WO2013185115A1 - Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use - Google Patents

Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use Download PDF

Info

Publication number
WO2013185115A1
WO2013185115A1 PCT/US2013/044843 US2013044843W WO2013185115A1 WO 2013185115 A1 WO2013185115 A1 WO 2013185115A1 US 2013044843 W US2013044843 W US 2013044843W WO 2013185115 A1 WO2013185115 A1 WO 2013185115A1
Authority
WO
WIPO (PCT)
Prior art keywords
substituted
alkylene
group
antibody
amino acid
Prior art date
Application number
PCT/US2013/044843
Other languages
French (fr)
Inventor
Christopher D. Thanos
Leslie Mcevoy
Gang Yin
Kalyani Penta
Ramesh Baliga
Sunil Bajad
Sonia Pollitt
Chris Murray
Alex STEINER
Avinash GILL
Original Assignee
Sutro Biopharma, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP19154161.4A priority Critical patent/EP3505534A1/en
Priority to ES13730764T priority patent/ES2718478T3/en
Priority to DK13730764.1T priority patent/DK2859017T3/en
Priority to BR112014030278A priority patent/BR112014030278A2/en
Priority to CN201380041954.0A priority patent/CN104583235B/en
Priority to SG11201408161RA priority patent/SG11201408161RA/en
Priority to JP2015516266A priority patent/JP6498600B2/en
Priority to KR1020157000097A priority patent/KR102172897B1/en
Application filed by Sutro Biopharma, Inc. filed Critical Sutro Biopharma, Inc.
Priority to AU2013270684A priority patent/AU2013270684B2/en
Priority to SI201331372T priority patent/SI2859017T1/en
Priority to PL13730764T priority patent/PL2859017T3/en
Priority to EP13730764.1A priority patent/EP2859017B1/en
Priority to CA2875989A priority patent/CA2875989A1/en
Publication of WO2013185115A1 publication Critical patent/WO2013185115A1/en
Priority to IL236111A priority patent/IL236111B/en
Priority to HK15103823.0A priority patent/HK1203518A1/en
Priority to HRP20190475TT priority patent/HRP20190475T1/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817—Toxins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • antibodies comprising non-natural amino acid residues at site-specific positions
  • compositions comprising the antibodies, methods of their production and methods of their use.
  • Antibodies are biological molecules with remarkable affinity for their target antigens. Nature provides antibodies as part of a defense system in certain vertebrates for the elimination or destruction of foreign proteins, cells and organisms. If a certain vertebrate is presented with a foreign protein on, for example, an infected cell or an infectious bacterium, an antibody can bind its target foreign protein to direct the foreign entity to its elimination or destruction.
  • the selective affinity of antibodies can be used by man to target nearly any antigen desired.
  • the antigen can be a protein on an infected cell or infectious
  • microorganism can also be, for example, a protein on a cancer cell, a protein on a cell of a target tissue, a protein in the bloodstream, a protein on an inflamed or inflammatory cell or any other protein whose selective binding is useful.
  • Antibodies have thus found use in therapy for conditions such as cancer, inflammatory diseases, autoimmune diseases and transplant rejection.
  • the antibody can signal the immune system to destroy or eliminate a diseased cell, or an engineered antibody can carry a molecular payload to destroy the target.
  • therapeutic antibodies are linked to molecular shields to increase their lifetime within an organism.
  • Antibodies have also found use as diagnostics. These antibodies can carry a label to indicate the presence of a target antigen on a cell or in a tissue. These labels are typically linked to the antibodies by covalent bonds.
  • antibodies modified at one or more site-specific positions with one or more non-natural amino acid residues. These site-specific positions are optimal for substitution of a natural amino acid residue with a non-natural amino acid residue. In certain embodiments, substitution at these site-specific positions yields antibodies that are uniform in substitution, i.e. that are substantially modified in the selected position. In certain
  • an antibody substituted at one or more of these site-specific positions has advantageous production yield, advantageous solubility, advantageous binding and/or advantageous activity.
  • the properties of these antibodies are described in detail in the sections below.
  • antibodies comprising a polypeptide chain having at least one non-natural amino acid residue at a position in the polypeptide chain that is optimally substitutable.
  • the antibody can be any polypeptide or multimeric polypeptide recognized as an antibody to those of skill in the art.
  • the polypeptide chain can be any polypeptide chain of the antibody, including any heavy chain and any light chain.
  • the position in the polypeptide chain that is optimally substitutable is any position in the polypeptide chain that can provide a substitution with optimal yield, uniformity, solubility, binding and/or activity.
  • the sections below describe in detail the optimally substitutable positions of such polypeptide chains. Also described below are useful antibodies useful non- natural amino acids.
  • compositions comprising said antibodies.
  • such compositions can have high uniformity because of the uniformity of the substitution of the antibodies provided herein.
  • the compositions comprise a substantial amount of the antibody when measured by total weight of protein or when measured by total weight of antibody.
  • the compositions comprise at least 80 % of the antibody, at least 85 % of the antibody, at least 90 % of the antibody or at least 95 % of the antibody by weight.
  • methods of making the antibodies The antibodies can be made by any technique apparent to those of skill in the art for incorporating non-natural amino acids into site-specific positions of antibody chains. In certain
  • the antibodies are made by solid phase synthesis, semi-synthesis, in vivo translation, in vitro translation or cell-free translation.
