WO2013192594A2 - Antigen binding proteins that bind c-met - Google Patents
Antigen binding proteins that bind c-met Download PDFInfo
- Publication number
- WO2013192594A2 WO2013192594A2 PCT/US2013/047190 US2013047190W WO2013192594A2 WO 2013192594 A2 WO2013192594 A2 WO 2013192594A2 US 2013047190 W US2013047190 W US 2013047190W WO 2013192594 A2 WO2013192594 A2 WO 2013192594A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- called
- variable domain
- met
- gce
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure provides compositions and methods relating to or derived from anti- c-Met antibodies. More specifically, the present disclosure provides human antibodies that bind c-Met, c-Met-binding fragments and derivatives of such antibodies, and C-Met- binding polypeptides comprising such fragments. Further still, the present disclosure provides nucleic acids encoding such antibodies, antibody fragments and derivatives and polypeptides, cells comprising such polynucleotides, methods of making such antibodies, antibody fragments and derivatives and polypeptides, and methods of using such antibodies, antibody fragments and derivatives and polypeptides, including methods of treating or diagnosing subjects having C-Met related disorders or conditions, including various inflammatory disorders and various cancers.
- HGF is a mesenchyme-derived pleiotrophic factor with mitogenic, motogenic and morphogenic activities on a number of different cell types. HGF effects are mediated through a specific tyrosine kinase, c-Met, and aberrant HGF and c-Met expression are frequently observed in a variety of tumors.
- c-Met tyrosine kinase
- HGF/c-Met signaling pathway is implicated in tumor progression and metastasis.
- HGF binds the extracellular domain of the Met receptor tyrosine kinase (RTK) and regulates diverse biological processes such as cell scattering, proliferation, and survival.
- RTK Met receptor tyrosine kinase
- HGF- Met signaling is essential for normal embryonic development especially in migration of muscle progenitor cells and development of the liver and nervous system (Bladt et al., Nature 376, 768-771. 1995; Hamanoue et al. /. Neurosci. Res. 43, 554-564. 1996; Schmidt et al., Proc. Natl. Acad. Sci. USA 94, 11445-11450, 1995; Uehara et al., Nature 373, 702-705, 1995).
- RTK Met receptor tyrosine kinase
- HGF-Met also plays a role in liver regeneration, angiogenesis, and wound healing (Bussolino et al., /. Cell Biol. 119, 629- 641 1992; Nusrat et al., /. Clin. Invest. 93, 2056-2065 1994).
- Met receptor undergoes proteolytic cleavage into an extracellular subunit and membrane spanning subunit linked by disulfide bonds (Tempest et al., Br. J. Cancer 58, 3-7 1988).
- the subunit contains the cytoplasmic kinase domain and harbors a multi-substrate docking site at the C-terminus where adapter proteins bind and initiate signaling.
- Met overexpression or gene- amplification has been observed in a variety of human cancers.
- Met protein is overexpressed at least 5-fold in colorectal cancers and reported to be gene-amplified in liver metastasis (Di Renzo et al., Clin. Cancer Res. 1, 147- 154, 1995; Liu et al., Oncogene 7, 181-185 1992).
- Met protein is also reported to be overexpressed in oral squamous cell carcinoma, hepatocellular carcinoma, renal cell carcinoma, breast carcinoma, and lung carcinoma (Jin et al., Cancer 79, 749-760 1997;
- HGF-dependent Met activation in transformed cells mediates increased motility, scattering, and migration which eventually leads to invasive tumor growth and metastasis (Jeffers et al., Mol. Cell Biol. 16, 1115-1125 1996; Meiners et al., Oncogene 16, 9-20 1998).
- Met is a member of the subfamily of RTKs which include Ron and Sea (Maulik et al., Cytokine Growth Factor Rev. 13, 41-59 2002). Prediction of the extracellular domain structure of Met suggests shared homology with the semaphorins and plexins.
- the N-terminus of Met contains a Sema domain of approximately 500 amino acids that is conserved in all
- semaphorins and plexins belong to a large family of secreted and membrane -bound proteins first described for their role in neural development (Van Vactor and Lorenz, Curr. Biol. 9, R201-204 1999). However, semaphorin overexpression has been correlated with tumor invasion and metastasis.
- a cysteine-rich PSI domain also referred to as a Met Related Sequence domain
- semaphorins, and integrins lies adjacent to the Sema domain followed by four IPT repeats that are immunoglobulin-like regions found in plexins and transcription factors.
- Met Sema domain is sufficient for HGF and heparin binding (Gherardi et al., (2003). Functional map and domain structure of Met, the product of the c-Met protooncogene and receptor for hepatocyte growth factor/scatter factor. Proc. Natl. Acad. Sci. USA 2003). Furthermore, Kong-Beltran et al.
- the present disclosure provides a fully human antibody of an IgG class that binds to a c-Met epitope with a binding affinity of at least 10 "6 M, which has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO.
- SEQ ID NO. 36 SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO.
- SEQ ID NO. 86 amino acid sequence
- SEQ ID NO. 88 amino acid sequence
- SEQ ID NO. 90 amino acid sequence
- SEQ ID NO. 92 amino acid sequence 92
- combinations thereof and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called AI herein), SEQ ID NO. 3/SEQ ID NO. 4 (called A2 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called A8 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called B 12 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called El herein), SEQ ID NO. 13/SEQ ID NO. 14 (called E6 herein), SEQ ID NO.
- H8-G7 SEQ ID NO. 24/SEQ ID NO. 35 (called H8-G9 herein), SEQ ID NO. 36/SEQ ID NO. 26 (called H8-H6 herein), SEQ ID NO. 29/SEQ ID NO. 22 (called H8-2A2 herein), SEQ ID NO. 37/SEQ ID NO. 38 (called H8-2B1 herein), SEQ ID NO. 34/SEQ ID NO. 23 (called H8-2B2 herein), SEQ ID NO. 37/SEQ ID NO. 23 (called H8-2B4 herein), SEQ ID NO. 32/SEQ ID NO. 39 (called H8-2B7 herein), SEQ ID NO. 32/SEQ ID NO.
- SEQ ID NO. 40/SEQ ID NO. 41 (called GCE-A10 herein), SEQ ID NO. 42/SEQ ID NO. 43 (called GCE-A11 herein), SEQ ID NO. 44/SEQ ID NO. 41 (called GCE- A13 herein), SEQ ID NO. 45/SEQ ID NO. 46 (called GCE-A14 herein), SEQ ID NO. 47/SEQ ID NO. 48 (called GCE-A16 herein), SEQ ID NO. 49/SEQ ID NO. 50 (called GCE-A18 herein), SEQ ID NO. 51/SEQ ID NO. 52 (called GCE-B2 herein), SEQ ID NO. 53/SEQ ID NO.
- GCE-B9 SEQ ID NO. 45/SEQ ID NO. 55
- GCE-B11 SEQ ID NO.
- SEQ ID NO. 56/SEQ ID NO. 57 SEQ ID NO. 56/SEQ ID NO. 57
- SEQ ID NO. 58/SEQ ID NO. 57 SEQ ID NO. 59/SEQ ID NO. 60
- GCE-BR1 SEQ ID NO. 61/SEQ ID NO. 62
- GCE-B20 SEQ ID NO. 63/SEQ ID NO. 64
- GCE-A19 SEQ ID NO. 65/SEQ ID NO. 66
- SEQ ID NO. 67 (called GCE-B5 herein), SEQ ID NO. 61/SEQ ID NO. 68 (called GCE-B4 herein), SEQ ID NO. 69/SEQ ID NO. 70 (called GCE-A26 herein), SEQ ID NO. 71/SEQ ID NO. 72 (called GCE-LlA-9 herein), SEQ ID NO. 49/SEQ ID NO. 73 (called GCE-H34-36 herein), SEQ ID NO. 74/SEQ ID NO. 73 (called GCE-H13-1 herein), SEQ ID NO. 61/SEQ ID NO. 73 (called GCE-H13-2 herein), SEQ ID NO. 44/SEQ ID NO.
- GCE-H13-3 herein
- SEQ ID NO. 40/SEQ ID NO. 73 (called GCE-H13-4 herein)
- SEQ ID NO. 75/SEQ ID NO. 73 (called GCE-H13-5 herein)
- SEQ ID NO. 69/SEQ ID NO. 73 (called GCE-H13-6 herein)
- SEQ ID NO. 76/SEQ ID NO. 73 (called GCE-H13-8 herein)
- SEQ ID NO. 21/SEQ ID NO. 77 called H8-9EH11L herein
- SEQ ID NO. 21/SEQ ID NO. 78 (called H8-9EG11L herein)
- SEQ ID NO. 80/SEQ ID NO. 81 (called Al-2 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called Al-4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called Al-6 herein), SEQ ID NO. 86/SEQ ID NO. 87 (called Al-8 herein), SEQ ID NO. 88/SEQ ID NO. 89 (called Al-9 herein), SEQ ID NO. 90/SEQ ID NO. 91 (called Al-24 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called Al-32 herein), and combinations thereof.
- the present disclosure provides a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO.
- SEQ ID NO. 37 SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO.
- SEQ ID NO. 86 SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 92, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO.
- SEQ ID NO. 48 SEQ ID NO. 50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO. 93, and combinations thereof.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO. 21/SEQ ID NO.
- SEQ ID NO. 21/SEQ ID NO. 23 SEQ ID NO. 24/SEQ ID NO. 22, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 23, SEQ ID NO. 33/SEQ ID NO. 22, SEQ ID NO. 34/SEQ ID NO. 22, SEQ ID NO. 24/SEQ ID NO. 35, SEQ ID NO. 36/SEQ ID NO. 26, SEQ ID NO. 29/SEQ ID NO. 22, SEQ ID NO.
- SEQ ID NO. 56/SEQ ID NO. 57 SEQ ID NO. 58/SEQ ID NO. 57, SEQ ID NO. 59/SEQ ID NO. 60, SEQ ID NO. 61/SEQ ID NO. 62, SEQ ID NO. 63/SEQ ID NO. 64, SEQ ID NO. 65/SEQ ID NO. 66, SEQ ID NO. 58/SEQ ID NO. 67, SEQ ID NO. 61/SEQ ID NO. 68, SEQ ID NO. 69/SEQ ID NO. 70, SEQ ID NO. 71/SEQ ID NO. 72, SEQ ID NO. 49/SEQ ID NO. 73, SEQ ID NO. 74/SEQ ID NO. 73, SEQ ID NO.
- the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO.
- SEQ ID NO. 34 SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO.
- SEQ ID NO. 86 amino acid sequence
- SEQ ID NO. 88 amino acid sequence
- SEQ ID NO. 90 amino acid sequence
- SEQ ID NO. 92 amino acid sequence 92
- combinations thereof and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO.
- the present disclosure further provides a method for treating a broad spectrum of mammalian cancers or a broad-spectrum of inflammatory diseases and autoimmune diseases, comprising administering an effective amount of an anti-c-Met polypeptide, wherein the anti-c- Met polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a c-Met epitope with a binding affinity of at least 10 "6 M, a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof; wherein the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO.
- SEQ ID NO. 3 SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO.
- SEQ ID NO. 58 SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 92, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO.
- SEQ ID NO. 6 SEQ ID NO. 8
- SEQ ID NO. 10 SEQ ID NO. 12
- SEQ ID NO. 14 SEQ ID NO. 16
- SEQ ID NO. 18 SEQ ID NO. 20
- the fully human antibody Fab fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO.
- SEQ ID NO. 45 SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 50, SEQ ID NO.
- SEQ ID NO. 54 SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO.
- the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO.
- SEQ ID NO. 45 SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 50, SEQ ID NO.
- SEQ ID NO. 54 SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO. 93, and combinations thereof.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called AI herein), SEQ ID NO. 3/SEQ ID NO. 4 (called A2 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called A8 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called B 12 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called El herein), SEQ ID NO. 13/SEQ ID NO. 14 (called E6 herein), SEQ ID NO. 15/SEQ ID NO.
- GCE-B19 SEQ ID NO. 59/SEQ ID NO. 60
- GCE-BR1 SEQ ID NO. 61/SEQ ID NO. 62
- GCE-B20 SEQ ID NO. 63/SEQ ID NO. 64
- GCE-A19 SEQ ID NO. 65/SEQ ID NO. 66
- GCE-B10 SEQ ID NO. 58/SEQ ID NO. 67
- GCE-B5 SEQ ID NO. 61/SEQ ID NO. 68
- GCE-B4 SEQ ID NO. 69/SEQ ID NO. 70
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called Al herein), SEQ ID NO. 3/SEQ ID NO. 4 (called A2 herein), SEQ ID NO. 5/SEQ ID NO.
- SEQ ID NO. 7/SEQ ID NO. 8 (called B12 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called El herein), SEQ ID NO. 13/SEQ ID NO. 14 (called E6 herein), SEQ ID NO. 15/SEQ ID NO. 16 (called F3 herein), SEQ ID NO. 17/SEQ ID NO. 18 (called H6 herein), SEQ ID NO. 19/SEQ ID NO. 20 (called H8 herein), SEQ ID NO. 21/SEQ ID NO. 22 (called H8-9 herein), SEQ ID NO. 21/SEQ ID NO.
