravir.
- Plasmid DNA encoding the guiding RNA molecule that uniquely binds to one of five specific regions located within the HIV-1 long terminal repeat region of the HIV-1 proviral DNA is generated ( Figure 1) .
- a plasmid encoding a cas9 nuclease is generated. Both plasmids are delivered to human cells, where the cas9 and guiding RNA loci are transcribed and the cas9 transcript is translated.
- the guiding RNA segment binds the cas9 nuclease to form a hybrid complex. Because of the addition of a nuclear localization sequence, this hybrid complex enters the nucleus where the guiding RNA segment binds to its complementary sequence in the HIV-1 proviral DNA.
- the nuclease cuts the proviral DNA, effecting a double -stranded DNA cut that is generally not repairable. See Figure 2.
- HIV-1 proviral DNA can be excised from the genome of an infected cell.
- J-Lat cell line a human T cell cancer line
- Flow cytometry was used to quantify cells that produce green fluorescent protein (GFP) from the LTR promoter 22 hours after transfection .
- GFP green fluorescent protein
- Flow cytometry analysis provides both a percentage of cells that express GFP and allows the quantification of the intensity of expression within the cell population by quantifying the mean fluorescence intensity (MFI) of the GFP+ cells.
- MFI mean fluorescence intensity
- Jurkat cells were transfected with three different plasmids. These plasmids included various guide RNAs, the humanized Cas9 plasmid, and a third (reporter) plasmid in which an intact HIV-1 LTR and 5' sequences promote the expression of GFP .
- the cells were subsequently lysed to recover the DNA and polymerase chain reaction was performed using primers to the reporter plasmid that would amplify a region from U3B through GAG (and hence not amplify the U3A region) .
- the preliminary data indicated that the integrity of the reporter plasmid was compromised (cleaved) in transfections that included guide RNAs to U3B, U3C, GAG, and likely also to the U5 and 5 'UT region, but not to TAR (a regulatory region in the HIV-1 provirus) .
- this reporter plasmid is also of use in quickly screening guide RNAs .
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- AIDS & HIV (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Marine Sciences & Fisheries (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/782,297 US11274305B2 (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of HIV-1 proviral DNA |
| CA2908253A CA2908253C (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| EP14779556.1A EP2981612B1 (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| JP2016506325A JP6576904B2 (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of HIV-1 proviral DNA |
| ES14779556T ES2747833T3 (en) | 2013-04-04 | 2014-03-25 | Compositions and procedures for in vivo cleavage of HIV-1 proviral DNA |
| US17/590,560 US20220154188A1 (en) | 2013-04-04 | 2022-02-01 | Compositions and methods for in vivo excision of hiv-1 proviral dna |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361808437P | 2013-04-04 | 2013-04-04 | |
| US61/808,437 | 2013-04-04 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/782,297 A-371-Of-International US11274305B2 (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of HIV-1 proviral DNA |
| US17/590,560 Continuation US20220154188A1 (en) | 2013-04-04 | 2022-02-01 | Compositions and methods for in vivo excision of hiv-1 proviral dna |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014165349A1 true WO2014165349A1 (en) | 2014-10-09 |
Family
ID=51659135
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/031674 Ceased WO2014165349A1 (en) | 2013-04-04 | 2014-03-25 | Compositions and methods for in vivo excision of hiv-1 proviral dna |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US11274305B2 (en) |
| EP (1) | EP2981612B1 (en) |
| JP (3) | JP6576904B2 (en) |
| CA (1) | CA2908253C (en) |
| ES (1) | ES2747833T3 (en) |
| WO (1) | WO2014165349A1 (en) |
Cited By (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9068179B1 (en) | 2013-12-12 | 2015-06-30 | President And Fellows Of Harvard College | Methods for correcting presenilin point mutations |