  • Antibodies directed to a therapeutic target can incorporate one or more site-specific non- natural amino acids according to the description herein. These antibodies can be used for treating or preventing a disease or condition associated with the therapeutic target.
  • a site-specific non-natural amino acid can be used to link the antibody to a therapeutic payload to facilitate efficacy.
  • exemplary antibodies, therapeutic targets and diseases or conditions are described herein.
  • Antibodies directed to a detection target can incorporate one or more site-specific non-natural amino acids according to the description herein. These antibodies can be used with a label to signal binding to the detection target.
  • a site-specific non-natural amino acid can be used to link the antibody to a label to facilitate detection.
  • Antibodies can be modified with a non-natural amino acid as described herein to facilitate linking to a molecular entity that can modify the stability of the antibody.
  • a site-specific non-natural amino acid can facilitate linking to a molecular shield, for example polyethylene glycol, to increase the stability of an antibody.
  • exemplary non-natural amino acids and linking moieties are described herein.
  • FIG. 1 provides the structure of exemplary cytotoxic reagent DBCO-MMAF.
  • FIG. 2 provides a single peak hydrophobic interaction chromatography (HIC) assay profile.
  • FIG. 3 provides a not-well-resolved (NWR) HIC assay profile.
  • FIG. 4 provides a well-resolved (WR) HIC assay profile.
  • FIGS. 5A and 5B depict exemplary HIC traces of two variants (HC Tl 10 and HC SI 12), showing peaks corresponding to unconjugated, partially conjugated and fully conjugated IgGs.
  • FIGS. 6A-6E depict exemplary embodiments showing site-specific conjugation.
  • FIGS. 7 A and 7B depict suppression efficiency and soluble yield comparison data of antibodies comprising different unnatural amino acids
  • FIG. 8 depicts cell killing of CD-30 positive cell lines by exemplary brentuximab antibody-drug conjugates.
  • FIG. 9 provides experimental results demonstrating that exemplary brentuximab antibody-drug conjugates do not kill cells that do not express CD-30.
  • FIG. 10 depicts binding to CD-30 positive cell lines by exemplary brentuximab (ADCETRIS®) antibody-drug conjugates.
  • FIGS. 11A, 1 IB, 11C, and 1 ID provide the structure of exemplary cytotoxic reagents DBCO-MMAF 2, DBCO-DM4, DBCO-DM4 2, and DBCO-MMAE, respectively.
  • FIG. 12 provides a graphical representation of the pharmacokinetics of an exemplary scFv-Fc site-specific antibody-drug conjugate.
  • FIGS. 13A and 13B depict a graphical representation of the in vivo effectiveness of exemplary site-specific antibody-drug conjugates to retard tumor growth and/or to regress tumor size in an animal model.
  • antibodies having non-natural amino acids at one or more site-specific positions are provided herein.
  • substantially pure with respect to a composition comprising an antibody refers to a composition that includes at least 80, 85, 90 or 95 % by weight or, in certain embodiments, 95, 98, 99 or 100 % by weight, e.g. dry weight, of the antibody relative to the remaining portion of the composition.
  • the weight percentage can be relative to the total weight of protein in the composition or relative to the total weight of antibodies in the composition. Purity can be determined by techniques apparent to those of skill in the art, for instance SDS-PAGE.
  • isolated refers to an antibody that is substantially or essentially free of components that normally accompany or interact with the antibody as found in its naturally occurring environment or in its production environment, or both. Isolated antibody preparations have less than about 30%, less than about 25%, less than about 20%, less than about 15%), less than about 10%>, less than about 5%, less than about 4%, less than about 3%, less than about 2% or less than about 1% of contaminating protein by weight, e.g. dry weight.
  • antibody refers to any macromolecule that would be recognized as an antibody by those of skill in the art. Antibodies share common properties including binding and at least one polypeptide chain that is substantially identical to a polypeptide chain that can be encoded by any of the immunoglobulin genes recognized by those of skill in the art.
  • the immunoglobulin genes include, but are not limited to, the ⁇ , ⁇ , ⁇ , ⁇ (IgGl, IgG2, IgG3, and IgG4), ⁇ , ⁇ and ⁇ constant region genes, as well as the immunoglobulin variable region genes.
  • the term includes full-length antibodies and antibody fragments recognized by those of skill in the art, and variants thereof.
  • the term further includes glycosylated and aglycosylated antibodies.
  • antibody fragment refers to any form of an antibody other than the full-length form.
  • Antibody fragments herein include antibodies that are smaller components that exist within full-length antibodies, and antibodies that have been engineered.
  • Antibody fragments include but are not limited to Fv, Fc, Fab, and (Fab') 2 , single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1, CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like (Maynard & Georgiou, 2000, Annu. Rev. Biomed. Eng. 2:339-76; Hudson, 1998, Curr. Opin. Biotechnol. 9:395-402).
  • immunoglobulin refers to a protein consisting of one or more polypeptides substantially encoded by one of the immunoglobulin genes, or a protein substantially identical thereto in amino acid sequence. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to V H , Cyl, Cy2, Cy3, V L , and C L .
  • immunoglobulin domain refers to a protein domain consisting of a polypeptide substantially encoded by an immunoglobulin gene. Ig domains include but are not limited to V H , Cyl, Cy2, Cy3, V L , and C L .