- H8-9EE8L3 SEQ ID NO. 24/SEQ ID NO. 22 (called H8-G3S herein), SEQ ID NO. 25/SEQ ID NO. 26 (called H8-A2 herein), SEQ ID NO. 27/SEQ ID NO. 28 (called H8-B6 herein), SEQ ID NO. 29/SEQ ID NO. 23 (called H8-C1 herein), SEQ ID NO. 24/SEQ ID NO. 30 (called H8-D4 herein), SEQ ID NO. 31/SEQ ID NO. 23 (called H8-D5 herein), SEQ ID NO. 24/SEQ ID NO. 23 (called H8-D6 herein), SEQ ID NO. 32/SEQ ID NO.
- H8-D10 SEQ ID NO. 33/SEQ ID NO. 22 (called H8-E5 herein), SEQ ID NO. 34/SEQ ID NO. 22 (called H8-G7 herein), SEQ ID NO. 24/SEQ ID NO. 35 (called H8- G9 herein), SEQ ID NO. 36/SEQ ID NO. 26 (called H8-H6 herein), SEQ ID NO. 29/SEQ ID NO. 22 (called H8-2A2 herein), SEQ ID NO. 37/SEQ ID NO. 38 (called H8-2B 1 herein), SEQ ID NO. 34/SEQ ID NO. 23 (called H8-2B2 herein), SEQ ID NO. 37/SEQ ID NO. 23 (called H8-2B4 herein), SEQ ID NO. 32/SEQ ID NO. 39 (called H8-2B7 herein), SEQ ID NO.
- GCE-B9 SEQ ID NO. 45/SEQ ID NO. 55
- GCE-B11 SEQ ID NO.
- SEQ ID NO. 56/SEQ ID NO. 57 SEQ ID NO. 56/SEQ ID NO. 57
- SEQ ID NO. 58/SEQ ID NO. 57 SEQ ID NO. 59/SEQ ID NO. 60
- GCE- BR1 SEQ ID NO. 61/SEQ ID NO. 62
- GCE-B20 SEQ ID NO. 63/SEQ ID NO. 64
- GCE-A19 SEQ ID NO. 65/SEQ ID NO. 66
- SEQ ID NO. 67 (called GCE-B5 herein), SEQ ID NO. 61/SEQ ID NO. 68 (called GCE-B4 herein), SEQ ID NO. 69/SEQ ID NO. 70 (called GCE-A26 herein), SEQ ID NO. 71/SEQ ID NO. 72 (called GCE-LlA-9 herein), SEQ ID NO. 49/SEQ ID NO. 73 (called GCE-H34-36 herein), SEQ ID NO. 74/SEQ ID NO. 73 (called GCE-H13-1 herein), SEQ ID NO. 61/SEQ ID NO. 73 (called GCE-H13-2 herein), SEQ ID NO. 44/SEQ ID NO.
- GCE-H13-3 herein
- SEQ ID NO. 40/SEQ ID NO. 73 (called GCE-H13-4 herein)
- SEQ ID NO. 75/SEQ ID NO. 73 (called GCE-H13-5 herein)
- SEQ ID NO. 69/SEQ ID NO. 73 (called GCE-H13-6 herein)
- SEQ ID NO. 76/SEQ ID NO. 73 (called GCE-H13-8 herein)
- SEQ ID NO. 21/SEQ ID NO. 77 called H8-9EH11L herein
- SEQ ID NO. 21/SEQ ID NO. 78 (called H8-9EG11L herein)
- SEQ ID NO. 80/SEQ ID NO. 81 (called Al-2 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called Al-4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called Al-6 herein), SEQ ID NO. 86/SEQ ID NO. 87 (called Al-8 herein), SEQ ID NO. 88/SEQ ID NO. 89 (called Al-9 herein), SEQ ID NO. 90/SEQ ID NO. 91 (called Al-24 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called Al-32 herein), and combinations thereof.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO.
- SEQ ID NO. 37/SEQ ID NO. 38 SEQ ID NO. 34/SEQ ID NO. 23, SEQ ID NO. 37/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 39, SEQ ID NO. 32/SEQ ID NO. 22, SEQ ID NO. 40/SEQ ID NO. 41, SEQ ID NO. 42/SEQ ID NO. 43, SEQ ID NO. 44/SEQ ID NO. 41, SEQ ID NO. 45/SEQ ID NO. 46, SEQ ID NO. 47/SEQ ID NO. 48, SEQ ID NO. 49/SEQ ID NO. 50, SEQ ID NO. 51/SEQ ID NO. 52, SEQ ID NO. 53/SEQ ID NO. 54, SEQ ID NO. 45/SEQ ID NO.
- SEQ ID NO. 56/SEQ ID NO. 57 SEQ ID NO. 58/SEQ ID NO. 57, SEQ ID NO. 59/SEQ ID NO. 60, SEQ ID NO. 61/SEQ ID NO. 62, SEQ ID NO. 63/SEQ ID NO. 64, SEQ ID NO. 65/SEQ ID NO. 66, SEQ ID NO. 58/SEQ ID NO. 67, SEQ ID NO. 61/SEQ ID NO. 68, SEQ ID NO. 69/SEQ ID NO. 70, SEQ ID NO. 71/SEQ ID NO. 72, SEQ ID NO. 49/SEQ ID NO. 73, SEQ ID NO. 74/SEQ ID NO. 73, SEQ ID NO.
- the broad spectrum of mammalian cancers to be treated the cancer is a c- Met-activation-related cancer, chosen from c-Met-activation-related cancers that are HGF- dependent, HGF-independent, or both.
- the broad spectrum of mammalian cancers to be treated is selected from the group consisting of prostate cancer, osteosarcoma, lung cancer, breast cancer, endometrial cancer, glyoblastoma, and colon cancer.
- Figure la shows the affinity ranking of anti-c-Met antibodies in IgG format obtained by the Octet Red method (Forte Bio).
- Figure lb shows the affinity kinetics of two preferred anti-c-Met antibodies (Al and El) in IgG format compared to Genentech 5D5 IgG constructed and expressed in house.
- Figure 2 shows crude epitope mapping of c-Met antibodies in IgG format in relation to Genentech 5D5 IgG.
- Genetech 5D5 IgG was immobilized on a CM5 chip using standard NHS/EDC coupling methodology. Then recombinant human c-Met was loaded. The anti-c- Met antibodies were then added and any additional binding was detected. Additional binding registered by Biacore would indicate that this antibody binds to an epitope of c-Met that is not occupied by 5D5.
- Figure 3a shows the antagonistic effects of anti-c-Met antibodies in IgG format on the proliferation of U87 glioblastoma cells.
- Figure 3b shows the antagonistic effects of anti-c-Met antibodies in Fab format on the proliferation of U87 glioblastoma cells.
- Figure 4a shows the inhibition of HGF- stimulated c-Met auto-phosphorylation by antic-Met antibodies in IgG format.
- Figure 4b shows the inhibition of HGF-stimulated c-Met auto-phosphorylation by antic-Met antibodies in Fab format.
- Figure 5 shows the inhibition of HGF-stimulated, c-Met-mediated cell migration by anti-Met antibodies (IgG and Fab format) in a cellular wound healing assay.
- Figure 6 shows the results of an HGF/c-Met scatter assay indicating that anti-c-Met Antibodies in IgG (Al, El, and H8) and Fab (El and A8) format can inhibit HGF-stimulated, c-Met-mediated cell motility.
- Figure 7 shows that anti-c-Met antibodies El (0), Al ( ⁇ ), and H8 ( ⁇ ) reduce the growth of xenogeneic tumor cells implanted into nude mice compared to control.
- Figure 8 shows a graph comparing the blocking of the interaction between recombinant HGF and various anti-c-Met antibodies that are El and various optimized versions of El.
- the IC50 numbers show a comparison of inhibiting ligand binding to its receptor.
- Figure 9 shows the blocking of the interaction between recombinant HGF and recombinant c-Met by anti-c-Met antibody Al and its optimized versions. Inhibition of ligand binding to its receptor prevents activation.
- Figure 10 shows in vitro data of HGF-stimulated phosphorylation of c-Met in A549 NSCLC (Non-small Cell Lung Cancer) cells. These data demonstrates the ability of anti-c-Met Al optimized clones to block the activation of and therefore the function of c-Met in cancer cells.
- Figure 11 shows the potential of anti-c-Met antibodies to induce ADCC (Antibody Dependent Cell Cytotoxicity.
- ADCC is triggered when the Fc region of an antibody which is bound to a target cell, interacts with an Fc receptor on the surface of an effector immune cell leading to the killing of the target cell.
- Figure 11 shows ADCC induced by anti-c-Met antibodies using a cell based reporter assay (Promega).
- the EC50 value for El and El optimized clones for the induction of ADCC ranged from 23 OpM to 1.1 nM.
- Figure 12 shows the effects on cell migration of anti-c-Met mAbs, using a modified Boyden Chamber setup utilizing the xCelligence system (ACEA). As shown in Figure 12, 5 ng/ml HGF induced cell migration and the described anti-c-Met mAbs inhibited this migration to varying degrees. Data are shown as the cell index normalized to the untreated control (+/- SD) at 8 hrs after the beginning of the experiment.
- Figure 13 shows an expanded view of the in vivo data shown in Figure 7.
- the present disclosure provides a fully human antibody of an IgG class that binds to a c-Met epitope with a binding affinity of 10 "6 M or less, that has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO.
- SEQ ID NO. 36 SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO.
- SEQ ID NO. 86 amino acid sequence
- SEQ ID NO. 88 amino acid sequence
- SEQ ID NO. 90 amino acid sequence
- SEQ ID NO. 92 amino acid sequence 92
- combinations thereof and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called Al herein), SEQ ID NO. 3/SEQ ID NO. 4 (called A2 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called A8 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called B 12 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called El herein), SEQ ID NO. 13/SEQ ID NO. 14 (called E6 herein), SEQ ID NO.
- GCE-B2 SEQ ID NO. 53/SEQ ID NO. 54 (called GCE-B9 herein), SEQ ID NO. 45/SEQ ID NO. 55 (called GCE-B11 herein), SEQ ID NO. 56/SEQ ID NO. 57 (called GCE-B13 herein), SEQ ID NO. 58/SEQ ID NO. 57 (called GCE-B19 herein), SEQ ID NO. 59/SEQ ID NO. 60 (called GCE-BR1 herein), SEQ ID NO. 61/SEQ ID NO. 62 (called GCE-B20 herein), SEQ ID NO. 63/SEQ ID NO. 64 (called GCE-A19 herein), SEQ ID NO. 65/SEQ ID NO.
- GCE-B10 SEQ ID NO. 58/SEQ ID NO. 67
- GCE-B5 SEQ ID NO.
- SEQ ID NO. 61/SEQ ID NO. 68 SEQ ID NO. 69/SEQ ID NO. 70
- GCE-A26 SEQ ID NO.
- SEQ ID NO. 71/SEQ ID NO. 72 SEQ ID NO. LlA-9 herein
- SEQ ID NO. 49/SEQ ID NO. 73 called GCE-H34-36 herein
- SEQ ID NO. 74/SEQ ID NO. 73 SEQ ID NO. 61/SEQ ID NO.
- SEQ ID NO. 79/SEQ ID NO. 20 (called H8-6AG2H3 herein), SEQ ID NO. 80/SEQ ID NO. 81 (called Al-2 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called Al-4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called Al-6 herein), SEQ ID NO. 86/SEQ ID NO. 87 (called Al-8 herein), SEQ ID NO. 88/SEQ ID NO. 89 (called Al-9 herein), SEQ ID NO. 90/SEQ ID NO. 91 (called Al-24 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called Al-32 herein), and combinations thereof.
- the present disclosure provides a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO.
- SEQ ID NO. 37 SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO.
- SEQ ID NO. 86 SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 92, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO.
- SEQ ID NO. 48 SEQ ID NO. 50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO. 93, and combinations thereof.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO. 21/SEQ ID NO.
- SEQ ID NO. 21/SEQ ID NO. 23 SEQ ID NO. 24/SEQ ID NO. 22, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 23, SEQ ID NO. 33/SEQ ID NO. 22, SEQ ID NO. 34/SEQ ID NO. 22, SEQ ID NO. 24/SEQ ID NO. 35, SEQ ID NO. 36/SEQ ID NO. 26, SEQ ID NO. 29/SEQ ID NO. 22, SEQ ID NO.
- SEQ ID NO. 56/SEQ ID NO. 57 SEQ ID NO. 58/SEQ ID NO. 57, SEQ ID NO. 59/SEQ ID NO. 60, SEQ ID NO. 61/SEQ ID NO. 62, SEQ ID NO. 63/SEQ ID NO. 64, SEQ ID NO. 65/SEQ ID NO. 66, SEQ ID NO. 58/SEQ ID NO. 67, SEQ ID NO. 61/SEQ ID NO. 68, SEQ ID NO. 69/SEQ ID NO. 70, SEQ ID NO. 71/SEQ ID NO. 72, SEQ ID NO. 49/SEQ ID NO. 73, SEQ ID NO. 74/SEQ ID NO. 73, SEQ ID NO.
- the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO.
- SEQ ID NO. 34 SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO.
- SEQ ID NO. 86 amino acid sequence
- SEQ ID NO. 88 amino acid sequence
- SEQ ID NO. 90 amino acid sequence
- SEQ ID NO. 92 amino acid sequence 92
- combinations thereof and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO.