| US9163284B2 (en) | 2013-08-09 | 2015-10-20 | President And Fellows Of Harvard College | Methods for identifying a target site of a Cas9 nuclease |
| US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
| US9322006B2 (en) | 2011-07-22 | 2016-04-26 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
| US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| WO2016057061A3 (en) * | 2014-10-10 | 2016-07-28 | Massachusetts Eye And Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| WO2016086177A3 (en) * | 2014-11-25 | 2016-10-20 | Drexel University | Compositions and methods for hiv quasi-species excision from hiv-1-infected patients |
| US9487802B2 (en) | 2014-05-30 | 2016-11-08 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods to treat latent viral infections |
| WO2016183345A1 (en) | 2015-05-13 | 2016-11-17 | Seattle Children' S Hospital (Dba Seattle Children 's Research Institute) | Enhancing endonuclease based gene editing in primary cells |
| WO2016196282A1 (en) * | 2015-05-29 | 2016-12-08 | Agenovir Corporation | Compositions and methods for cell targeted hpv treatment |
| WO2016196308A1 (en) * | 2015-05-29 | 2016-12-08 | Agenovir Corporation | Methods and compositions for treating cells for transplant |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| EP3038661A4 (en) * | 2013-08-29 | 2017-04-05 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| WO2017058658A3 (en) * | 2015-09-28 | 2017-05-26 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| WO2017066588A3 (en) * | 2015-10-16 | 2017-06-08 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions utilizing cpf1 for rna-guided gene editing |
| WO2017132112A1 (en) * | 2016-01-25 | 2017-08-03 | Excision Biotherapeutics | Methods and compositions for rna-guided treatment of hiv infection |
| EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
| JP2017527256A (en) * | 2013-12-12 | 2017-09-21 | ザ・ブロード・インスティテュート・インコーポレイテッド | Delivery, use and therapeutic applications of CRISPR-Cas systems and compositions for HBV and viral diseases and disorders |
| WO2017197038A1 (en) * | 2016-05-10 | 2017-11-16 | United States Government As Represented By The Department Of Veterans Affairs | Lentiviral delivery of crispr/cas constructs that cleave genes essential for hiv-1 infection and replication |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| CN107949424A (en) * | 2015-03-20 | 2018-04-20 | 天普大学-联邦高等教育系统 | The gene editing based on CRISPR/ endonucleases of TAT inductions |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US10337001B2 (en) | 2014-12-03 | 2019-07-02 | Agilent Technologies, Inc. | Guide RNA with chemical modifications |
| US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US20200002776A1 (en) * | 2016-09-07 | 2020-01-02 | St. Vincent's Hospital Sydney Limited | Methods of Detecting Lentivirus |
| US10544405B2 (en) | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
| US10696986B2 (en) | 2014-12-12 | 2020-06-30 | The Board Institute, Inc. | Protected guide RNAS (PGRNAS) |
| US10711285B2 (en) | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
| US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
| US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
| US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
| AU2016270702B2 (en) * | 2015-06-01 | 2022-01-20 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| WO2022015702A3 (en) * | 2020-07-13 | 2022-02-17 | Howell Alexandra L | Methods and compositions for crispr/cas9 guide rna efficiency and specificity against genetically diverse hiv-1 isolates |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11306309B2 (en) | 2015-04-06 | 2022-04-19 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11407985B2 (en) | 2013-12-12 | 2022-08-09 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11884915B2 (en) | 2021-09-10 | 2024-01-30 | Agilent Technologies, Inc. | Guide RNAs with chemical modification for prime editing |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12421506B2 (en) | 2013-12-12 | 2025-09-23 