  • variable region of an antibody refers to a polypeptide or polypeptides composed of the V H immunoglobulin domain, the V L immunoglobulin domains, or the V H and V L immunoglobulin domains. Variable region may refer to this or these polypeptides in isolation, as an Fv fragment, as a scFv fragment, as this region in the context of a larger antibody fragment, or as this region in the context of a full-length antibody or an alternative, non-antibody scaffold molecule.
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are responsible for the binding specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed through the variable domains of antibodies. It is concentrated in three segments called Complementarity Determining Regions (CDRs) both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework regions (FR).
  • CDRs Complementarity Determining Regions
  • FR framework regions
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three or four CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
  • the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
  • the constant domains are not typically involved directly in binding an antibody to an antigen, but exhibit various effector functions.
  • antibodies or immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGl, IgG2, IgG3, and IgG4; IgAl and IgA2.
  • the heavy chain constant regions that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ and ⁇ , respectively.
  • human immunoglobulin classes only human IgGl, IgG2, IgG3 and IgM are known to activate complement.
  • variant protein sequence refers to a protein sequence that has one or more residues that differ in amino acid identity from another similar protein sequence.
  • Said similar protein sequence may be the natural wild type protein sequence, or another variant of the wild type sequence.
  • Variants include proteins that have one or more amino acid insertions, deletions or substitutions.
  • Variants also include proteins that have one or more post-translationally modified amino acids.
  • parent antibody refers to an antibody known to those of skill in the art that is modified according to the description provided herein.
  • the modification can be physical, i.e., chemically or biochemically replacing or modifying one or more amino acids of the parent antibody to yield an antibody within the scope of the present description.
  • the modification can also be conceptual, i.e., using the sequence of one or more polypeptide chains of the parent antibody to design an antibody comprising one or more site-specific non- natural amino acids according to the present description.
  • Parent antibodies can be naturally occurring antibodies or antibodies designed or developed in a laboratory. Parent antibodies can also be artificial or engineered antibodies, e.g., chimeric or humanized antibodies.
  • conservatively modified variant refers to an antibody that differs from a related antibody by conservative substitutions in amino acid sequence.
  • conservative substitutions One of skill will recognize that individual substitutions, deletions or additions to a peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
  • Conservative substitution tables providing functionally similar amino acids are well known in the art.
  • conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
  • the following eight groups each contain amino acids that are conservative substitutions for one another:
  • sequences or subsequences refer to two or more sequences or subsequences that are the same. Sequences are “substantially identical” if they have a percentage of amino acid residues or nucleotides that are the same ⁇ i.e., about 60% identity, optionally about 65%, about 70%>, about 75%, about 80%), about 85%), about 90%>, or about 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
  • the identity can exist over a region that is at least about 50 amino acids or nucleotides in length, or over a region that is 75-100 amino acids or nucleotides in length, or, where not specified, across the entire sequence or a polypeptide. In the case of antibodies, identity can be measured outside the variable CDRs.
  • Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l. Acad. Sci.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLAST algorithm is typically performed with the "low complexity" filter turned off.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as imino acids such as proline, amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally encoded amino acids are the proteinogenic amino acids known to those of skill in the art. They include the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and the less common pyrrolysine and selenocysteine.
  • Naturally encoded amino acids include post-translational variants of the 22 naturally occurring amino acids such as prenylated amino acids, isoprenylated amino acids, myrisoylated amino acids, palmitoylated amino acids, N- linked glycosylated amino acids, O-linked glycosylated amino acids, phosphorylated amino acids and acylated amino acids.
  • non-natural amino acid refers to an amino acid that is not a proteinogenic amino acid, or a post-translationally modified variant thereof. In particular, the term refers to an amino acid that is not one of the 20 common amino acids or pyrrolysine or selenocysteine, or post-translationally modified variants thereof.
  • a "functional Releasing Factor 1 (RFl) protein” refers to RFl that retains activity equal to or substantially similar to wild-type or unmodified RFl protein.
  • Functional RFl activity can be tested, for example, by measuring the growth rate of bacteria expressing the modified RFl protein, and comparing the growth rate to bacteria expressing wild-type or unmodified RFl .
  • Functional RFl activity can also be tested, for example, by the ability of the modified RFl protein to reduce orthogonal tRNA incorporation of a nnAA at a specified position in an mRNA encoding a target protein, thereby increasing the amount of premature chain termination (i.e., increasing the amount of truncated protein).
  • An "attenuated Releasing Factor 1 (RFl) protein” refers to a modified RFl that retains reduced activity relative to wild-type or unmodified RFl protein.
  • RFl activity can be tested, for example, by measuring the growth rate of bacteria expressing the modified RFl protein, and comparing the growth rate to bacteria expressing wild-type or unmodified RFl .
  • RFl activity can also be tested, for example, by the ability of the modified RFl protein to reduce orthogonal tRNA incorporation of a nnAA at a specified position in an mRNA encoding a target protein, thereby increasing the amount of premature chain termination (i.e., increasing the amount of truncated protein).
  • the attenuated RFl protein comprises transcriptional modifications; for example, the expression level of the RFl protein (wild type or modified) can be reduced to achieve attenuation. The reduction can also achieved by using RNAi technologies.