- the present disclosure further provides a method for treating a broad spectrum of mammalian cancers or inflammatory diseases or autoimmune diseases, comprising
- an anti- c-Met polypeptide wherein the anti- c-Met polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a c-Met epitope with a binding affinity of at least 10 "6 M, a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof; wherein the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO.
- SEQ ID NO. 3 SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO.
- SEQ ID NO. 58 SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 92, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO.
- SEQ ID NO. 6 SEQ ID NO. 8
- SEQ ID NO. 10 SEQ ID NO. 12
- SEQ ID NO. 14 SEQ ID NO. 16
- SEQ ID NO. 18 SEQ ID NO. 20
- the fully human antibody Fab fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO.
- SEQ ID NO. 45 SEQ ID NO. 47, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 50, SEQ ID NO.
- SEQ ID NO. 54 SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO. 93, and combinations thereof; and
- the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 37, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO.
- SEQ ID NO. 47 SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 65, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 74, SEQ ID NO. 75, SEQ ID NO. 76, SEQ ID NO. 79, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 35, SEQ ID NO. 38, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 50, SEQ ID NO.
- SEQ ID NO. 54 SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 67, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 73, SEQ ID NO. 77, SEQ ID NO. 78, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 91, SEQ ID NO. 93, and combinations thereof.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO.
- SEQ ID NO. 23 SEQ ID NO. 24/SEQ ID NO. 22, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 23, SEQ ID NO. 24/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 23, SEQ ID NO. 33/SEQ ID NO. 22, SEQ ID NO. 34/SEQ ID NO. 22, SEQ ID NO. 24/SEQ ID NO. 35, SEQ ID NO. 36/SEQ ID NO. 26, SEQ ID NO. 29/SEQ ID NO. 22, SEQ ID NO. 37/SEQ ID NO.
- SEQ ID NO. 34/SEQ ID NO. 23 SEQ ID NO. 37/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 39, SEQ ID NO. 32/SEQ ID NO. 22, SEQ ID NO. 40/SEQ ID NO. 41, SEQ ID NO. 42/SEQ ID NO. 43, SEQ ID NO. 44/SEQ ID NO. 41, SEQ ID NO. 45/SEQ ID NO. 46, SEQ ID NO. 47/SEQ ID NO. 48, SEQ ID NO. 49/SEQ ID NO. 50, SEQ ID NO. 51/SEQ ID NO. 52, SEQ ID NO. 53/SEQ ID NO. 54, SEQ ID NO. 45/SEQ ID NO. 55, SEQ ID NO.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO.
- SEQ ID NO. 34/SEQ ID NO. 22 SEQ ID NO. 34/SEQ ID NO. 22, SEQ ID NO. 24/SEQ ID NO. 35, SEQ ID NO. 36/SEQ ID NO. 26, SEQ ID NO. 29/SEQ ID NO. 22, SEQ ID NO. 37/SEQ ID NO. 38, SEQ ID NO. 34/SEQ ID NO. 23, SEQ ID NO. 37/SEQ ID NO. 23, SEQ ID NO. 32/SEQ ID NO. 39, SEQ ID NO. 32/SEQ ID NO. 22, SEQ ID NO. 40/SEQ ID NO. 41, SEQ ID NO. 42/SEQ ID NO. 43, SEQ ID NO. 44/SEQ ID NO. 41, SEQ ID NO. 45/SEQ ID NO. 46, SEQ ID NO. 47/SEQ ID NO.
- SEQ ID NO. 49/SEQ ID NO. 50 SEQ ID NO. 51/SEQ ID NO. 52, SEQ ID NO. 53/SEQ ID NO. 54, SEQ ID NO. 45/SEQ ID NO. 55, SEQ ID NO. 56/SEQ ID NO. 57, SEQ ID NO. 58/SEQ ID NO. 57, SEQ ID NO. 59/SEQ ID NO. 60, SEQ ID NO. 61/SEQ ID NO. 62, SEQ ID NO. 63/SEQ ID NO. 64, SEQ ID NO. 65/SEQ ID NO. 66, SEQ ID NO. 58/SEQ ID NO. 67, SEQ ID NO. 61/SEQ ID NO. 68, SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO.
- the broad spectrum of mammalian cancers to be treated the cancer is a c- Met-activation-related cancer, chosen from c-Met-activation-related cancers that are HGF- dependent, HGF-independent, or both.
- the broad spectrum of mammalian cancers to be treated is selected from the group consisting of prostate cancer, osteosarcoma, lung cancer, breast cancer, endometrial cancer, glyoblastoma, and colon cancer.
- an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
- antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
- the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
- Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer.
- PAMs peptide antibody mimetics
- An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
- An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino- terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa or lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
- the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
- variable regions of naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C- terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
- Other numbering systems for the amino acids in immunoglobulin chains include IMGT.RTM.
- Antibodies can be obtained from sources such as serum or plasma that contain immunoglobulins having varied antigenic specificity. If such antibodies are subjected to affinity purification, they can be enriched for a particular antigenic specificity. Such enriched preparations of antibodies usually are made of less than about 10% antibody having specific binding activity for the particular antigen. Subjecting these preparations to several rounds of affinity purification can increase the proportion of antibody having specific binding activity for the antigen. Antibodies prepared in this manner are often referred to as "monospecific.” Monospecfic antibody preparations can be made up of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, or 99.9% antibody having specific binding activity for the particular antigen.
- an “antibody” refers to an intact immunoglobulin or to an antigen binding portion thereof that competes with the intact antibody for specific binding, unless otherwise specified.
- Antigen binding portions may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
- Antigen binding portions include, inter alia, Fab, Fab', F(ab') 2 , Fv, domain antibodies (dAbs), and complementarity determining region (CDR) fragments, single-chain antibodies (scFv), chimeric antibodies, diabodies, triabodies, tetrabodies, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
- a Fab fragment is a monovalent fragment having the VL, VH, CL and CHI domains; a F(ab') 2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the VH and CHI domains; an Fv fragment has the VL and VH domains of a single arm of an antibody; and a dAb fragment has a VH domain, a VL domain, or an antigen-binding fragment of a VH or VL domain (U.S. Patents 6,846,634;
- a single-chain antibody is an antibody in which a VL and a VH region are joined via a linker ⁇ e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (Bird et al., 1988, Science 242:423-26 and Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-83).
- a linker ⁇ e.g., a synthetic sequence of amino acid residues
- Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises VH and VL domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (Holliger et al., 1993, Proc. Natl. Acad. Sci. USA 90:6444-48, and Poljak et al., 1994, Structure 2: 1121-23). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites. Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites. Similarly, tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
- Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody may be identified using the system described by Kabat et al. supra; Lefranc et al., supra and/or Honegger and Pluckthun, supra.
- One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
- An antigen binding protein may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
- the CDRs permit the antigen binding protein to specifically bind to a particular antigen of interest.
- An antigen binding protein may have one or more binding sites. If there is more than one binding site, the binding sites may be identical to one another or may be different. For example, a naturally occurring human immunoglobulin typically has two identical binding sites, while a "bispecific” or “bifunctional” antibody has two different binding sites.
- the term "human antibody” includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody). These antibodies may be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain-encoding genes.
- a humanized antibody has a sequence that differs from the sequence of an antibody derived from a non-human species by one or more amino acid substitutions, deletions, and/or additions, such that the humanized antibody is less likely to induce an immune response, and/or induces a less severe immune response, as compared to the non-human species antibody, when it is administered to a human subject.
- certain amino acids in the framework and constant domains of the heavy and/or light chains of the non-human species antibody are mutated to produce the humanized antibody.
- the constant domain(s) from a human antibody are fused to the variable domain(s) of a non-human species.
- one or more amino acid residues in one or more CDR sequences of a non-human antibody are changed to reduce the likely immunogenicity of the non-human antibody when it is administered to a human subject, wherein the changed amino acid residues either are not critical for immunospecific binding of the antibody to its antigen, or the changes to the amino acid sequence that are made are conservative changes, such that the binding of the humanized antibody to the antigen is not significantly worse than the binding of the non-human antibody to the antigen. Examples of how to make humanized antibodies may be found in U.S. Patents 6,054,297, 5,886,152 and 5,877,293.
- chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
- one or more of the CDRs are derived from a human anti-c-Met antibody.
- all of the CDRs are derived from a human anti-c-Met antibody.
- the CDRs from more than one human anti-c-Met antibodies are mixed and matched in a chimeric antibody.
- a chimeric antibody may comprise a CDR1 from the light chain of a first human anti-PAR-2 antibody, a CDR2 and a CDR3 from the light chain of a second human anti-c-Met antibody, and the CDRs from the heavy chain from a third anti-c-Met antibody.
- Other combinations are possible.
- the framework regions may be derived from one of the same anti-c-Met antibodies, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
- a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody (-ies) from another species or belonging to another antibody class or subclass.
- fragments of such antibodies that exhibit the desired biological activity (i.e., the ability to specifically bind c- Met).
- a “neutralizing antibody” or an “inhibitory antibody” is an antibody that inhibits the proteolytic activation of c-Met when an excess of the anti-c-Met antibody reduces the amount of activation by at least about 20% using an assay such as those described herein in the
- the antigen binding protein reduces the amount of amount of proteolytic activation of c-Met by at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, and 99.9%.
- Fragments or analogs of antibodies can be readily prepared by those of ordinary skill in the art following the teachings of this specification and using techniques known in the art. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Computerized comparison methods can be used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. See, Bowie et al., 1991, Science 253: 164.
- a “CDR grafted antibody” is an antibody comprising one or more CDRs derived from an antibody of a particular species or isotype and the framework of another antibody of the same or different species or isotype.
- a “multi- specific antibody” is an antibody that recognizes more than one epitope on one or more antigens.
- a subclass of this type of antibody is a "bi-specific antibody” which recognizes two distinct epitopes on the same or different antigens.
- An antigen binding protein "specifically binds" to an antigen (e.g., human c-Met) if it binds to the antigen with a dissociation constant of 1 nanomolar or less.
- an “antigen binding domain,” “antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
- An “epitope” is the portion of a molecule that is bound by an antigen binding protein (e.g., by an antibody).
- An epitope can comprise non-contiguous portions of the molecule (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein).
- the "percent identity" of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, Calif.)) using its default parameters.
- polynucleotide oligonucleotide
- nucleic acid oligonucleotide
- nucleic acid molecules e.g., cDNA or genomic DNA
- RNA molecules e.g., mRNA
- nucleotide analogs e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
- hybrids thereof e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
- the nucleic acid molecule can be single- stranded or double-stranded.
- the nucleic acid molecules of the invention comprise a contiguous open reading frame encoding an antibody, or a fragment, derivative, mutein, or variant thereof.
- Two single-stranded polynucleotides are "the complement" of each other if their sequences can be aligned in an anti -parallel orientation such that every nucleotide in one polynucleotide is opposite its complementary nucleotide in the other polynucleotide, without the introduction of gaps, and without unpaired nucleotides at the 5' or the 3' end of either sequence.
- a polynucleotide is "complementary" to another polynucleotide if the two polynucleotides can hybridize to one another under moderately stringent conditions.
- a polynucleotide can be complementary to another polynucleotide without being its complement.
- a “vector” is a nucleic acid that can be used to introduce another nucleic acid linked to it into a cell.
- a vector is a "plasmid,” which refers to a linear or circular double stranded DNA molecule into which additional nucleic acid segments can be ligated.
- a viral vector e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses
- certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
- a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the nucleotide sequence.
- a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
- the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
- Examples of regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals).
- a "host cell” is a cell that can be used to express a nucleic acid, e.g., a nucleic acid of the invention.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- host cells examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (see Gluzman et al., 1981, Cell 23:175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (see Rasmussen et al., 1998, Cytotechnology 28:31) or CHO strain DX-B11, which is deficient in DHFR (see Urlaub et al., 1980, Proc. Natl. Acad. Sci.
- COS-7 line of monkey kidney cells ATCC CRL 1651
- L cells C127 cells
- 3T3 cells ATCC CCL 163
- CHO Chinese hamster ovary
- HeLa cells derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (see McMahan et al., 1991, EMBO J. 10:2821), human embryonic kidney cells such as 293,293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
- a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
- the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
- a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- the mammalian cancer to be treated is selected from the group consisting of ovarian, colon, breast or hepatic carcinoma cell lines, myelomas, neuroblastic -derived CNS tumors, monocytic leukemias, B-cell derived leukemia's, T-cell derived leukemias, B-cell derived lymphomas, T-cell derived lymphomas, mast cell derived tumors, and combinations thereof.
- Polypeptides of the present disclosure can be produced using any standard methods known in the art.
- the polypeptides are produced by recombinant DNA methods by inserting a nucleic acid sequence (e.g., a cDNA) encoding the polypeptide into a recombinant expression vector and expressing the DNA sequence under conditions promoting expression.
- a nucleic acid sequence e.g., a cDNA
- Nucleic acids encoding any of the various polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells.
- the DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes.
- suitable transcriptional or translational regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
- the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants is additionally incorporated.
- the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
- protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
- the expression construct is introduced into the host cell using a method appropriate to the host cell.
- a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
- Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
- Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
- Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, ⁇ Bio/Technology, 6:47, 1988).
- suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
- Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
- Proteins disclosed herein can also be produced using cell-translation systems.
- the nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
- polypeptides of the present disclosure can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry.