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| US12435320B2 (en) | 2014-12-24 | 2025-10-07 | The Broad Institute, Inc. | CRISPR having or associated with destabilization domains |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12454687B2 (en) | 2012-12-12 | 2025-10-28 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2908253C (en) * | 2013-04-04 | 2024-01-09 | Trustees Of Dartmouth College | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| US20250360083A1 (en) * | 2022-09-21 | 2025-11-27 | Board Of Regents Of The University Of Nebraska | Lipid nanoparticle formulations and methods of use thereof |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1991006309A1 (en) | 1989-11-03 | 1991-05-16 | Vanderbilt University | Method of in vivo delivery of functioning foreign genes |
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| WO1996017947A1 (en) | 1994-12-06 | 1996-06-13 | Targeted Genetics Corporation | Packaging cell lines for generation of high titers of recombinant aav vectors |
| US5658785A (en) | 1994-06-06 | 1997-08-19 | Children's Hospital, Inc. | Adeno-associated virus materials and methods |
| US5712136A (en) | 1994-09-08 | 1998-01-27 | Genvec, Inc. | Adenoviral-mediated cell targeting commanded by the adenovirus penton base protein |
| JPH1047381A (en) | 1996-06-12 | 1998-02-17 | Mannesmann Sachs Ag | Operating mechanism for operating the friction clutch, especially pneumatic operation |
| US5770442A (en) | 1995-02-21 | 1998-06-23 | Cornell Research Foundation, Inc. | Chimeric adenoviral fiber protein and methods of using same |
| WO1998027207A1 (en) | 1996-12-18 | 1998-06-25 | Targeted Genetics Corporation | Recombinase-activatable aav packaging cassettes for use in the production of aav vectors |
| US5837484A (en) | 1993-11-09 | 1998-11-17 | Medical College Of Ohio | Stable cell lines capable of expressing the adeno-associated virus replication gene |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| US5922315A (en) | 1997-01-24 | 1999-07-13 | Genetic Therapy, Inc. | Adenoviruses having altered hexon proteins |
| US6146874A (en) | 1998-05-27 | 2000-11-14 | University Of Florida | Method of preparing recombinant adeno-associated virus compositions |
| US20050042620A1 (en) | 1988-09-20 | 2005-02-24 | The Board Of Regents For Northern Illinois University Of Dekalb | RNA catalyst for cleaving specific RNA sequences |
| US20100076057A1 (en) * | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
| US20120052483A1 (en) | 2010-08-27 | 2012-03-01 | Samsung Techwin Co., Ltd. | Kit for detecting hiv-1 and method for detecting hiv-1 using the same |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1942192A1 (en) * | 2007-01-08 | 2008-07-09 | Heinrich-Pette-Institut für experimentelle Virologie und Immunologie | Use of a tailored recombinase for the treatment of retroviral infections |
| EP3031921B1 (en) | 2012-12-12 | 2025-03-12 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| CA2908253C (en) * | 2013-04-04 | 2024-01-09 | Trustees Of Dartmouth College | Compositions and methods for in vivo excision of hiv-1 proviral dna |
-
2014
- 2014-03-25 CA CA2908253A patent/CA2908253C/en active Active
- 2014-03-25 EP EP14779556.1A patent/EP2981612B1/en active Active
- 2014-03-25 ES ES14779556T patent/ES2747833T3/en active Active
- 2014-03-25 JP JP2016506325A patent/JP6576904B2/en active Active
- 2014-03-25 US US14/782,297 patent/US11274305B2/en active Active
- 2014-03-25 WO PCT/US2014/031674 patent/WO2014165349A1/en not_active Ceased
-
2019
- 2019-08-21 JP JP2019151297A patent/JP6937802B2/en active Active
-
2021
- 2021-08-27 JP JP2021139036A patent/JP7206338B2/en active Active
-
2022
- 2022-02-01 US US17/590,560 patent/US20220154188A1/en not_active Abandoned
Patent Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| US20050042620A1 (en) | 1988-09-20 | 2005-02-24 | The Board Of Regents For Northern Illinois University Of Dekalb | RNA catalyst for cleaving specific RNA sequences |