  • the attenuated RFl protein comprises translational modifications; for example, the amount of the synthesized RFl protein (wild type or modified) can be reduced to achieve attenuation, e.g., by increasing the rate at which the protein is digested by protease via insertion of protease-specific sequence into the RFl sequence.
  • antibodies comprising one or more non-natural amino acid residues at site-specific positions in the amino acid sequence of at least one polypeptide chain.
  • the antibody can share high sequence identity with any antibody recognized by those of skill in the art, i.e. a parent antibody.
  • the amino acid sequence of the antibody is identical to the amino acid sequence of the parent antibody, other than the non-natural amino acids at site-specific position.
  • the antibody provided herein can have one or more insertions, deletions or mutations relative to the parent antibody in addition to the one or more non-natural amino acids at the site-specific positions.
  • the antibody provided herein can have a unique primary sequence, so long as it would be recognized as an antibody by those of skill in the art.
  • the antibody is typically a protein comprising multiple polypeptide chains.
  • the antibody is a heterotetramer comprising two identical light (L) chains and two identical heavy (H) chains.
  • Each light chain can be linked to a heavy chain by one covalent disulfide bond.
  • Each heavy chain can be linked to the other heavy chain by one or more covalent disulfide bonds.
  • Each heavy chain and each light chain can also have one or more intrachain disulfide bonds.
  • each heavy chain typically comprises a variable domain (V H ) followed by a number of constant domains.
  • Each light chain typically comprises a variable domain at one end (V L ) and a constant domain.
  • antibodies typically have selective affinity for their target molecules, i.e. antigens.
  • the antibodies provided herein can have any antibody form known to those of skill in the art. They can be full-length, or fragments. Exemplary full length antibodies include IgA, IgAl, IgA2, IgD, IgE, IgG, IgGl, IgG2, IgG3, IgG4, IgM, etc. Exemplary fragments include Fv, Fab, Fc, sFv, etc.
  • the antibodies provided herein comprise at least one non-natural amino acid.
  • the non-natural amino acid can be any non-natural amino acid known to those of skill in the art. Exemplary non-natural amino acids are described in the sections below.
  • the non-natural amino acids are positioned at select locations in a polypeptide chain of the antibody. These locations were identified as providing optimum sites for substitution with the non-natural amino acids. Each site is capable of bearing a non-natural amino acid with optimum structure, function and/or methods for producing the antibody.
  • a site-specific position for substitution provides an antibody that is stable. Stability can be measured by any technique apparent to those of skill in the art.
  • a site-specific position for substitution provides an antibody that is has optimal functional properties. For instance, the antibody can show little or no loss of binding affinity for its target antigen compared to an antibody without the site- specific non-natural amino acid. In certain embodiments, the antibody can show enhanced binding compared to an antibody without the site-specific non-natural amino acid.
  • a site-specific position for substitution provides an antibody that can be made advantageously.
  • the antibody shows advantageous properties in its methods of synthesis, discussed below.
  • the antibody can show little or no loss in yield in production compared to an antibody without the site-specific non-natural amino acid.
  • the antibody can show enhanced yield in production compared to an antibody without the site- specific non-natural amino acid.
  • the antibody can show little or no loss of tRNA suppression, described below, compared to an antibody without the site-specific non-natural amino acid.
  • the antibody can show enhanced tRNA suppression, described below, in production compared to an antibody without the site- specific non-natural amino acid.
  • a site-specific position for substitution provides an antibody that has advantageous solubility.
  • the antibody can show little or no loss in solubility compared to an antibody without the site-specific non-natural amino acid.
  • the antibody can show enhanced solubility compared to an antibody without the site-specific non-natural amino acid.
  • a site-specific position for substitution provides an antibody that has advantageous expression.
  • the antibody can show little or no loss in expression compared to an antibody without the site-specific non-natural amino acid.
  • the antibody can show enhanced expression compared to an antibody without the site-specific non-natural amino acid.
  • a site-specific position for substitution provides an antibody that has advantageous folding.
  • the antibody can show little or no loss in proper folding compared to an antibody without the site-specific non-natural amino acid.
  • the antibody can show enhanced folding compared to an antibody without the site-specific non-natural amino acid.
  • a site-specific position for substitution provides an antibody that is capable of advantageous conjugation. As described below, several non- natural amino acids have side chains or functional groups that facilitate conjugation of the antibody to a second agent, either directly or via a linker.
  • the antibody can show enhanced conjugation efficiency compared to an antibody without the same or other non-natural amino acids at other positions.
  • the antibody can show enhanced conjugation yield compared to an antibody without the same or other non-natural amino acids at other positions. In certain embodiments, the antibody can show enhanced conjugation specificity compared to an antibody without the same or other non-natural amino acids at other positions.
  • the one or more non-natural amino acids are located at selected site-specific positions in at least one polypeptide chain of the antibody.
  • the polypeptide chain can be any polypeptide chain of the antibody without limitation, including either light chain or either heavy chain.
  • the site-specific position can be in any domain of the antibody, including any variable domain and any constant domain.