- Non-limiting examples include extraction, recrystallization, salting out ⁇ e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
- polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
- the purified polypeptide is preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
- the binding polypeptides of the invention may further comprise post-translational modifications.
- post-translational protein modifications include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
- the modified soluble polypeptides may contain non- amino acid elements, such as lipids, poly- or mono-saccharide, and phosphates.
- a preferred form of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide. Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogeneticity of the protein. See Raju et al. Biochemistry. 2001 31 ; 40(30):8868- 76.
- modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers.
- the polymer is polyethylene glycol ("PEG"), polypropylene glycol, or poly oxy alky lenes, in the manner as set forth in U.S. Patents 4,640,835; 4,496,689; 4,301, 144; 4,670,417; 4,791, 192 or 4,179,337.
- PEG is a water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
- the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-C CHzCHzC n -lCHzCHzOH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a C 1-4 alkyl.
- the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH 3 ("methoxy PEG").
- a PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule.
- such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol.
- a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
- Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Patent. 5,932,462.
- One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini et al., Bioconjugate Chem. 6 (1995) 62-69).
- the pegylated n3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus.
- the present disclosure provides a target-binding n3 polypeptide with improved pharmacokinetic properties, the polypeptide comprising: a n3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10F n3 domain participate in
- n3 polypeptide binds to the target with a KD of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a
- the PEG moiety may be attached to the n3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at
- beta or beta-like strand or at the C-terminus of the n3 polypeptide or between the C-terminus and the most C-terminal beta or beta-like strand.
- a Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding.
- a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
- a variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to c-Met-binding polypeptides.
- the number of repeating units "n" in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da.
- each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270)
- the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
- the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
- a c-Met binding polypeptide is covalently linked to one poly(ethylene glycol) group of the formula: -CO— (CH 2 ) x -(OCH 2 CH 2 ) m -OR , with the -CO (i.e. carbonyl) of the poly(ethylene glycol) group forming an amide bond with one of the amino groups of the binding polypeptide; R being lower alkyl; x being 2 or 3; m being from about 450 to about 950; and n and m being chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to 40 kDa.
- a binding polypeptide's 6-amino group of a lysine is the available (free) amino group.
- PEG molecules may be activated to react with amino groups on a binding polypeptide, such as with lysines.
- carbonate esters of PEG are used to form the PEG-binding polypeptide conjugates.
- ⁇ , ⁇ '-disuccinimidylcarbonate may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a binding polypeptide (U.S. Patents 5,281 ,698 and 5,932,462).
- l,l'-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG- pyridyl mixed carbonate (U.S. Patent 5,382,657), respectively.
- Pegylation of a 10F n3 polypeptide can be performed according to the methods of the state of the art, for example by reaction of the binding polypeptide with electrophilically active PEGs (supplier: Shearwater Corp., USA, www.shearwatercorp.com).
- Preferred PEG reagents of the present invention are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SB A), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini et al., Bioconjugate Chem. 6 (1995) 62-69).
- PEG-SPA N-hydroxysuccinimidyl propionates
- PEG-SB A butanoates
- PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Mon
- PEG molecules may be coupled to sulfhydryl groups on a binding polypeptide (Sartore et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Patent 5,766,897).
- U.S. Patents 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
- cysteine residues are native to the binding polypeptide, whereas in other embodiments, one or more cysteine residues are engineered into the binding polypeptide.
- Mutations may be introduced into a binding polypeptide coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
- Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
- the residue to be mutated to cysteine is a surface-exposed residue.
- surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (Himanen et al., Nature. (2001) 20-27; 414(6866):933-8) and thus the surface-exposed residues identified.
- cysteine residues are introduced into binding polypeptides at or near the N- and/or C -terminus, or within loop regions.
- the pegylated binding polypeptide comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid.
- PEG- aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Patent 4,002,531, in Wieder et al., (1979) /. Biol. Chem.
- pegylated binding polypeptide comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide.
- a binding polypeptide is pegylated at the C-terminus.
- a protein is pegylated at the C-terminus by the introduction of C-terminal azido- methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., Bioconjug. Chem. 2004; 15(5): 1005-1009.
- Monopegylation of a binding polypeptide can also be produced according to the general methods described in WO 94/01451.
- WO 94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C- terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified.
- the polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group.
- the unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent.
- the side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide.
- the number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
- the ratio of a binding polypeptide to activated PEG in the conjugation reaction can be from about 1 :0.5 to 1 :50, between from about 1 : 1 to 1 :30, or from about 1 :5 to 1 : 15.
- Various aqueous buffers can be used in the present method to catalyze the covalent addition of PEG to the binding polypeptide.
- the pH of a buffer used is from about 7.0 to 9.0.
- the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
- PEGylated binding polypeptide such as size exclusion (e.g. gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri- poly- and un-pegylated binding polypeptide, as well as free PEG.
- the percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition. About ninety percent mono-PEG conjugates represents a good balance of yield and activity.
- compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired.
- the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
- the pegylated binding polypeptides will preferably retain at least 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
- biological activity refers to its ability to bind to c-Met, as assessed by KD, k on or k cff .
- the pegylated binding polypeptide protein shows an increase in binding to c-Met relative to unpegylated binding polypeptide.
- the serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide.
- the PEG-modified polypeptide may have a half-life (ti /2 ) which is enhanced relative to the half-life of the unmodified protein.
- the half-life of PEG- binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide.
- the protein half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
- Therapeutic Formulations and Modes of Administration The present disclosure features methods for treating conditions or preventing preconditions which respond to an inhibition of c-Met biological activity. Preferred examples are conditions that are characterized by inflammation or cellular hyperproliferation. Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan. In general, regulatory agencies require that a protein reagent to be used as a therapeutic is formulated so as to have acceptably low levels of pyrogens. Accordingly, therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency (e.g., FDA).
- FDA regulatory agency
- compositions of the present disclosure may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form.
- Administration may be parenteral (e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples.
- any gene therapy technique using nucleic acids encoding the polypeptides of the invention, may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
- the polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry.
- acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like.
- Metal complexes include zinc, iron, and the like.
- the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
- a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered.
- the exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques.
- the polypeptide is administered at about 0.01 g/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg/kg per day.
- the polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or preferably less frequently (e.g., weekly, every two weeks, every three weeks, monthly, or quarterly).
- adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
- c-Met binding proteins described herein and their related variants are useful in a number of therapeutic and diagnostic applications. These include the inhibition of the biological activity of c-Met by competing for or blocking the binding to a c-Met as well as the delivery of cytotoxic or imaging moieties to cells, preferably cells expressing c-Met.
- the small size and stable structure of these molecules can be particularly valuable with respect to manufacturing of the drug, rapid clearance from the body for certain applications where rapid clearance is desired or formulation into novel delivery systems that are suitable or improved using a molecule with such characteristics.
- the polypeptides of this disclosure are effective against a number of cancer conditions as well as complications arising from cancer, such as pleural effusion and ascites.
- the c-Met-binding polypeptides of the disclosure can be used for the treatment of prevention of hyperproliferative diseases or cancer and the metastatic spread of cancers.
- Preferred indications for the disclosed anti- c-Met antibodies include colorectal cancers, head and neck cancers, small cell lung cancer, non-small cell lung cancer (NSCLC) and pancreatic cancer.
- Non-limiting examples of cancers include bladder, blood, bone, brain, breast, cartilage, colon kidney, liver, lung, lymph node, nervous tissue, ovary, pancreatic, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, or vaginal cancer.
- a c-Met binding polypeptide can be administered alone or in combination with one or more additional therapies such as chemotherapy radiotherapy, immunotherapy, surgical intervention, or any combination of these. Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
- polypeptide therapeutic agents can be administered, together (simultaneously) or at different times (sequentially).
- polypeptide therapeutic agents can be administered with another type of compounds for treating cancer or for inhibiting angiogenesis.
- the subject anti- c-Met antibodies agents of the invention can be used alone.
- the subject agents may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor).
- proliferative disorders e.g., tumor
- methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
- conventional cancer therapies e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
- a wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies.
- chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
- a polypeptide therapeutic agent of the present invention When a polypeptide therapeutic agent of the present invention is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may be found to enhance the therapeutic effect of the antineoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
- Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol,
- diethylstilbestrol docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine,
- chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disrupters such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracycl
- doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disrupters.
- administration of the polypeptide therapeutic agents may be continued while the other therapy is being administered and/or thereafter.
- Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses.
- administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
- a biological sample such as serum or a tissue biopsy, from a patient suspected of having a condition characterized by inappropriate angiogenesis is contacted with a detectably labeled polypeptide of the disclosure to detect levels of c-Met.
- the levels of c-Met detected are then compared to levels of c-Met detected in a normal sample also contacted with the labeled polypeptide.
- An increase of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% in the levels of the c-Met may be considered a diagnostic indicator.
- the c-Met binding polypeptides are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
- the active moiety may be a radioactive agent, such as: radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or manganese, positron emitters of oxygen, nitrogen, iron, carbon, or gallium, 43 K, 52 Fe, 51 Co, 67 Cu, 67 Ga, 68 Ga, 123 I, 125 I, 131 I, 132 I, or "TC.
- a binding agent affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected.
- the localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography.
- Immunoscintigraphy using c-Met binding polypeptides directed at c-Met may be used to detect and/or diagnose cancers and vasculature. For example, any of the binding polypeptide against a c-Met marker labeled with "Technetium, m Indium, or 125 Iodine may be effectively used for such imaging.
- compositions according to the present invention useful as imaging agents comprising a targeting moiety conjugated to a radioactive moiety comprise 0.1- 100 millicuries, in some embodiments preferably 1 -10 millicuries, in some embodiments preferably 2-5 millicuries, in some embodiments more preferably 1-5 millicuries.
- the c-Met binding polypeptides can also be used to deliver additional therapeutic agents (including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds) to a cell or tissue expressing c-Met.
- additional therapeutic agents including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds
- the c-Met binding polypeptide is fused to a chemotherapeutic agent for targeted delivery of the chemotherapeutic agent to a tumor cell or tissue expressing c-Met.
- the c-Met binding polypeptides are useful in a variety of applications, including research, diagnostic and therapeutic applications. For instance, they can be used to isolate and/or purify receptor or portions thereof, and to study receptor structure (e.g., conformation) and function.
- the various binding polypeptides can be used to detect or measure the expression of c-Met, for example, on endothelial cells (e.g., venous endothelial cells), or on cells transfected with a c-Met gene.
- endothelial cells e.g., venous endothelial cells
- cells transfected with a c-Met gene e.g., a c-Met gene.
- they also have utility in applications such as cell sorting and imaging (e.g., flow cytometry, and fluorescence activated cell sorting), for diagnostic or research purposes.
- the binding polypeptides of fragments thereof can be labeled or unlabeled for diagnostic purposes.
- diagnostic assays entail detecting the formation of a complex resulting from the binding of a binding polypeptide to c-Met.
- the binding polypeptides or fragments can be directly labeled, similar to antibodies.
- labels can be employed, including, but not limited to, radionuclides, fluorescers, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors and ligands (e.g., biotin, haptens). Numerous appropriate immunoassays are known to the skilled artisan (see, for example, U.S. Patents.
- the binding polypeptides can be used in assays, such as agglutination assays. Unlabeled binding polypeptides can also be used in combination with another (one or more) suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
- a labeled antibody reactive with the binding polypeptide or other suitable reagent e.g., labeled protein A
- the binding polypeptides of the present invention can be utilized in enzyme immunoassays, wherein the subject polypeptides are conjugated to an enzyme.
- a biological sample comprising a c-Met protein is combined with the subject binding polypeptides, binding occurs between the binding polypeptides and the c-Met protein.
- a sample containing cells expressing a c-Met protein e.g., endothelial cells
- binding occurs between the binding polypeptides and cells bearing a c-Met protein recognized by the binding polypeptide.
- These bound cells can be separated from unbound reagents and the presence of the binding polypeptide-enzyme conjugate specifically bound to the cells can be determined, for example, by contacting the sample with a substrate of the enzyme which produces a color or other detectable change when acted on by the enzyme.
- the subject binding polypeptides can be unlabeled, and a second, labeled polypeptide (e.g., an antibody) can be added which recognizes the subject binding polypeptide.
- kits for use in detecting the presence of a c-Met protein in a biological sample can also be prepared.
- Such kits will include a c-Met binding polypeptide which binds to a c-Met protein or portion of said receptor, as well as one or more ancillary reagents suitable for detecting the presence of a complex between the binding polypeptide and the receptor protein or portions thereof.
- the polypeptide compositions of the present invention can be provided in lyophilized form, either alone or in combination with additional antibodies specific for other epitopes.
- the binding polypeptides and/or antibodies which can be labeled or unlabeled, can be included in the kits with adjunct ingredients (e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin).
- adjunct ingredients e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin.
- the binding polypeptides and/or antibodies can be provided as a lyophilized mixture with the adjunct ingredients, or the adjunct ingredients can be separately provided for combination by the user.
- these adjunct materials will be present in less than about 5% weight based on the amount of active binding polypeptide or antibody, and usually will be present in a total amount of at least about 0.001 % weight based on polypeptide or antibody concentration.
- a second antibody capable of binding to the binding polypeptide can be provided in the kit, for instance in a separate vial or container.
- the second antibody if present, is typically labeled, and can be formulated in an analogous manner with the antibody formulations described above.