| WO1991006309A1 (en) | 1989-11-03 | 1991-05-16 | Vanderbilt University | Method of in vivo delivery of functioning foreign genes |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| US5837484A (en) | 1993-11-09 | 1998-11-17 | Medical College Of Ohio | Stable cell lines capable of expressing the adeno-associated virus replication gene |
| US5658785A (en) | 1994-06-06 | 1997-08-19 | Children's Hospital, Inc. | Adeno-associated virus materials and methods |
| US5858775A (en) | 1994-06-06 | 1999-01-12 | Children's Hospital, Inc. | Adeno-associated virus materials and methods |
| US5712136A (en) | 1994-09-08 | 1998-01-27 | Genvec, Inc. | Adenoviral-mediated cell targeting commanded by the adenovirus penton base protein |
| WO1996017947A1 (en) | 1994-12-06 | 1996-06-13 | Targeted Genetics Corporation | Packaging cell lines for generation of high titers of recombinant aav vectors |
| US5770442A (en) | 1995-02-21 | 1998-06-23 | Cornell Research Foundation, Inc. | Chimeric adenoviral fiber protein and methods of using same |
| JPH1047381A (en) | 1996-06-12 | 1998-02-17 | Mannesmann Sachs Ag | Operating mechanism for operating the friction clutch, especially pneumatic operation |
| WO1998027207A1 (en) | 1996-12-18 | 1998-06-25 | Targeted Genetics Corporation | Recombinase-activatable aav packaging cassettes for use in the production of aav vectors |
| US5922315A (en) | 1997-01-24 | 1999-07-13 | Genetic Therapy, Inc. | Adenoviruses having altered hexon proteins |
| US6146874A (en) | 1998-05-27 | 2000-11-14 | University Of Florida | Method of preparing recombinant adeno-associated virus compositions |
| US20100076057A1 (en) * | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
| US20120052483A1 (en) | 2010-08-27 | 2012-03-01 | Samsung Techwin Co., Ltd. | Kit for detecting hiv-1 and method for detecting hiv-1 using the same |
Non-Patent Citations (80)
| Title |
|---|
| "Current Protocols in Human Genetics", 1997, JOHN WILEY AND SONS, INC, article "Vectors for Gene Therapy" |
| "Current Protocols in Molecular Biology", 1989, GREENE PUBLISHING ASSOCIATES |
| "GENBANK", Database accession no. AAK33936 |
| "GENBANK", Database accession no. NP 269215 |
| "GENBANK", Database accession no. NP_472073 |
| "GENBANK", Database accession no. YP_002342100 |
| "GENBANK", Database accession no. YP_820832 |
| "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS & WILKINS |
| ARMENTANO ET AL., J. VIROLOGY, vol. 71, 1997, pages 2408 |
| BARRANGOU ET AL., SCIENCE, vol. 315, 2007, pages 1709 - 12 |
| BEHR ET AL., BIOCONJUGATE CHEM, vol. 5, 1994, pages 382 - 389 |
| BERKNER ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 616 |
| BLAESE ET AL., CANCER GENE THER, vol. 2, 1995, pages 291 - 297 |
| BRIGHAM ET AL., AM. J. MED. SCI., vol. 298, 1989, pages 278 |
| BROUNS ET AL., SCIENCE, vol. 321, 2008, pages 960 - 964 |
| CADEPOND ET AL., EXP. CELL RES., vol. 201, 1992, pages 99 - 108 |
| CHANG ET AL., J. VIROL., vol. 66, 1992, pages 6019 - 6027 |
| CHESKY ET AL., MOL. CELL BIOL., vol. 9, 1989, pages 2487 - 2492 |
| CRYSTAL, SCIENCE, vol. 270, 1995, pages 404 - 410 |
| DEDIEU ET AL., J. VIROLOGY, vol. 71, 1997, pages 4626 |
| DEVEAU ET AL., J. BACTERIOL., vol. 190, 2008, pages 1390 |
| DOUGLAS ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 1574 |
| FELGNER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 2550 - 2561 |
| FELGNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 7413 - 17 |
| FELGNER; RINGOLD, NATURE, vol. 337, 1989, pages 387 |
| FIELDS ET AL.: "Virology", vol. 2, LIPPINCOTT-RAVEN PUBLISHERS |
| FLOTTE ET AL., AM. J. RESPIR. CELL. MOL. BIOL., vol. 7, 1992, pages 349 - 356 |
| FLOTTE ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 3781 - 3790 |
| GAO ET AL., GENE THERAPY, vol. 2, 1995, pages 710 - 722 |
| GAO ET AL., HUMAN GENE THERAPY, vol. 9, 1998, pages 2353 |
| GAO ET AL., J. VIROLOGY, vol. 70, 1996, pages 8934 |
| GARNEAU ET AL., NATURE, vol. 468, 2010, pages 67 - 71 |
| GORLICH ET AL., NATURE, vol. 377, 1995, pages 246 - 248 |
| GREENSPAN ET AL., J. VIROL., vol. 62, 1988, pages 3020 - 3026 |
| HABU Y. ET AL.: "Inhibition of HIV-1 gene expression by retroviral vector-mediated small-guide RNAs that direct specific RNA cleavage by tRNase ZL", NUCLEIC ACIDS RESEARCH, vol. 33, no. 1, 1 January 2005 (2005-01-01), XP003002181, DOI: doi:10.1093/nar/gki164 |