  • the antibodies provided herein comprise one non-natural amino acid at a site-specific position. In certain embodiments, the antibodies provided herein comprise two non-natural amino acids at site-specific positions. In certain embodiments, the antibodies provided herein comprise three non-natural amino acids at site-specific positions. In certain embodiments, the antibodies provided herein comprise more than three non-natural amino acids at site-specific positions.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H33
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H074, H084, H118, H119, H132, H134, H135, H136, H137, H139, H160, H162, H165, H172, H191, H194, H239, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301 , H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H359, H375, H386, H389, H39
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H084, HI 18, HI 19, H132, H134, H136, H137, H160, H162, H172, H239, H241, H267, H269, H270, H271, H272, H282, H286, H292, H293, H296, H298, H329, H330, H334, H335, H340, H355, H359, H386, H389, H404, H420, H421, H438, and H342.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H084, HI 18, H132, H136, H239, H293, H334, H355, H359, and H389.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H023, H074, H119, H134, H135, H137, H139, H160, H162, H165, H172, H191, H194, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H335, H337, H339, H342, H344, H355, H375, H386, H392, H398, H404, H420, H421, H340 and H438.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H042, H065, H138, H155, H174, H176, H177, H219, H238, H243, H262, H264, H265, H278, H342, H356, H358, H360, H383, H384 H404, and H436.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues corresponding to H292-H301, H303, and H305.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H023, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H139, H160, H162, H165, H172, H191, H194, H239, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H359, H375, H386, H389, H39
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H084, HI 18, H132, H136, H239, H293, H334, H342, H355, H359, H389 and H404.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues corresponding to H292-H301, H303, and H305.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H023, H074, H119, H134, H135, H137, H139, H160, H162, H165, H172, H191, H194, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H335, H337, H339, H342, H344, H355, H375, H386, H392, H398, H420, H421, H340, H404, and H438.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H042, H065, H138, H155, H174, H176, H177, H219, H238, H243, H262, H264, H265, H278, H342, H356, H358, H360, H383, H384, H404, and H436.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H005, H023, H084, HI 18, HI 19, H132, H134, H136, H137, H160, H162, H172, H239, H241, H267, H269, H270, H271, H272, H282, H286, H292, H293, H296, H298, H329, H330, H334, H335, H340, H355, H359, H386, H389, H404, H420, H421, H438, and H342, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, LI 12, LI 14, L144, L153, L156, L157, L168, L184, L202, L203, and L206, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, LI 12, LI 14, L144, L153, L156, L168, L184, L202, and L203, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, L144, L153, L156, L184, L202, and L203, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L049, L056, L057, L060, L067, L109, L153, L202, and L203, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, H119, H135, H136, H137, H160, H161, H162, H164, H195, H197, H219, H282, H289, H296, H330, H335, H361, H400, H404, H422, H440, H260, H267, H268, H272, H274, H292, H293, H297, H298, H303, H305, H332, H333, H334, H340, H341, H342, H343, H355, H362, H386, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H137, H160, H161, H162, H164, H195, H197, H219, H282, H296, H335, H361, H422, H440, H267, H272, H274, H293, H297, H298, H303, H305, H334, H340, H341, H342, H343, H355, H362, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H137, H160, H161, H162, H195, H197, H219, H282, H296, H422, H440, H267, H272, H293, H297, H298, H303, H305, H334, H340, H341, H342, H355, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H160, H162, H195, H219, H282, H296, H267, H293, H297, H298, H303, H305, H334, H340, H341, H392, and H438, H442, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, H014, H016, H019, H025, H040, H043, H051, H052, H053, H056, H070, H082A, H098, H100, HI 10, HI 12, H121, H180, H184, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, HO 14, HO 16, H019, H025, H040, H043, H052, H053, H056, H070, H082A, H100, HI 10, HI 12, H121, H180, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, HO 14, HO 16, HO 19, H025, H040, H043, H052, H070, H082A, H100, HI 10, HI 12, H121, H180, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H007, HO 14, H019, H025, H040, H043, H052, H070, H100, HI 10, HI 12, H121, H180, H214, H216, H222, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L003, L005, L007, L008, L009, L010, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L138, L142, L143, L152, L171, L182, L188, L199, and L201 , according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues minus 1, L003, L005, L007, L008, L009, L010, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L142, L143, L152, L171, L182, L188, L199, and L201, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L003, L005, L007, L008, L009, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L142, L152, L171, L182, L188, and L199, according to the Kabat or Chothia numbering scheme.
  • residues (-)L001, L003, L005, L007, L008, L009, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L142, L152, L171, L182, L188, and L199 according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues minus 1, L005, L007, L008, L016, L017, L018, L020, L022, L027, L045, L058, L063, L077, L079, L107, L142, L152, L182, L188, and L199, according to the Kabat or Chothia numbering scheme.
  • residues minus 1, L005, L007, L008, L016, L017, L018, L020, L022, L027, L045, L058, L063, L077, L079, L107, L142, L152, L182, L188, and L199 according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L016, L063, and LI 99, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues HO 19, H025, H051, H070, H098, HI 10, HI 12, H121, H136, H180, H187, H190, H214, H216, H221, and H222, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L007, L008, L016, L022, L063, L014, L070, L138, L142, L143 and L152, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues HO 19, H025, H051, H070, H077, H079, H098, HI 10, HI 12, H121, H136, H180, H187, H190, H214, H216, H221, and H222, according to the Kabat or Chothia numbering scheme.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L007, L008, L016, L022, L063, L070, L138, L142, L143, L152 and L201, according to the Kabat or Chothia numbering scheme.
  • the site-specific positions can also be identified relative to the amino acid sequences of the polypeptide chains of a reference antibody.