- the present disclosure also provides a method of detecting and/or quantitating expression of c-Met, wherein a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted with a binding polypeptide which binds to a c-Met or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored. Detection of the binding polypeptide, indicative of the formation of a complex between binding polypeptide and c-Met or a portion thereof, indicates the presence of the receptor. Binding of a polypeptide to the cell can be determined by standard methods, such as those described in the working examples. The method can be used to detect expression of c- Met on cells from an individual. Optionally, a quantitative expression of c-Met on the surface of endothelial cells can be evaluated, for instance, by flow cytometry, and the staining intensity can be correlated with disease susceptibility, progression or risk.
- a composition comprising a cell or fraction thereof (e.g., membrane fraction) is
- the present disclosure also provides a method of detecting the susceptibility of a mammal to certain diseases.
- the method can be used to detect the susceptibility of a mammal to diseases which progress based on the amount of c-Met present on cells and/or the number of c-Met-positive cells in a mammal.
- Polypeptide sequences are indicated using standard one- or three-letter abbreviations. Unless otherwise indicated, each polypeptide sequence has amino termini at the left and a carboxy termini at the right; each single-stranded nucleic acid sequence, and the top strand of each double-stranded nucleic acid sequence, has a 5' termini at the left and a 3' termini at the right. A particular polypeptide sequence also can be described by explaining how it differs from a reference sequence.
- c-Met inhibitor and "c-Met antagonist” are used interchangeably. Each is a molecule that detectably inhibits at least one function of c-Met. Conversely, a "c-Met agonist” is a molecule that detectably increases at least one function of c-Met. The inhibition caused by a c-Met inhibitor need not be complete so long as it is detectable using an assay. Any assay of a function of c-Met can be used, examples of which are provided herein. Examples of functions of c-Met that can be inhibited by a c-Met inhibitor, or increased by a c-Met agonist, include cancer cell growth or apoptosis (programmed cell death), and so on.
- c-Met inhibitors and c-Met agonists include, but are not limited to, c-Met binding polypeptides such as antigen binding proteins (e.g., c-Met inhibiting antigen binding proteins), antibodies, antibody fragments, and antibody derivatives.
- c-Met binding polypeptides such as antigen binding proteins (e.g., c-Met inhibiting antigen binding proteins), antibodies, antibody fragments, and antibody derivatives.
- peptide each refers to a molecule comprising two or more amino acid residues joined to each other by peptide bonds. These terms encompass, e.g., native and artificial proteins, protein fragments and polypeptide analogs (such as muteins, variants, and fusion proteins) of a protein sequence as well as post-translationally, or otherwise covalently or non-covalently, modified proteins.
- a peptide, polypeptide, or protein may be monomeric or polymeric.
- a "variant" of a polypeptide (for example, an antibody) comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence. Disclosed variants include, for example, fusion proteins.
- a “derivative" of a polypeptide is a polypeptide (e.g., an antibody) that has been chemically modified, e.g., via conjugation to another chemical moiety (such as, for example, polyethylene glycol or albumin, e.g., human serum albumin), phosphorylation, and glycosylation.
- another chemical moiety such as, for example, polyethylene glycol or albumin, e.g., human serum albumin
- phosphorylation phosphorylation
- glycosylation e.g., glycosylation
- the term “antibody” includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
- an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
- antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
- the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
- Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer.
- PAMs peptide antibody mimetics
- An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
- An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino- terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa or lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the anti-c-Met antibodies disclosed herein are characterized by their variable domain region sequences in the heavy VH and light VL amino acid sequences.
- the preferred antibody is A6 which is a kappa IgG antibody.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids.
- the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
- a “multi- specific antibody” is an antibody that recognizes more than one epitope on one or more antigens.
- a subclass of this type of antibody is a "bi-specific antibody” which recognizes two distinct epitopes on the same or different antigens.
- An antigen binding protein "specifically binds" to an antigen (e.g., human c-Met) if it binds to the antigen with a dissociation constant of 1 nanomolar or less.
- an “antigen binding domain, "antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
- An “epitope” is the portion of a molecule that is bound by an antigen binding protein (e.g., by an antibody).
- An epitope can comprise non-contiguous portions of the molecule (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein).
- the "percent homology" of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, Calif.)) using its default parameters.
- a "host cell” is a cell that can be used to express a nucleic acid.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- a prokaryote for example, E. coli
- a eukaryote for example, a single-celled eukaryote (e.g., a yeast or other fungus)
- a plant cell e.g., a tobacco or tomato plant cell
- an animal cell e.g., a human cell,
- host cells examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23: 175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (Rasmussen et al., 1998,
- Cytotechnology 28:31 or CHO strain DX-B11, which is deficient in DHFR (Urlaub et al., 1980, Proc. Natl. Acad. Sci. USA 77:4216-20), HeLa cells, BHK (ATCC CRL 10) cell lines, the CV1/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (McMahan et al., 1991, EMBO J.
- a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
- the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
- a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- Antigen binding proteins ⁇ e.g., antibodies, antibody fragments, antibody derivatives, antibody muteins, and antibody variants) are polypeptides that bind to c-Met, (preferably, human c-Met). Antigen binding proteins include antigen binding proteins that inhibit a biological activity of c-Met.
- Oligomers that contain one or more antigen binding proteins may be employed as c- Met antagonists. Oligomers may be in the form of covalently-linked or non-covalently-linked dimers, trimers, or higher oligomers. Oligomers comprising two or more antigen binding protein are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
- One embodiment is directed to oligomers comprising multiple antigen binding proteins joined via covalent or non-covalent interactions between peptide moieties fused to the antigen binding proteins.
- Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
- Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of antigen binding proteins attached thereto, as described in more detail below.
- the oligomers comprise from two to four antigen binding proteins.
- the antigen binding proteins of the oligomer may be in any form, such as any of the forms described above, e.g., variants or fragments.
- the oligomers comprise antigen binding proteins that have c-Met binding activity.
- One embodiment is directed to a dimer comprising two fusion proteins created by fusing a c-Met binding fragment of an anti- c-Met antibody to the Fc region of an antibody.
- the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
- Fc polypeptide includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
- Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found.
- Leucine zippers were originally identified in several DNA- binding proteins (Landschulz et al., 1988, Science 240: 1759), and have since been found in a variety of different proteins.
- leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize.
- leucine zipper domains suitable for producing soluble oligomeric proteins are described in WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al., 1994, FEBS Letters 344: 191.
- SPD lung surfactant protein D
- the use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al., 1994, Semin. Immunol. 6:267- 78.
- recombinant fusion proteins comprising an anti- c-Met antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti- c-Met antibody fragments or derivatives that form are recovered from the culture supernatant.
- Antigen-binding fragments of antigen binding proteins of the invention may be produced by conventional techniques. Examples of such fragments include, but are not limited to, Fab and F(ab') 2 fragments.
- Monoclonal antibodies that bind to c-Met.
- Monoclonal antibodies may be produced using any technique known in the art, e.g., by immortalizing spleen cells harvested from the transgenic animal after completion of the immunization schedule.
- the spleen cells can be immortalized using any technique known in the art, e.g., by fusing them with myeloma cells to produce hybridomas.
- Myeloma cells for use in hybridoma- producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas).
- Examples of suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NSl/l .Ag 4 1, Sp210-Agl4, FO, NSO/U, MPC-11, MPC 11 -X45-GTG 1.7 and S194/5XX0 Bui; examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 48210.
- Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
- Antigen binding proteins directed against c-Met can be used, for example, in assays to detect the presence of c-Met polypeptides, either in vitro or in vivo.
- the antigen binding proteins also may be employed in purifying c-Met proteins by immunoaffinity
- Blocking antigen binding proteins can be used in the methods disclosed herein. Such antigen binding proteins that function as c-Met antagonists may be employed in treating any c-Met-induced condition, including but not limited to various cancers.
- Antigen binding proteins may be employed in an in vitro procedure, or administered in vivo to inhibit c-Met-induced biological activity. Disorders caused or exacerbated (directly or indirectly) by the proteolytic activation of c-Met, examples of which are provided herein, thus may be treated.
- the present invention provides a therapeutic method comprising in vivo administration of a c-Met blocking antigen binding protein to a mammal in need thereof in an amount effective for reducing a c-Met-induced biological activity.
- Antigen binding proteins include fully human monoclonal antibodies that inhibit a biological activity of c-Met.
- Antigen binding proteins may be prepared by any of a number of conventional techniques. For example, they may be purified from cells that naturally express them ⁇ e.g., an antibody can be purified from a hybridoma that produces it), or produced in recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), Plenum Press, New York (1980); and Antibodies: A Laboratory Manual, Harlow and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988).
- any expression system known in the art can be used to make the recombinant polypeptides of the invention.
- host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired polypeptide.
- the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
- suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23: 175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, BHK (ATCC CRL 10) cell lines, and the CVl/EBNA cell line derived from the African green monkey kidney cell line CVl (ATCC CCL 70) as described by McMahan et al., 1991, EMBO J. 10: 2821.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985).
- the transformed cells can be cultured under conditions that promote expression of the polypeptide, and the polypeptide recovered by conventional protein purification procedures.
- One such purification procedure includes the use of affinity chromatography, e.g., over a matrix having all or a portion ⁇ e.g., the extracellular domain) of c-Met bound thereto.
- Polypeptides contemplated for use herein include substantially homogeneous recombinant mammalian anti- c-Met antibody polypeptides substantially free of contaminating endogenous materials.
- Antigen binding proteins may be prepared, and screened for desired properties, by any of a number of known techniques. Certain of the techniques involve isolating a nucleic acid encoding a polypeptide chain (or portion thereof) of an antigen binding protein of interest ⁇ e.g., an anti- c-Met antibody), and manipulating the nucleic acid through recombinant DNA technology.
- the nucleic acid may be fused to another nucleic acid of interest, or altered ⁇ e.g., by mutagenesis or other conventional techniques) to add, delete, or substitute one or more amino acid residues, for example.
- Single chain antibodies may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
- Fv region heavy and light chain variable domain
- short peptide linker short peptide linker
- Such single-chain Fvs have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
- the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers ⁇ e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., 1997, Prot. Eng.
- IgG antibodies may be derived from an IgM antibody, for example, and vice versa.
- Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
- Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype (Lantto et al., 2002, Methods Mol. Biol. 178:303-16).
- an IgG4 it may also be desired to introduce a point mutation (CPSCP->CPPCP) in the hinge region (Bloom et al., 1997, Protein Science 6:407) to alleviate a tendency to form intra-H chain disulfide bonds that can lead to heterogeneity in the IgG4 antibodies.
- CPSCP->CPPCP point mutation
- antigen binding proteins of the present invention have a binding affinity (K a ) for c-Met of at least 10 6 . In other embodiments, the antigen binding
- the proteins exhibit a K a of at least 10 , at least 10 , at least 10 , or at least 10 .
- the antigen binding protein exhibits a K a substantially the same as that of an antibody described herein in the Examples.
- the present disclosure provides an antigen binding protein that has a low dissociation rate from c-Met.
- the antigen binding protein has a K 0ff of 1 X 10 "4 to 1 or lower.
- the K cff is 5 X 10 "5 to 1 or lower.
- the K cff is substantially the same as an antibody described herein.
- the antigen binding protein binds to c-Met with substantially the same K 0ff as an antibody described herein.
- the present disclosure provides an antigen binding protein that inhibits an activity of c-Met.
- the antigen binding protein has an IC 50 of 1000 nM or lower. In another embodiment, the IC 50 is 100 nM or lower; in another embodiment, the IC5 0 is 10 nM or lower. In another embodiment, the IC5 0 is substantially the same as that of an antibody described herein in the Examples. In another embodiment, the antigen binding protein inhibits an activity of c-Met with substantially the same IC5 0 as an antibody described herein.
- the present disclosure provides an antigen binding protein that binds to human c-Met expressed on the surface of a cell and, when so bound, inhibits c-Met signaling activity in the cell without causing a significant reduction in the amount of c-Met on the surface of the cell. Any method for determining or estimating the amount of c-Met on the surface and/or in the interior of the cell can be used. In other embodiments, binding of the antigen binding protein to the c-Met-expressing cell causes less than about 75%, 50%, 40%, 30%, 20%, 15%, 10%, 5%, 1%, or 0.1 % of the cell-surface c-Met to be internalized.
- the present disclosure provides an antigen binding protein having a half-life of at least one day in vitro or in vivo ⁇ e.g., when administered to a human subject).
- the antigen binding protein has a half-life of at least three days.
- the antigen binding protein has a half-life of four days or longer.
- the antigen binding protein has a half-life of eight days or longer.
- the antigen binding protein is derivatized or modified such that it has a longer half-life as compared to the underivatized or unmodified antigen binding protein.
- the antigen binding protein contains one or more point mutations to increase serum half life, such as described in WO00/09560, incorporated by reference herein.
- bispecific antigen binding protein e.g., antigen binding protein that bind to two different epitopes of c-Met, or to an epitope of c-Met and an epitope of another molecule, via two different antigen binding sites or regions.
- bispecific antigen binding protein as disclosed herein can comprise a c-Met binding site from one of the herein-described antibodies and a second c-Met binding region from another of the herein-described antibodies, including those described herein by reference to other publications.