| HAJ-AHMAND; GRAHAM, J. VIROL., vol. 57, 1986, pages 267 |
| HALE ET AL., RNA, vol. 14, 2008, pages 2572 - 2579 |
| HERMONAT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6466 - 6470 |
| INOUE ET AL., J. VIROL., vol. 72, 1998, pages 7024 |
| JAKUBAUSKAS ET AL., J. MOL. BIOL., vol. 370, 2007, pages 157 - 169 |
| JANSEN ET AL., OMICS J. INTEGR. BIOL., vol. 6, 2002, pages 23 - 33 |
| JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816 |
| JINEK ET AL.: "A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity", SCIENCE, vol. 337, 28 June 2012 (2012-06-28), pages 816 - 821, XP055229606 * |
| KLEANTHOUS ET AL., NAT. STRUCT. BIOL., vol. 6, 1999, pages 243 - 52 |
| LIEBER ET AL., J. VIROL., vol. 70, 1996, pages 8944 - 60 |
| LILLESTOL ET AL., ARCHAEA, vol. 2, 2006, pages 59 - 72 |
| LOEFFLER ET AL., METHODS IN ENZYMOLOGY, vol. 217, 1993, pages 599 - 618 |
| MAKAROVA ET AL., BIOL. DIRECT, vol. 1, 2006, pages 7 |
| MAKAROVA ET AL., BIOL. DIRECT., vol. 1, 2006, pages 7 |
| MAKAROVA ET AL., NAT. REV. MICROBIOL., vol. 9, 2011, pages 467 |
| MALI ET AL., SCIENCE, vol. 339, 2013, pages 823 - 6 |
| MALI ET AL.: "RNA-guided human genome engineering via Cas9", SCIENCE, vol. 339, 3 January 2013 (2013-01-03), pages 823 - 826, XP055232938 * |
| MCLAUGHLIN ET AL., J. VIROL., vol. 62, 1989, pages 1963 - 1973 |
| MICHAUD; GOLDFARB, J. CELL BIOL., vol. 112, 1991, pages 215 - 223 |
| MILLER, BLOOD, vol. 76, 1990, pages 271 |
| MIZUNO ET AL., NO SHINKEI GEKA, vol. 20, 1992, pages 547 |
| MUZYCZKA ET AL., CURR. TOPICS MICRO. IMMUNOL., vol. 158, 1992, pages 97 - 129 |
| OLIVER, METHODS MOL. BIOL., vol. 115, 1999, pages 341 - 345 |
| PRIDE ET AL., GENOME RES, vol. 21, 2011, pages 126 |
| REMY ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 647 - 654 |
| RHO ET AL., PLOS GENET., vol. 8, 2012, pages e1002441 |
| ROSENFELD ET AL., CELL, vol. 68, 1992, pages 143 - 155 |
| ROSENFELD ET AL., SCIENCE, vol. 252, 1991, pages 431 - 434 |
| SAMULSKI ET AL., J VIROL., vol. 63, 1989, pages 3822 - 3828 |
| SAMULSKI ET AL., J. VIROLOGY, vol. 63, 1989, pages 3822 |
| SCHREIBER ET AL., EMBO J., vol. 11, 1992, pages 3263 - 3269 |
| See also references of EP2981612A4 |
| SIOMI; DREYFUSS, J. CELL BIOL., vol. 129, 1995, pages 551 - 560 |
| TANG ET AL., MOL. MICROBIOL., vol. 55, 2005, pages 469 - 481 |
| TANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 7536 - 7541 |
| TRATSCHIN ET AL., J. VIROL., vol. 51, 1984, pages 611 - 619 |
| TRATSCHIN ET AL., MOL. CELL. BIOL., vol. 4, 1985, pages 2072 - 2081 |
| VAN DER PLOEG ET AL., MICROBIOLOGY, vol. 155, 2009, pages 1966 |
| VAN ETTEN ET AL., CELL, vol. 58, 1989, pages 669 - 678 |
| WANG BRIAN.: "RNA Guided Human Gene and Genome Engineering and Radical life extension, disease prevention and cures", 12 January 2013 (2013-01-12), XP055304891, Retrieved from the Internet <URL:http://nextbigfuture.com/2013/01/ma-guided-human-gene-and-genome.html> * |
| WANG ET AL., GENE THERAPY, vol. 4, 1997, pages 393 |
| WOLFF ET AL., SCIENCE, vol. 247, 1989, pages 247 |
| WONDISFORD ET AL., MOL. ENDOCRINOL., vol. 2, 1988, pages 32 - 39 |
| WOO CHO ET AL.: "Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease", NATURE BIOTECHNOLOGY, vol. 31, no. 3, 29 January 2013 (2013-01-29), pages 230 - 232 |
| ZURCHER ET AL., J. VIROL., vol. 66, 1992, pages 5059 - 5066 |
Cited By (163)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US9322006B2 (en) | 2011-07-22 | 2016-04-26 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US12454687B2 (en) | 2012-12-12 | 2025-10-28 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof |
| US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
| US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US12252707B2 (en) | 2012-12-12 | 2025-03-18 | The Broad Institute, Inc. | Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US10544405B2 (en) | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| US11312945B2 (en) | 2013-01-16 | 2022-04-26 | Emory University | CAS9-nucleic acid complexes and uses related thereto |