  • the amino acid sequence of a reference heavy chain is provided at SEQ ID NO: 1.
  • the site-specific positions are at residues 5, 23, 42, 66, 75, 88, 121, 122, 135, 137, 138, 139, 140, 141, 142, 158, 163, 165, 168, 175, 177, 179, 180, 194, 197, 222, 241, 242, 244, 246, 249, 265, 267, 268, 270, 271, 272, 273, 274, 275, 277, 278, 281, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343,
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 42, 66, 75, 88, 121, 122, 135, 137, 138, 139, 140, 141, 142, 158, 163, 165, 168, 175, 177, 179, 180, 194, 197, 222, 241, 242, 244, 246, 249, 265, 267, 268, 270, 271, 272, 273, 274, 275, 277, 278, 281, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343, 345, 347, 358, 359, 361, 362, 363, 378, 386, 387, 389, 392, 395, 401, 40
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 75, 88, 121, 122, 135, 137, 138, 139, 140, 142, 163, 165, 168, 175, 194, 197, 242, 244, 249, 270, 271, 272, 273, 274, 275, 277, 278, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343, 345, 347, 358, 362, 378, 389, 392, 395, 401, 407, 423, 424, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 88, 121, 122, 135, 137, 138, 139, 140, 163, 165, 168, 175, 242, 244, 270, 273, 274, 275, 285, 289, 295, 296, 299, 300, 301, 332, 333, 337, 338, 343, 345, 358, 362, 389, 407, 423, 424, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 88,
  • polypeptide according to SEQ ID NO: l is a polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 75,
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 66, 141, 158, 177, 179, 180, 222, 241, 246, 265, 267, 268, 281, 359, 361, 363, 386, 387, 407, and 439 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 292- 301, 303, and 305 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 292, 299, 333, 338, 364, 403, 407, 425, 443, 263, 270, 271, 275, 277, 295, 296, 300, 301, 306, 308, 335, 336, 337,
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 299, 338, 364, 425, 443, 270, 275, 277, 295, 296, 300, 301, 306, 308, 337, 343, 344, 345, 346, 358, 365, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 299, 364, 425, 443, 270, 275, 296, 300, 301, 306, 308, 337, 343, 344, 345, 358, 365, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 198, 200, 222, 285, 299, 425, 443, 270, 275, 296, 300, 301, 306, 308, 337, 343, 344, 345, 358, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 163, 165, 198, 222, 285, 299, 270, 296, 300, 301, 306, 308, 337, 343,
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 3, 7, 14, 16, 19, 25, 40, 43, 51, 52, 54, 57, 71, 84, 102, 104, 114, 119, 124, 183, 187, 193, 195, 217, 219, 224, 225, 228, 230, 233, 234, 235 and 239 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 3, 7, 14, 16, 19, 25, 40, 43, 52, 54, 57, 71, 84, 104, 114, 119, 124, 183, 193, 195, 217, 219, 224, 225, 228, 230, 233, 234, 235 and 239 of the representative heavy chain polypeptide according to SEQ ID NO: l .
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 7, 14, 19, 25, 40, 43, 52, 71, 104, 114, 119, 124, 183, 195, 217, 219, 230, 233, 234, 235, and 239 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 10, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 138, 142, 143, 152, 171, 182, 188, 199, and 201 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 142, 143, 152, 171, 182, 188, 199, and 201 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 142, 152, 171, 182, 188, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 5, 7, 8, 16, 17, 18, 20, 22, 27, 45, 58, 63, 77, 79, 107, 142, 152, 182, 188, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 16, 63, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 19, 25, 51, 71, 102, 114, 119, 124, 139, 183, 187, 193, 217, 219, 224, and 225 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 7, 8, 16, 22, 63, 14, 70, 138, 142, 143 and 152 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 19, 25, 51, 71, 78, 80, 102, 114, 119, 124, 139, 183, 187, 193, 217, 219, 224, and 225 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 7, 8, 16, 22, 63, 70, 138, 142, 143, 152, and 201of the representative light chain
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49, 56, 57, 60, 67, 68, 109, 112, 114, 144, 153, 156, 157, 168, 184, 202, 203, and 206 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49, 56, 57, 60, 67, 68, 109, 112, 144, 153, 156, 168, 184, 202, and 203 of the representative light chain polypeptide according to SEQ ID NO:2.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49,
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 49, 56,
  • the antibody comprises a polypeptide chain that can be described by the following formula (I):
  • each Xaa represents an amino acid in the polypeptide chain of any identity.
  • each Xaa can be any amino acid, typically any naturally occurring amino acid, or a variant thereof.
  • the superscript to the right of each Xaa represents the position of the amino acid within the primary sequence of the polypeptide chain.
  • Xaa 1 represents the first, or N-terminal, amino acid in the polypeptide chain
  • Xaa q represents the last, or C- terminal, amino acid in the polypeptide chain.
  • the variable q is an integer that is equal to the total number of amino acids in the polypeptide chain.
  • Each Naa represents a non-natural amino acid within the polypeptide chain. Useful non-natural amino acids are described in the sections below.
  • n represents the number of non-natural amino acids in the polypeptide chain. In typical embodiments, n is an integer greater than 1. Each integer p(i) is greater than 1 and less than q, and the variable i is an integer that varies from 1 to n. Each integer p(i) represents a site-specific location in the amino acid sequence for the
  • Each site specific location p(i) is optimal for substitution of a naturally occurring amino acid with a non-natural amino acid, such as Naa p ⁇ , according to the techniques described herein.