- a bispecific antigen binding protein may comprise an antigen binding site from one of the herein described antibodies and a second antigen binding site from another c-Met antibody that is known in the art, or from an antibody that is prepared by known methods or the methods described herein.
- bispecific antibodies Numerous methods of preparing bispecific antibodies are known in the art. Such methods include the use of hybrid-hybridomas as described by Milstein et al., 1983, Nature 305:537, and chemical coupling of antibody fragments (Brennan et al., 1985, Science 229:81 ; Glennie et al., 1987, /. Immunol. 139:2367; U.S. Patent 6,010,902). Moreover, bispecific antibodies can be produced via recombinant means, for example by using leucine zipper moieties ⁇ i.e., from the Fos and Jun proteins, which preferentially form heterodimers; Kostelny et al., 1992, /. Immunol. 148: 1547) or other lock and key interactive domain structures as described in U.S. Patent 5,582,996. Additional useful techniques include those described in U.S. Patents 5,959,083; and 5,807,706.
- the antigen binding protein comprises a derivative of an antibody.
- the derivatized antibody can comprise any molecule or substance that imparts a desired property to the antibody, such as increased half-life in a particular use.
- the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or
- an antibody e.g., a pharmaceutically active moiety
- a molecule that increases the suitability of the antibody for a particular use e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses.
- molecules that can be used to derivatize an antibody include albumin (e.g., human serum albumin) and polyethylene glycol (PEG).
- Albumin-linked and PEGylated derivatives of antibodies can be prepared using techniques well known in the art.
- the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
- TTR transthyretin
- the TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n- vinyl pyurrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
- the present disclosure provides methods of treating a subject.
- the method can, for example, have a generally salubrious effect on the subject, e.g., it can increase the subject's expected longevity.
- the method can, for example, treat, prevent, cure, relieve, or ameliorate ("treat") a disease, disorder, condition, or illness ("a condition").
- a condition a disease, disorder, condition, or illness
- the conditions to be treated are conditions characterized by inappropriate expression or activity of c-Met. In some such conditions, the expression or activity level is too high, and the treatment comprises administering a c-Met antagonist as described herein.
- the disorders or conditions are cancer-related. In particular, those cancers include, but are not limited to, lung, ovarian and colon carcinoma and various myelomas.
- Specific medical conditions and diseases that are treatable or preventable with the antigen binding proteins of this disclosure include various cancers.
- Certain methods provided herein comprise administering a c-Met binding antigen binding protein to a subject, thereby reducing a c-Met-induced biological response that plays a role in a particular condition.
- methods of the invention involve contacting endogenous c-Met with a c-Met binding antigen binding protein, e.g., via administration to a subject or in an ex vivo procedure.
- treatment encompasses alleviation or prevention of at least one symptom or other aspect of a disorder, or reduction of disease severity, and the like.
- An antigen binding protein need not effect a complete cure, or eradicate every symptom or manifestation of a disease, to constitute a viable therapeutic agent.
- drugs employed as therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents.
- a prophylactically administered treatment need not be completely effective in preventing the onset of a condition in order to constitute a viable prophylactic agent.
- Simply reducing the impact of a disease for example, by reducing the number or severity of its symptoms, or by increasing the effectiveness of another treatment, or by producing another beneficial effect), or reducing the likelihood that the disease will occur or worsen in a subject, is sufficient.
- One embodiment of the invention is directed to a method comprising
- a c-Met antagonist in an amount and for a time sufficient to induce a sustained improvement over baseline of an indicator that reflects the severity of the particular disorder.
- compositions comprising the antibodies and fragments thereof of the disclosure are administered to a subject in a manner appropriate to the indication.
- Pharmaceutical compositions may be administered by any suitable technique, including but not limited to, parenterally, topically, or by inhalation. If injected, the pharmaceutical composition can be administered, for example, via intra-articular, intravenous, intramuscular, intralesional, intraperitoneal or subcutaneous routes, by bolus injection, or continuous infusion. Localized administration, e.g. at a site of disease or injury is contemplated, as are transdermal delivery and sustained release from implants.
- Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation of the antagonist in aerosol form, and the like.
- Other alternatives include eyedrops; oral preparations including pills, syrups, lozenges or chewing gum; and topical preparations such as lotions, gels, sprays, and ointments.
- antigen binding proteins are administered in the form of a
- composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent.
- the composition additionally comprises one or more physiologically active agents, for example, a second inflammation- or immune- inhibiting substance, an anti-angiogenic substance, an analgesic substance, etc., non-exclusive examples of which are provided herein.
- the composition comprises one, two, three, four, five, or six physiologically active agents in addition to a c-Met binding antigen binding protein
- the present disclosure provides a method of treating a subject with a c-Met inhibiting antigen binding protein and one or more other treatments.
- a combination therapy achieves synergy or an additive effect by, for example, attacking multiple sites or molecular targets in a tumor.
- Types of combination therapies that can be used in connection with the present invention include inhibiting or activating (as appropriate) multiple nodes in a single disease-related pathway, multiple pathways in a target cell, and multiple cell types within a target tissue.
- a combination therapy method comprises administering to the subject two, three, four, five, six, or more of the c-Met agonists or antagonists described herein.
- the method comprises administering to the subject two or more treatments that together inhibit or activate (directly or indirectly) c-Met-mediated signal transduction. Examples of such methods include using combinations of two or more c-Met inhibiting antigen binding proteins, of a c-Met inhibiting antigen binding protein and one or more other therapeutic moiety having anti-cancer properties (for example, cytotoxic agents, and/or immunomodulators), or of a c-Met inhibiting antigen binding protein and one or more other treatments (e.g., surgery, or radiation).
- one or more anti- c-Met antibodies or antibody derivatives can be used in combination with one or more molecules or other treatments, wherein the other molecule(s) and/or treatment(s) do not directly bind to or affect c-Met, but which combination is effective for treating or preventing the condition being treated.
- one or more of the molecule(s) and/or treatment(s) treats or prevents a condition that is caused by one or more of the other molecule(s) or treatment(s) in the course of therapy, e.g., nausea, fatigue, alopecia, cachexia, insomnia, etc.
- the individual molecule(s) and/or treatment(s) can be administered in any order, over any length of time, which is effective, e.g., simultaneously, consecutively, or alternately.
- the method of treatment comprises completing a first course of treatment with one molecule or other treatment before beginning a second course of treatment.
- the length of time between the end of the first course of treatment and beginning of the second course of treatment can be any length of time that allows the total course of therapy to be effective, e.g., seconds, minutes, hours, days, weeks, months, or even years.
- the method comprises administering one or more of the c-Met antagonists described herein and one or more other treatments (e.g., a therapeutic or palliative treatment).
- a method comprises administering more than one treatment to a subject, it is to be understood that the order, timing, number, concentration, and volume of the
- administrations is limited only by the medical requirements and limitations of the treatment, i.e., two treatments can be administered to the subject, e.g., simultaneously, consecutively, alternately, or according to any other regimen.
- This example illustrates in vitro data showing the inhibition of Met-mediated cell proliferation by anti-c-Met antibodies in IgG ( Figure 3a) and Fab ( Figure 3b) form compared with the IgG and Fab forms of Genetech 5D5 (derivatized from Met Mab).
- Uncontrolled cell proliferation is a hallmark of cancer and the ability to inhibit proliferation in c-Met positive cancer cells with anti-c-Met antibodies is requisite for a therapeutic compound.
- 5000 U87 glioblastoma cells were plated into the wells of a 96-well white opaque cell culture cluster in 100 ⁇ DMEM media supplemented with 10% FBS, in triplicate.
- Example 2 This example illustrates in vitro data showing HGF stimulated auto-phosphorylation of the c-Met receptor in PC3 prostate cancer cells. This example demonstrates the ability of antibodies to block the activation of and therefore the function of c-Met in cancer cells.
- HGF was added to a final concentration of 50ng/ml. Cells were further incubated for 7 min. Cells were then processed according to the manufacturer's protocol. Following stimulation, cells were fixed and permeabilized in the wells. The c-Met phosphorylation was measured using a double immunoenzymatic labeling procedure. The cells were simultaneously incubated with two primary antibodies: a phospho-specific c-Met antibody and a normalization antibody that recognizes the pan-protein regardless of phosphorylation status. The primary antibodies were derived from different species.
- HRP horseradish-peroxidase
- AP alkaline phosphatase
- This example illustrates in vitro data showing HGF- stimulated, c-Met-mediated cell migration.
- a wound healing assay investigated the migration of cells into a denuded area of a cell culture. Stimulation of c-Met by HGF would trigger cells to migrate into the denuded area, therefore exemplary anti-c-Met antibodies will inhibit this migration.
- cell migration away from the local tumor environment allows for metastasis. Inhibition of migration may decrease the potential of metastasis.
- PC3 prostate cancer cells were used as a model. In this example, cells were grown to confluence on 6-well plates creating a tight monolayer of cells. After 24hr starvation with serum free media, the cell monolayer was scratched with a 200 ⁇ pipette tip. This created a denuded area for cells to migrate into.
- HGF HGF- stimulated, c-Met-mediated cell motility.
- HGF is also known as Scatter Factor, as it has the ability to trigger dispersion or scattering of cells. This scatter is mediated through c-Met-dependent cell motility. This type of cell motility can be associated with metastasis of tumor cells.
- a colony scatter assay is used to demonstrate the ability of anti-c-Met antibodies to inhibit c-Met-dependent cell motility.
- DU145 prostate cancer cells were seeded in a 10 cm plate at a density of 2 xlO 3 cells and cultured for 7 days until colonies formed.
- HGF (+HGF) stimulates cell motility depicted as spreading or scattering of the cells of the colony.
- Pre-treatment of cells with anti-C-Met antibodies in IgG and Fab format prevented this scatter to a variable extent.
- Clones El both IgG and Fab format), Al (IgG format), A8 (Fab format), and H8 (IgG format) antagonized HGF- stimulated, c-Met-mediated cell motility to the same extent as Genentech 5D5 (Fab format), while D6 (IgG format) and the IgG format of Genentech 5D5 have no antagonistic effects on cell motility.
- mice This example provides an effect of antibodies reactive with c-Met on tumor growth in vivo.
- the ability of anti-c-Met antibodies to modulate tumor growth was assessed using an athymic murine model. Groups of five mice were injected subcutaneously in the flank with 5xl0 6 Ul 18 human primary glioblastoma cells. Ten days after implantation of cells, mice were treated intraperitoneally with 100 ml of i) PBS, ii) antibody Al (0.15 mg), iii) antibody El (0.15 mg), or iv) antibody H8 (0.15 mg). Treatments were performed three times per week until the termination of the experiment. As shown in Figures 7 and 13, El (0), Al ( ⁇ ), and H8 ( ⁇ ) antibodies reduced the growth of the xenogeneic tumor cells compared to PBS alone.
- This example illustrates in vitro data for anti-c-Met antibody cellular binding EC 50 measurements.
- This example shows the binding characteristic for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC 50 ) is reached.
- DU-145 prostate cancer cells, SK-0-V3 ovarian cancer cells, or human umbilical vein endothelial cells (HUVEC) were aliquoted into the wells of a 96-well, v- bottom plate in FACS Buffer (PBS + 2% FBS). A 16-point, 2 fold serial dilution curve of antibodies made in FACS Buffer was used to stain the cells.
- Table 1 shows EC50 values for El derived anti-c-Met antibodies on DU-145 prostrate cancer cells and SK-0-V3 ovarian cancer cells
- This example illustrates in vitro data for anti-c-Met antibody cellular binding EC5 0 measurements.
- This example shows the binding characteristic for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC5 0 ) is reached.
- DU-145 prostate cancer cells or SK-0-V3 ovarian cancer cells were aliquoted into the wells of a 96-well, v-bottom plate in FACS Buffer (PBS + 2% FBS). A 16- point, 2 fold serial dilution curve of antibodies made in FACS Buffer was used to stain the cells.
- This example shows the blocking of the interaction between recombinant HGF and recombinant c-Met by anti-c-Met antibody El and its optimized versions. Inhibition of ligand binding to its receptor prevents activation.
- an ELISA was used to determine the concentration at which 50% of the ligand/receptor binding was blocked by the antibodies (IC50).
- recombinant c-Met extracellular domain R&D Sytems cat#358-MT-100/CF
- HGF R&D Systems cat# 294-HG-005/CF
- HGF binding to c-Met was detected using a biotinylated anti-HGF antibody (R&D cat#BAF294) followed by Streptavidin-HRP (Fitzgerald cat#65R-510PHRP).
- OD450 was plotted against antibody concentration and non-linear regression (GraphPad Prism) was used to determine the IC50 for each antibody ( Figure 8). The data is shown as mean OD450+/- SEM and the IC50 values shown are in nM.
- This example shows the blocking of the interaction between recombinant HGF and recombinant c-Met by anti-c-Met antibody Al and its optimized versions. Inhibition of ligand binding to its receptor prevents activation.
- an ELISA was used to determine the concentration at which 50% of the ligand/receptor binding was blocked by the antibodies (IC50).
- recombinant c-Met extracellular domain R&D Sytems cat#358-MT-100/CF
- HGF R&D Systems cat# 294-HG-005/CF
- HGF binding to c-Met is detected using a biotinylated anti-HGF antibody (R&D cat#BAF294) followed by Streptavidin-HRP (Fitzgerald cat#65R-510PHRP).