| US12441995B2 (en) | 2013-06-17 | 2025-10-14 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US11597949B2 (en) | 2013-06-17 | 2023-03-07 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US12018275B2 (en) | 2013-06-17 | 2024-06-25 | The Broad Institute, Inc. | Delivery and use of the CRISPR-CAS systems, vectors and compositions for hepatic targeting and therapy |
| US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
| US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
| US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| US10711285B2 (en) | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
| US12553065B2 (en) | 2013-06-17 | 2026-02-17 | The Broad Institute, Inc. | Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US9163284B2 (en) | 2013-08-09 | 2015-10-20 | President And Fellows Of Harvard College | Methods for identifying a target site of a Cas9 nuclease |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US10227581B2 (en) | 2013-08-22 | 2019-03-12 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| EP3038661A4 (en) * | 2013-08-29 | 2017-04-05 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| EP4385567A3 (en) * | 2013-08-29 | 2024-08-14 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| US11298411B2 (en) | 2013-08-29 | 2022-04-12 | Temple University—Of the Commonwealth System of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US9925248B2 (en) | 2013-08-29 | 2018-03-27 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US11285193B2 (en) | 2013-08-29 | 2022-03-29 | Temple University—Of the Commonwealth System of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US9981020B2 (en) | 2013-08-29 | 2018-05-29 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US11291710B2 (en) | 2013-08-29 | 2022-04-05 | Temple University—Of the Commonwealth System of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US9340799B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | MRNA-sensing switchable gRNAs |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
| US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US9737604B2 (en) | 2013-09-06 | 2017-08-22 | President And Fellows Of Harvard College | Use of cationic lipids to deliver CAS9 |
| US9340800B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | Extended DNA-sensing GRNAS |
| US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
| US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US9068179B1 (en) | 2013-12-12 | 2015-06-30 | President And Fellows Of Harvard College | Methods for correcting presenilin point mutations |
| US11597919B2 (en) | 2013-12-12 | 2023-03-07 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US12421506B2 (en) | 2013-12-12 | 2025-09-23 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| JP2017527256A (en) * | 2013-12-12 | 2017-09-21 | ザ・ブロード・インスティテュート・インコーポレイテッド | Delivery, use and therapeutic applications of CRISPR-Cas systems and compositions for HBV and viral diseases and disorders |
| US11591581B2 (en) | 2013-12-12 | 2023-02-28 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US12251450B2 (en) | 2013-12-12 | 2025-03-18 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders |
| US9840699B2 (en) | 2013-12-12 | 2017-12-12 | President And Fellows Of Harvard College | Methods for nucleic acid editing |
| US12258595B2 (en) | 2013-12-12 | 2025-03-25 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
| US12410435B2 (en) | 2013-12-12 | 2025-09-09 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11407985B2 (en) | 2013-12-12 | 2022-08-09 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing |
| US10066241B2 (en) | 2014-05-30 | 2018-09-04 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods of delivering treatments for latent viral infections |
| US9487802B2 (en) | 2014-05-30 | 2016-11-08 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods to treat latent viral infections |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| WO2016057061A3 (en) * | 2014-10-10 | 2016-07-28 | Massachusetts Eye And Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| WO2016086177A3 (en) * | 2014-11-25 | 2016-10-20 | Drexel University | Compositions and methods for hiv quasi-species excision from hiv-1-infected patients |