  • thermostability than the other tested variants.
  • the preferred sites for nnAA incorporation are listed in Table I, below.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC-N152, HC-S136, HC-S25, HC-A40, HC-S119, HC-S190, HC-K222, HC-R19, HC-Y52, or HC-S70 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC- N152, HC-S136, HC-S25, HC-A40, HC-S119, HC-S190, and HC-K222 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
  • antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC- N152, and HC-S136 according to the Kabat or Chothia numbering scheme, or a post- translationally modified variant thereof.
  • conservatively modified variants of the above antibodies include one or more insertions, deletions or substitutions that do not disrupt the structure and/or function of the antibody when evaluated by one of skill in the art.
  • conservatively modified variants include 20 or fewer amino acid insertions, deletions or substitutions.
  • conservatively modified variants include 15 or fewer amino acid insertions, deletions or substitutions.
  • conservatively modified variants include 10 or fewer amino acid insertions, deletions or substitutions.
  • conservatively modified variants include 9 or fewer amino acid insertions, deletions or substitutions.
  • conservatively modified variants include 8 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 7 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 6 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 5 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 4 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 3 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 2 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 1 amino acid insertion, deletion or substitution. In particular embodiments the substitutions are conservative, substituting an amino acid within the same class, as described above.
  • the antibodies can be modified to modulate structure, stability and/or activity.
  • the modifications can be conservative or other than conservative.
  • the modifications need only be suitable to the practitioner carrying out the methods and using the compositions described herein.
  • the modifications decrease but do not eliminate antigen binding affinity.
  • the modifications increase antigen binding affinity.
  • the modifications increase antigen binding affinity.
  • modified variants enhance structure or stability of the antibody. In certain embodiments, the modifications reduce but do not eliminate structure or stability of the antibody. In certain embodiments, modified variants include 20 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 15 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 10 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 9 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 8 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 7 or fewer amino acid insertions, deletions or substitutions.
  • modified variants include 6 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 5 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 4 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 3 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 2 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 1 amino acid insertion, deletion or substitution.
  • post-translationally modified variants Any of the antibodies provided herein can be post-translationally modified in any manner recognized by those of skill in the art. Typical post-translational modifications for antibodies include interchain disulfide bonding, intrachain disulfide bonding, N-linked glycosylation and proteolysis. Also provided herein are other post-translationally modified antibodies having modifications such as phosphorylation, O-linked glycosylation, methylation, acetylation, lipidation, GPI anchoring, myristoylation and prenylation. The post-translational
  • the post-translational modification can be an intentional modification by a practitioner, for instance, using the methods provided herein.
  • antibodies fused to further peptides or polypeptides include, but are not limited to, e.g., a methionyl antibody in which a methionine is linked to the N-terminus of the antibody resulting from the
  • the antibodies may comprise protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including but not limited to, FLAG, poly-His, GST, etc.).
  • the antibodies may also comprise linked molecules (including but not limited to, biotin) that improve detection (including but not limited to, GFP), purification or other features of the antibody.
  • the antibodies comprise a C-terminal affinity sequence that facilitates purification of full length antibodies.
  • such C-terminal affinity sequence is a poly-His sequence, e.g., a 6-His sequence.
  • the antibody can have any antibody form recognized by those of skill in the art.
  • the antibody can comprise a single polypeptide chain - a single heavy chain or a single light chain.
  • the antibody can also form multimers that will be recognized by those of skill in the art including homodimers, heterodimers, homomultimers, and heteromultimers. These multimers can be linked or unlinked. Useful linkages include interchain disulfide bonds typical for antibody molecules.
  • the multimers can also be linked by other amino acids, including the non-natural amino acids introduced according to the present description.
  • the antibody can be an immunoglobulin such as of any class or subclass including IgA, IgAl, IgA2, IgD, IgE, IgG, IgGl, IgG2, IgG3, IgG4 and IgM.
  • the antibody can be of the form of any antibody fragment including Fv, Fc, Fab, and (Fab') 2 and scFv.
  • the antibody may further be glycosylated or aglycosyated. Accordingly, in certain embodiments, the antibody is glycosylated. In certain embodiments, the antibody is aglycosylated.
  • Agylcosylated antibodies comprising a non-natural amino acid may be made, for example, as described in the Examples provided herein or through bacterial expression systems known to those skilled in the art.
  • Glycosylated antibodies comprising a non-natural amino acid may be made, for example, as described by Axup et ah, 2012, Proc. Nat. Acad. Sci. USA 109(40): 16101-16106.
  • antibodies that are conjugated to one or more
  • the conjugation moiety can be any conjugation moiety deemed useful to one of skill in the art.
  • the conjugation moiety can be a polymer, such as polyethylene glycol, that can improve the stability of the antibody in vitro or in vivo.
  • the conjugation moiety can have therapeutic activity, thereby yielding an antibody-drug conjugate.
  • the conjugation moiety can be a molecular payload that is harmful to target cells.
  • the conjugation moiety can be a label useful for detection or diagnosis.
  • the conjugation moiety is linked to the antibody via a direct covalent bond.
  • the conjugation moiety is linked to the antibody via a linker.