- OD450 was plotted against antibody concentration and non-linear regression (GraphPad Prism) is used to determine the IC50 for each antibody ( Figure 9). The data is shown as mean OD450+/- SEM and the IC50 values shown are in nM.
- This example illustrates in vitro data showing HGF- stimulated phosphorylation of c- Met in A549 NSCLC (Non-small Cell Lung Cancer) cells.
- This example demonstrates the ability of anti-c-Met Al optimized clones to block the activation of and therefore the function of c-Met in cancer cells.
- A549 cells grown for 24hr in the wells of a 96- well cell culture cluster were treated with an 8-point, 5-fold serial dilution of the listed antibodies. After incubation for 4 hours, 40 ng/ml HGF (R&D Systems cat# 294-HG-005/CF) was added to the cells. Cells were then incubated for 15 min.
- ADCC Antibody Dependent Cell Cytotoxicity.
- ADCC is triggered when the Fc region of an antibody which is bound to a target cell, interacts with an Fc receptor on the surface of an effector immune cell leading to the killing of the target cell.
- ADCC induced by antic-Met antibodies using a cell based reporter assay (Promega).
- 625 A431 cells were seeded into the inner 320 wells of a white 384-well cell culture plate in 100 ⁇ of media.
- ADCC Assay Buffer RPMI + 4% Low IgG Fetal Bovine Serum
- ADCC Assay Buffer RPMI + 4% Low IgG Fetal Bovine Serum
- a 9-point, 3-fold serial dilution curve of anti-c-Met mABs was made at 3x final concentration in ADCC Assay Buffer. 7 ⁇ of the antibody dilution was added to wells in triplicate distributed across the rows to avoid spatial effects.
- ADCC Effector cells are thawed according to manufacturer's protocol and 7ul added to each well. The plate was incubated for 6hr at 37 °C and then removed to the lab bench to reach room temperature.
- This example illustrates the effects on cell migration of anti-c-Met mAbs, using a modified Boyden Chamber setup utilizing the xCelligence system (ACEA).
- a solution of 50 ng/ml HGF (R&D Systems cat# 294- HG-005/CF) to serve as the chemoattractant was made in Migration Basal Media (MBM; fully supplemented media diluted 1:125 in Serum Free Media, SFM).
- MBM Migration Basal Media
- SFM Serum Free Media
- the upper chamber was then assembled onto the lower chamber and the wells of the upper chamber were filled with 40 ⁇ of SFM. he setup was incubated in the RTCA-DP unit for 1 hr and then a background measurement was taken. Target cells were then lifted non-enzymatically and resuspended in SFM at a concentration of 800,000 cells/ml. Fifty ⁇ of the cell suspension was incubated with 50 ⁇ of 10 ⁇ g/ml anti-c-Met mAbs (40,000 cells and 5 ⁇ g/ml final mAb concentration; in triplicate) for 10 min and then transferred to the wells of the CIM-16 plate. Cells were allowed to settle for 30 min at room temperature in the hood.
- the plate was then place in the RTCA-DP apparatus and readings were taken every 2 min for 24 hrs.
- the cells are drawn to the chemoattractant (HGF), they pass through the pores of the membrane and attach to the underside of the membrane resulting in changes in electrical impedance which is converted to a cell index by the RTCA apparatus.
- 5 ng/ml HGF induced cell migration and the described anti-c-Met mAbs inhibited this migration to varying degrees. Data are shown as the cell index normalized to the untreated control (+/- SD) at 8 hrs after the beginning of the experiment.
- H8-B6 FDTWGQGTLVTVSS SEQ ID NO. 27 DSTLSAWVFGGGTKLTVL SEQ ID NO. 28 QLVLTQSPSVSVAPGQRVTISCSGSNSNIGN
- H8-2A2 FDTWGQGTLVTVSS SEQ ID NO. 29 22 EVQLVQSGAEVKKPGASVKVSCKASGYTFYSYYM H QLVLTQSPSVSVAPGQRVTISCSGSNSNIGN WVRQAPGQGLEWMGWIN PNSGNTGLAPKFQGR NYVSWYHHLPGTAPKLLIYDTNKRPSGIPDR VTMTRNTS 1 STAYM E LSS LRS E DTA VYYC AR RGTTVS FSGSKSGTSATLGITGLQPGDEAHYYCGTW
- H8-2B1 FDTWGQGTLVTVSS SEQ ID NO. 37 DSTLSAWAFGGGTKLTVL SEQ ID NO. 38
- GCE-A16 SEQ ID NO. 47 SEQ ID NO. 48 QVQLVQSGAEVKKPGASVKVSCKASGYTFSGD QSVVTQPPSVSGAPGQRVTISCIGSASNI YMHWVRQAPGQGLEWMGWINPNSGGTNYA GAGHDVHWYQQLPGTAPKLLIYGNSN QKFQGRVTMTRDTSISTAYMELSRLRSDDTAVY RPSGVPDRFSGSKSGTSASLAITGLQAED YCAREPGRDYYYYDGLDVWGQGTTVTVSS EADYYCQSYSSSLSAYVFGTGTKVTVL
- GCE-BR1 SEQ ID NO.59 SEQ ID NO.60
- GCE-A19 ID NO.63 SEQ ID NO.64 QVQLVQSGAEVKKPGASVKVSCKASGFTFSGD QSVVTQPPSVSGAPGQRVTISCLGSSSNI YLHWVRQAPGQGLEWMGWINPNTGGTNYA GAGHDVHWYQQLPGTAPKLLIYGNSNL QKFQGRVTMTRDTSISTAYMELSRLKSDDTAVY PSGVPDRFSGSKSGTSASLAITGLQAEDE YCAREPARDYYYYDGLDVWGQGTTVTVSS ADYYCQSYSSSLSAYVFGTGTKVTVL
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Endocrinology (AREA)
- Neurosurgery (AREA)
- Urology & Nephrology (AREA)
- Neurology (AREA)
- Pain & Pain Management (AREA)
- Reproductive Health (AREA)
- Rheumatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Pulmonology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201380043630.0A CN105050618B (zh) | 2012-06-21 | 2013-06-21 | 与c-Met结合的抗原结合蛋白 |
| JP2015518628A JP6429771B2 (ja) | 2012-06-21 | 2013-06-21 | c−Metに結合する抗原結合タンパク質 |
| EP13806086.8A EP2863946A4 (en) | 2012-06-21 | 2013-06-21 | ANTIGEN-BINDING PROTEINS THAT BIND TO C-MET |
| HK15108908.7A HK1208181A1 (en) | 2012-06-21 | 2013-06-21 | Antigen binding proteins that bind c-met |
| CA2877573A CA2877573A1 (en) | 2012-06-21 | 2013-06-21 | Antigen binding proteins that bind c-met |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261662910P | 2012-06-21 | 2012-06-21 | |
| US61/662,910 | 2012-06-21 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2013192594A2 true WO2013192594A2 (en) | 2013-12-27 |
| WO2013192594A3 WO2013192594A3 (en) | 2014-04-03 |
Family
ID=49769735
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/047190 Ceased WO2013192594A2 (en) | 2012-06-21 | 2013-06-21 | Antigen binding proteins that bind c-met |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US10377827B2 (https=) |
| EP (1) | EP2863946A4 (https=) |
| JP (2) | JP6429771B2 (https=) |
| CN (2) | CN105050618B (https=) |
| CA (1) | CA2877573A1 (https=) |
| HK (1) | HK1208181A1 (https=) |
| WO (1) | WO2013192594A2 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016094455A1 (en) * | 2014-12-08 | 2016-06-16 | Sorrento Therapeutics, Inc. | C-met antibody drug conjugate |
| WO2018129248A1 (en) * | 2017-01-06 | 2018-07-12 | The Regents Of The University Of California | Therapeutic anti-ige antibodies and methods and compositions thereof |
| WO2018148447A1 (en) * | 2017-02-08 | 2018-08-16 | Adimab, Llc | Antibody heavy chain variable domains targeting the nkg2d receptor |
| WO2020099674A3 (en) * | 2018-11-16 | 2020-06-25 | R.G.C.C. Holdings AG | Novel c-met and tmx2 antibodies |
| CN113366022A (zh) * | 2018-11-16 | 2021-09-07 | 纪念斯隆凯特琳癌症中心 | 针对粘蛋白-16的抗体及其使用方法 |
| US11142578B2 (en) | 2016-11-16 | 2021-10-12 | Regeneron Pharmaceuticals, Inc. | Anti-MET antibodies, bispecific antigen binding molecules that bind MET, and methods of use thereof |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11896682B2 (en) | 2019-09-16 | 2024-02-13 | Regeneron Pharmaceuticals, Inc. | Radiolabeled MET binding proteins for immuno-PET imaging and methods of use thereof |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105050618B (zh) | 2012-06-21 | 2018-11-16 | 索伦托治疗有限公司 | 与c-Met结合的抗原结合蛋白 |
| CN110382008A (zh) | 2017-06-06 | 2019-10-25 | 江苏恒瑞医药股份有限公司 | 一种含c-Met抗体药物偶联物的药物组合物及其用途 |
| CN112592408B (zh) * | 2020-07-20 | 2021-08-17 | 北京鼎成肽源生物技术有限公司 | 一种靶向c-Met的单链抗体、嵌合抗原受体、重组载体、CAR-T细胞及应用 |
| EP4259180A4 (en) * | 2020-12-14 | 2024-11-20 | Vanderbilt University | HUMANIZED MONOCLONAL ANTIBODIES DIRECTED AGAINST IGE BINDING TO ALPHA-GAL (GALACTOSE-?-1,3-GALACTOSE) AND THEIR USES |
Citations (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3817827A (en) | 1972-03-30 | 1974-06-18 | Scott Paper Co | Soft absorbent fibrous webs containing elastomeric bonding material and formed by creping and embossing |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0473084A2 (en) | 1990-08-28 | 1992-03-04 | Sumitomo Pharmaceuticals Company, Limited | Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides |
| WO1994001451A2 (en) | 1992-07-13 | 1994-01-20 | Bionebraska, Inc. | Method for modification of recombinant polypeptides |
| US5281698A (en) | 1991-07-23 | 1994-01-25 | Cetus Oncology Corporation | Preparation of an activated polymer ester for protein conjugation |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| US5382657A (en) | 1992-08-26 | 1995-01-17 | Hoffmann-La Roche Inc. | Peg-interferon conjugates |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5686292A (en) | 1995-06-02 | 1997-11-11 | Genentech, Inc. | Hepatocyte growth factor receptor antagonist antibodies and uses thereof |
| US5766897A (en) | 1990-06-21 | 1998-06-16 | Incyte Pharmaceuticals, Inc. | Cysteine-pegylated proteins |
| US5807706A (en) | 1995-03-01 | 1998-09-15 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US6010902A (en) | 1988-04-04 | 2000-01-04 | Bristol-Meyers Squibb Company | Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US20020044921A1 (en) | 2000-09-29 | 2002-04-18 | Seoju Lee | Pegylated interleukin-10 |
| US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
| US6610281B2 (en) | 1993-11-12 | 2003-08-26 | Shearwater Corporation | Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules |
| US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
| WO2012030842A2 (en) | 2010-09-03 | 2012-03-08 | Academia Sinica | Anti-c-met antibody and methods of use thereof |
Family Cites Families (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BRPI0407446A (pt) | 2003-02-13 | 2006-01-31 | Pharmacia Corp | Anticorpos para c-met para o tratamento de cânceres |
| HN2004000285A (es) | 2003-08-04 | 2006-04-27 | Pfizer Prod Inc | ANTICUERPOS DIRIGIDOS A c-MET |
| CA2575402A1 (en) * | 2004-08-05 | 2006-02-09 | Genentech, Inc. | Humanized anti-cmet antagonists |
| UA97096C2 (ru) * | 2005-08-31 | 2012-01-10 | Емджен Інк. | Выделенное антитело, которое специфически связывает рецептор-2 trail (tr-2) |
| PE20071101A1 (es) | 2005-08-31 | 2007-12-21 | Amgen Inc | Polipeptidos y anticuerpos |
| ES2368864T3 (es) * | 2006-02-06 | 2011-11-23 | Metheresis Translational Research Sa | Anticuerpos monoclonales anti-met, sus fragmentos y vectores para el tratamiento de tumores y productos correspondientes. |
| US8101727B2 (en) * | 2006-03-30 | 2012-01-24 | Novartis Ag | Compositions and methods of use for antibodies of c-Met |
| JP5382692B2 (ja) | 2006-07-10 | 2014-01-08 | 学校法人藤田学園 | 抗体の分類法、抗原の同定法、抗体又は抗体セットの取得法、抗体パネルの作成法、並びに抗体又は抗体セット及びその用途 |
| EP2014681A1 (en) | 2007-07-12 | 2009-01-14 | Pierre Fabre Medicament | Novel antibodies inhibiting c-met dimerization, and uses thereof |
| PA8849001A1 (es) * | 2008-11-21 | 2010-06-28 | Lilly Co Eli | Anticuerpos de c-met |
| AR074439A1 (es) | 2008-12-02 | 2011-01-19 | Pf Medicament | Anticuerpo anti-cmet (receptor c-met) |
| US8545839B2 (en) * | 2008-12-02 | 2013-10-01 | Pierre Fabre Medicament | Anti-c-Met antibody |
| EP2287197A1 (en) * | 2009-08-21 | 2011-02-23 | Pierre Fabre Medicament | Anti-cMET antibody and its use for the detection and the diagnosis of cancer |
| PT3904391T (pt) * | 2010-03-10 | 2024-10-14 | Genmab As | Anticorpos monoclonais contra c-met |
| KR101865223B1 (ko) * | 2011-10-05 | 2018-06-08 | 삼성전자주식회사 | 항 c-Met 인간화 항체 및 그의 용도 |
| CN105050618B (zh) | 2012-06-21 | 2018-11-16 | 索伦托治疗有限公司 | 与c-Met结合的抗原结合蛋白 |
| WO2013192596A2 (en) * | 2012-06-22 | 2013-12-27 | Sorrento Therapeutics Inc. | Antigen binding proteins that bind ccr2 |
-
2013
- 2013-06-21 CN CN201380043630.0A patent/CN105050618B/zh not_active Expired - Fee Related
- 2013-06-21 WO PCT/US2013/047190 patent/WO2013192594A2/en not_active Ceased