| US10900034B2 (en) | 2014-12-03 | 2021-01-26 | Agilent Technologies, Inc. | Guide RNA with chemical modifications |
| US10337001B2 (en) | 2014-12-03 | 2019-07-02 | Agilent Technologies, Inc. | Guide RNA with chemical modifications |
| US12571005B2 (en) | 2014-12-12 | 2026-03-10 | The Broad Institute, Inc. | Protected guide RNAs (pgRNAs) |
| US11624078B2 (en) | 2014-12-12 | 2023-04-11 | The Broad Institute, Inc. | Protected guide RNAS (pgRNAS) |
| US10696986B2 (en) | 2014-12-12 | 2020-06-30 | The Board Institute, Inc. | Protected guide RNAS (PGRNAS) |
| US12435320B2 (en) | 2014-12-24 | 2025-10-07 | The Broad Institute, Inc. | CRISPR having or associated with destabilization domains |
| EP3271021A4 (en) * | 2015-03-20 | 2019-02-13 | Temple University Of The Commonwealth System Of Higher Education | GENE EDITION BASED ON TAT INDUCTION CRISPR / ENDONUCLEASE SYSTEM |
| CN107949424A (en) * | 2015-03-20 | 2018-04-20 | 天普大学-联邦高等教育系统 | The gene editing based on CRISPR/ endonucleases of TAT inductions |
| CN107949424B (en) * | 2015-03-20 | 2022-03-01 | 天普大学-联邦高等教育系统 | TAT-induced CRISPR/endonuclease-based gene editing |
| US11306309B2 (en) | 2015-04-06 | 2022-04-19 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation |
| US11851652B2 (en) | 2015-04-06 | 2023-12-26 | The Board Of Trustees Of The Leland Stanford Junior | Compositions comprising chemically modified guide RNAs for CRISPR/Cas-mediated editing of HBB |
| US11535846B2 (en) | 2015-04-06 | 2022-12-27 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide RNAS for CRISPR/Cas-mediated gene regulation |
| JP2018520648A (en) * | 2015-05-13 | 2018-08-02 | シアトル チルドレンズ ホスピタル, ディービーエー シアトル チルドレンズ リサーチ インスティテュート | Improved gene editing based on endonuclease in primary cells |
| WO2016183345A1 (en) | 2015-05-13 | 2016-11-17 | Seattle Children' S Hospital (Dba Seattle Children 's Research Institute) | Enhancing endonuclease based gene editing in primary cells |
| US10563226B2 (en) | 2015-05-13 | 2020-02-18 | Seattle Children's Hospital | Enhancing endonuclease based gene editing in primary cells |
| EP3294343A4 (en) * | 2015-05-13 | 2018-09-26 | Seattle Children's Hospital, dba Seattle Children's Research Institute | Enhancing endonuclease based gene editing in primary cells |
| WO2016196308A1 (en) * | 2015-05-29 | 2016-12-08 | Agenovir Corporation | Methods and compositions for treating cells for transplant |
| GB2542653A (en) * | 2015-05-29 | 2017-03-29 | Agenovir Corp | Methods and compositions for treating cells for transplant |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| JP2018516984A (en) * | 2015-05-29 | 2018-06-28 | アジェノビア コーポレーション | Compositions and methods for cell targeted HPV treatment |
| WO2016196282A1 (en) * | 2015-05-29 | 2016-12-08 | Agenovir Corporation | Compositions and methods for cell targeted hpv treatment |
| AU2016270702B2 (en) * | 2015-06-01 | 2022-01-20 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US12251429B2 (en) | 2015-06-01 | 2025-03-18 | Temple University—Of the Commonwealth System of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US12168789B2 (en) | 2015-06-18 | 2024-12-17 | The Broad Institute, Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US12123032B2 (en) | 2015-06-18 | 2024-10-22 | The Broad Institute, Inc. | CRISPR enzyme mutations reducing off-target effects |
| US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US10876100B2 (en) | 2015-06-18 | 2020-12-29 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US20190367910A1 (en) * | 2015-09-28 | 2019-12-05 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| WO2017058658A3 (en) * | 2015-09-28 | 2017-05-26 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| WO2017066588A3 (en) * | 2015-10-16 | 2017-06-08 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions utilizing cpf1 for rna-guided gene editing |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| WO2017132112A1 (en) * | 2016-01-25 | 2017-08-03 | Excision Biotherapeutics | Methods and compositions for rna-guided treatment of hiv infection |