- 2013-06-21 JP JP2015518628A patent/JP6429771B2/ja not_active Expired - Fee Related
- 2013-06-21 HK HK15108908.7A patent/HK1208181A1/xx unknown
- 2013-06-21 CA CA2877573A patent/CA2877573A1/en not_active Abandoned
- 2013-06-21 US US13/924,492 patent/US10377827B2/en active Active
- 2013-06-21 CN CN201811232378.9A patent/CN109503714A/zh active Pending
- 2013-06-21 EP EP13806086.8A patent/EP2863946A4/en not_active Withdrawn
-
2018
- 2018-07-06 JP JP2018128712A patent/JP2018184421A/ja not_active Withdrawn
-
2019
- 2019-06-25 US US16/451,511 patent/US11155628B2/en not_active Expired - Fee Related
-
2021
- 2021-09-22 US US17/482,140 patent/US20220002422A1/en not_active Abandoned
Patent Citations (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3817827A (en) | 1972-03-30 | 1974-06-18 | Scott Paper Co | Soft absorbent fibrous webs containing elastomeric bonding material and formed by creping and embossing |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US6010902A (en) | 1988-04-04 | 2000-01-04 | Bristol-Meyers Squibb Company | Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity |
| US5766897A (en) | 1990-06-21 | 1998-06-16 | Incyte Pharmaceuticals, Inc. | Cysteine-pegylated proteins |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| EP0473084A2 (en) | 1990-08-28 | 1992-03-04 | Sumitomo Pharmaceuticals Company, Limited | Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5281698A (en) | 1991-07-23 | 1994-01-25 | Cetus Oncology Corporation | Preparation of an activated polymer ester for protein conjugation |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| WO1994001451A2 (en) | 1992-07-13 | 1994-01-20 | Bionebraska, Inc. | Method for modification of recombinant polypeptides |
| US5382657A (en) | 1992-08-26 | 1995-01-17 | Hoffmann-La Roche Inc. | Peg-interferon conjugates |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| US6610281B2 (en) | 1993-11-12 | 2003-08-26 | Shearwater Corporation | Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| US5807706A (en) | 1995-03-01 | 1998-09-15 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5686292A (en) | 1995-06-02 | 1997-11-11 | Genentech, Inc. | Hepatocyte growth factor receptor antagonist antibodies and uses thereof |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| US20040038291A2 (en) | 1997-10-20 | 2004-02-26 | Domantis Limited | Method to screen phage display libraries with different ligands |
| US6846634B1 (en) | 1997-10-20 | 2005-01-25 | Domantis Limited | Method to screen phage display libraries with different ligands |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
| US20020044921A1 (en) | 2000-09-29 | 2002-04-18 | Seoju Lee | Pegylated interleukin-10 |
| US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
| US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
| WO2012030842A2 (en) | 2010-09-03 | 2012-03-08 | Academia Sinica | Anti-c-met antibody and methods of use thereof |
Non-Patent Citations (82)
| Title |
|---|
| "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| "Fundamental Immunology Ch. 7", 1989, RAVEN PRESS |
| "Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS |
| BARON ET AL., NUCLEIC ACIDS RES., vol. 23, 1995, pages 3605 - 06 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 |
| BLADT ET AL., NATURE, vol. 376, 1995, pages 768 - 771 |
| BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407 |
| BOIX ET AL., HEPATOLOGY, vol. 19, 1994, pages 88 - 91 |
| BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BUSSOLINO ET AL., J. CELL BIOL., vol. 119, 1992, pages 629 - 641 |
| CAZALIS ET AL., BIOCONJUG. CHEM., vol. 15, no. 5, 2004, pages 1005 - 1009 |
| CHAMOW ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 133 |
| DANILKOVITCH-MIAGKOVA; ZBAR, J. CLIN. INVEST., vol. 109, no. 7, 2002, pages 863 - 867 |
| DE GRAAF ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 379 - 87 |
| DI RENZO ET AL., CLIN. CANCER RES., vol. 1, 1995, pages 147 - 154 |
| FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 78 |
| FURGE ET AL., ONCOGENE, vol. 19, 2000, pages 5582 - 5589 |
| GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 |
| GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175 |
| GOEDDEL: "Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS, article "Gene Expression Technology" |
| GOODSON ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 343 |
| HAMANOUE ET AL., J. NEUROSCI. RES., vol. 43, 1996, pages 554 - 564 |
| HARTMANN ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 21936 - 21939 |
| HIMANEN ET AL., NATURE, vol. 414, no. 6866, 2001, pages 933 - 8 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48 |
| HONEGGER; PLUCKTHUN, J. MOL. BIOL., vol. 309, no. 3, 2001, pages 657 - 670 |
| HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83 |
| JEFFERS ET AL., MOL. CELL BIOL., vol. 16, 1996, pages 1115 - 1125 |
| JEFFERS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 11445 - 11450 |
| JIN ET AL., CANCER, vol. 79, 1997, pages 749 - 760 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest" |
| KONG-BELTRAN ET AL., CANCER CELL, vol. 6, 2004, pages 61 - 73 |
| KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129 |
| KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108 |
| KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 |
| KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40 |
| KUNIYASU ET AL., INT. J. CANCER, vol. 55, 1993, pages 72 - 75 |
| LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759 |
| LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 16 |
| LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 29, 2005, pages 185 - 203 |
| LIU ET AL., ONCOGENE, vol. 7, 1992, pages 181 - 185 |
| LORENZATO ET AL., CANCER RES., vol. 62, 2002, pages 7025 - 7030 |
| LUCKOW; SUMMERS, BIO/TECHNOLOGY, vol. 6, 1988, pages 47 |
| MAULIK ET AL., CYTOKINE & GROWTH FACTOR REVIEWS, vol. 13, 2002, pages 41 - 59 |
| MAULIK ET AL., CYTOKINE GROWTH FACTOR REV., vol. 13, 2002, pages 41 - 59 |
| MCMAHAN ET AL., EMBO J., vol. 10, 1991, pages 2821 |
| MEINERS ET AL., ONCOGENE, vol. 16, 1998, pages 9 - 20 |
| MILSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 |
| MONFARDINI ET AL., BIOCONJUGATE CHEM., vol. 6, 1995, pages 62 - 69 |
| MORELLO ET AL., J. CELL PHYSIOL., vol. 189, 2001, pages 285 - 290 |
| MORPURGO ET AL., BIOCON. CHEM., vol. 7, 1996, pages 363 - 368 |
| NATALI ET AL., INT. J. CANCER, vol. 69, 1996, pages 212 - 217 |
| NUSRAT ET AL., J. CLIN. INVEST., vol. 93, 1994, pages 2056 - 2065 |
| OLIVERO ET AL., BR. J. CANCER, vol. 74, 1996, pages 1862 - 1868 |
| OLIVERO ET AL., INT. J. CANCER, vol. 82, 1999, pages 640 - 643 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 23 |
| PONZETTO ET AL., CELL, vol. 87, 1996, pages 531 - 542 |
| POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER |
| PROC. NATL. ACAD. SCI. USA, 2003 |
| RAJU ET AL., BIOCHEMISTRY, vol. 40, no. 30, 2001, pages 8868 - 76 |
| RASMUSSEN ET AL., CYTOTECHNOLOGY, vol. 28, 1998, pages 31 |
| ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654 |
| ROYAL; PARK, J. BIOL. CHEM., vol. 270, 1995, pages 27780 - 27787 |
| SANDLER; KARO: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161 |
| SARTORE ET AL., APPL. BIOCHEM. BIOTECHNOL., vol. 27, 1991, pages 45 |
| SCHMIDT ET AL., NAT. GENET., vol. 16, 1997, pages 68 - 73 |
| SCHMIDT ET AL., ONCOGENE, vol. 18, 1999, pages 2343 - 2350 |
| SCHMIDT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1995, pages 11445 - 11450 |
| SUZUKI ET AL., HEPATOLOGY, vol. 20, 1994, pages 1231 - 1236 |
| TEMPEST ET AL., BR. J. CANCER, vol. 58, 1988, pages 3 - 7 |
| TRUSOLINO; COMOGLIO, NATURE REV., vol. 2, 2002, pages 289 - 300 |
| UEHARA ET AL., NATURE, vol. 373, 1995, pages 702 - 705 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 20 |
| VAN VACTOR; LORENZ, CURR. BIOL., vol. 9, 1999, pages R201 - 204 |
| WARD ET AL., NATURE, vol. 334, 1989, pages 544 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WIEDER ET AL., J. BIOI. CHEM., vol. 254, 1979, pages 12579 |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016094455A1 (en) * | 2014-12-08 | 2016-06-16 | Sorrento Therapeutics, Inc. | C-met antibody drug conjugate |
| US12545735B2 (en) | 2016-11-16 | 2026-02-10 | Regeneron Pharmaceuticals, Inc. | Anti-met antibodies, bispecific antigen binding molecules that bind met, and methods of use thereof |
| US11142578B2 (en) | 2016-11-16 | 2021-10-12 | Regeneron Pharmaceuticals, Inc. | Anti-MET antibodies, bispecific antigen binding molecules that bind MET, and methods of use thereof |
| WO2018129248A1 (en) * | 2017-01-06 | 2018-07-12 | The Regents Of The University Of California | Therapeutic anti-ige antibodies and methods and compositions thereof |
| US11518818B2 (en) | 2017-01-06 | 2022-12-06 | The Regents Of The University Of California | Therapeutic anti-IgE antibodies and methods and compositions thereof |
| WO2018148447A1 (en) * | 2017-02-08 | 2018-08-16 | Adimab, Llc | Antibody heavy chain variable domains targeting the nkg2d receptor |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US12129300B2 (en) | 2018-02-08 | 2024-10-29 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US11939384B1 (en) | 2018-02-08 | 2024-03-26 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| CN113366022A (zh) * | 2018-11-16 | 2021-09-07 | 纪念斯隆凯特琳癌症中心 | 针对粘蛋白-16的抗体及其使用方法 |
| WO2020099674A3 (en) * | 2018-11-16 | 2020-06-25 | R.G.C.C. Holdings AG | Novel c-met and tmx2 antibodies |
| US12600786B2 (en) | 2018-11-16 | 2026-04-14 | R.G.C.C. Holdings AG | C-met and TMX2 antibodies |
| US11896682B2 (en) | 2019-09-16 | 2024-02-13 | Regeneron Pharmaceuticals, Inc. | Radiolabeled MET binding proteins for immuno-PET imaging and methods of use thereof |
| US12605473B2 (en) | 2019-09-16 | 2026-04-21 | Regeneron Pharmaceuticals, Inc. | Methods for making radiolabeled anti-MET binding proteins |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
Also Published As
| Publication number | Publication date |
|---|---|
| JP6429771B2 (ja) | 2018-11-28 |
| WO2013192594A3 (en) | 2014-04-03 |
| JP2015521627A (ja) | 2015-07-30 |
| CN105050618A (zh) | 2015-11-11 |
| EP2863946A4 (en) | 2016-04-13 |
| US20220002422A1 (en) | 2022-01-06 |
| US10377827B2 (en) | 2019-08-13 |
| US20170283501A1 (en) | 2017-10-05 |
| JP2018184421A (ja) | 2018-11-22 |
| US11155628B2 (en) | 2021-10-26 |
| HK1208181A1 (en) | 2016-02-26 |
| CN109503714A (zh) | 2019-03-22 |
| US20190359719A1 (en) | 2019-11-28 |
| CN105050618B (zh) | 2018-11-16 |
| CA2877573A1 (en) | 2013-12-27 |
| EP2863946A2 (en) | 2015-04-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11155628B2 (en) | Antigen binding proteins that bind c-Met | |
| AU2022204504B2 (en) | Antigen binding proteins that bind PD-L1 | |
| US9676853B2 (en) | Antigen binding proteins that bind PD-1 | |
| US10717779B2 (en) | Methods for blocking an interaction between notch-1 and delta-like 4 (DLL-4) by administering a DDL-4 antibody | |
| US9346890B2 (en) | Antigen binding proteins that bind ErbB3 | |
| US9944707B2 (en) | Antibodies that bind epidermal growth factor receptor (EGFR) | |
| US10519245B2 (en) | Antibodies which bind insulin-like growth factor receptor-1 (IGF1R) and methods of use thereof to treat cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201380043630.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13806086 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013806086 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2877573 Country of ref document: CA Ref document number: 2015518628 Country of ref document: JP Kind code of ref document: A |