| CN108883201A (en) * | 2016-01-25 | 2018-11-23 | 切除生物治疗公司 | Methods and compositions for RNA-guided treatment of HIV infection |
| WO2017158153A1 (en) | 2016-03-17 | 2017-09-21 | Imba - Institut Für Molekulare Biotechnologie Gmbh | Conditional crispr sgrna expression |
| EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
| WO2017197038A1 (en) * | 2016-05-10 | 2017-11-16 | United States Government As Represented By The Department Of Veterans Affairs | Lentiviral delivery of crispr/cas constructs that cleave genes essential for hiv-1 infection and replication |
| JP2022001047A (en) * | 2016-05-10 | 2022-01-06 | ユナイテッド ステイツ ガバメント アズ リプレゼンテッド バイ ザ デパートメント オブ ベテランズ アフェアーズUnited States Government As Represented By The Department Of Veterans Affairs | Lentivirus delivery of CRISPR / CAS constructs that cleave genes essential for HIV-1 infection and replication |
| EP4036223A1 (en) | 2016-05-10 | 2022-08-03 | United States Government as Represented by The Department of Veterans Affairs | Lentiviral delivery of cas constructs for the treatment and prevention of hiv-1 infections |
| JP2019519250A (en) * | 2016-05-10 | 2019-07-11 | ユナイテッド ステイツ ガバメント アズ リプレゼンテッド バイ ザ デパートメント オブ ベテランズ アフェアーズUnited States Government As Represented By The Department Of Veterans Affairs | Lentiviral delivery of a CRISPR / CAS construct that cleaves genes essential for HIV-1 infection and replication |
| US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US20200002776A1 (en) * | 2016-09-07 | 2020-01-02 | St. Vincent's Hospital Sydney Limited | Methods of Detecting Lentivirus |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US12559748B2 (en) | 2017-02-06 | 2026-02-24 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| WO2022015702A3 (en) * | 2020-07-13 | 2022-02-17 | Howell Alexandra L | Methods and compositions for crispr/cas9 guide rna efficiency and specificity against genetically diverse hiv-1 isolates |
| US11884915B2 (en) | 2021-09-10 | 2024-01-30 | Agilent Technologies, Inc. | Guide RNAs with chemical modification for prime editing |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2908253A1 (en) | 2014-10-09 |
| CA2908253C (en) | 2024-01-09 |
| JP2019198329A (en) | 2019-11-21 |
| EP2981612B1 (en) | 2019-07-03 |
| US20160040165A1 (en) | 2016-02-11 |
| US11274305B2 (en) | 2022-03-15 |
| EP2981612A4 (en) | 2017-01-18 |
| EP2981612A1 (en) | 2016-02-10 |
| JP7206338B2 (en) | 2023-01-17 |
| JP6937802B2 (en) | 2021-09-22 |
| JP2022001051A (en) | 2022-01-06 |
| JP6576904B2 (en) | 2019-09-18 |
| ES2747833T3 (en) | 2020-03-11 |
| US20220154188A1 (en) | 2022-05-19 |
| JP2016514479A (en) | 2016-05-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220154188A1 (en) | Compositions and methods for in vivo excision of hiv-1 proviral dna | |
| JP7176737B2 (en) | Excision of retroviral nucleic acid sequences | |
| JP6968416B2 (en) | Methods and compositions for the treatment of RNA-induced, HIV infections | |
| US20230250407A1 (en) | Silencing of dux4 by recombinant gene editing complexes | |
| JP2023071897A (en) | Methods and compositions for RNA-guided treatment of HIV infection | |
| JP2025527567A (en) | Compositions, systems, and methods for modulation of hepatitis B virus by targeted gene silencing | |
| KR20170137114A (en) | Tat-induced CRISPR / endonuclease-based gene editing | |
| CN108779447A (en) | The method and composition of RNA guiding treatments for HIV infection | |
| JP2019517503A (en) | Negative feedback regulation of HIV-1 by gene editing strategies | |
| CN108778343A (en) | The method and composition of the gene editing of guide RNA is carried out using CPF1 | |
| EP4558629A2 (en) | Biallelic knockout of angptl3 | |
| HK40000290A (en) | Excision of retroviral nucleic acid sequences |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14779556 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2908253 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016506325 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014779556 Country of ref document: EP |