  • the conjugation moiety or the linker is attached via one of the non-natural amino acids of the antibody. Exemplary conjugation moieties and linkers are discussed in the sections below.
  • the non-natural amino acid can be any non-natural amino acid known to those of skill in the art.
  • the non-naturally encoded amino acid comprises a functional group.
  • the functional group can be any functional group known to those of skill in the art.
  • the functional group is a label, a polar group, a non-polar group or a reactive group.
  • Reactive groups are particularly advantageous for linking further functional groups to the antibody at the site-specific position of the antibody chain.
  • the reactive group is selected from the group consisting of amino, carboxy, acetyl, hydrazino, hydrazido, semicarbazido, sulfanyl, azido and alkynyl.
  • the amino acid residue is according to any of the following formulas:
  • antibodies are generally comprised of L-amino acids.
  • the present methods and compositions provide the practitioner with the ability to use L-, D- or racemic non-natural amino acids at the site-specific positions.
  • the non-natural amino acids described herein include D- versions of the natural amino acids and racemic versions of the natural amino acids.
  • the wavy lines indicate bonds that connect to the remainder of the polypeptide chains of the antibodies.
  • These non-natural amino acids can be incorporated into polypeptide chains just as natural amino acids are incorporated into the same polypeptide chains.
  • the non-natural amino acids are incorporated into the polypeptide chain via amide bonds as indicated in the formulas.
  • R designates any functional group without limitation, so long as the amino acid residue is not identical to a natural amino acid residue.
  • R can be a hydrophobic group, a hydrophilic group, a polar group, an acidic group, a basic group, a chelating group, a reactive group, a therapeutic moiety or a labeling
  • R and R are each independently selected from the group consisting of hydrogen, alkyl and heteroalklyl.
  • the non-naturally encoded amino acids include side chain functional groups that react efficiently and selectively with functional groups not found in the 20 common amino acids (including but not limited to, azido, ketone, aldehyde and aminooxy groups) to form stable conjugates.
  • antigen-binding polypeptide that includes a non-naturally encoded amino acid containing an azido functional group can be reacted with a polymer (including but not limited to, poly(ethylene glycol) or, alternatively, a second polypeptide containing an alkyne moiety to form a stable conjugate resulting for the selective reaction of the azide and the alkyne functional groups to form a Huisgen [3+2] cycloaddition product.
  • non-naturally encoded amino acids that may be suitable for use in the present invention and that are useful for reactions with water soluble polymers include, but are not limited to, those with carbonyl, aminooxy, hydrazine, hydrazide, semicarbazide, azide and alkyne reactive groups.
  • non-naturally encoded amino acids comprise a saccharide moiety.
  • amino acids examples include N-acetyl-L- glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L- threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L-serine.
  • amino acids also include examples where the naturally-occurring N- or O-linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature-including but not limited to, an alkene, an oxime, a thioether, an amide and the like.
  • amino acids also include saccharides that are not commonly found in naturally-occurring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
  • non-naturally encoded amino acids are commercially available, e.g., from Sigma-Aldrich (St. Louis, Mo., USA), Novabiochem (a division of EMD Biosciences, Darmstadt, Germany), or Peptech (Burlington, Mass., USA). Those that are not commercially available are optionally synthesized as provided herein or using standard methods known to those of skill in the art.
  • unnatural amino acids that may be suitable for use in the present invention also optionally comprise modified backbone structures, including but not limited to, as illustrated by the structures of Formula II and III:
  • Z typically comprises OH, NH 2 , SH, NH-R', or S-R';
  • X and Y which can be the same or different, typically comprise S or O, and R and R', which are optionally the same or different, are typically selected from the same list of constituents for the R group described above for the unnatural amino acids having Formula I as well as hydrogen.
  • unnatural amino acids of the invention optionally comprise substitutions in the amino or carboxyl group as illustrated by Formulas II and III.
  • Unnatural amino acids of this type include, but are not limited to, a-hydroxy acids, a-thioacids, a-aminothiocarboxylates, including but not limited to, with side chains corresponding to the common twenty natural amino acids or unnatural side chains.
  • substitutions at the a-carbon optionally include, but are not limited to, L, D, or ⁇ - ⁇ -disubstituted amino acids such as D-glutamate, D- alanine, D-methyl-O-tyrosine, aminobutyric acid, and the like.
  • Other structural alternatives include cyclic amino acids, such as proline analogues as well as 3, 4, 6, 7, 8, and 9 membered ring proline analogues, P and y amino acids such as substituted ⁇ -alanine and ⁇ -amino butyric acid.
  • Tyrosine analogs include, but are not limited to, para-substituted tyrosines, ortho-substituted tyrosines, and meta substituted tyrosines, where the substituted tyrosine comprises, including but not limited to, a keto group (including but not limited to, an acetyl group), a benzoyl group, an amino group, a hydrazine, an hydroxyamine, a thiol group, a carboxy group, an isopropyl group, a methyl group, a C 6 -C 2 o straight chain or branched hydrocarbon, a saturated or unsaturated hydrocarbon, an O-methyl group, a polyether group, a nitro group, an alkynyl group or the like.
  • multiply substituted aryl rings are also contemplated.
  • Glutamine analogs that may be suitable for use in the present invention include, but are not limited to, a-hydroxy derivatives, ⁇ -substituted derivatives, cyclic derivatives, and amide substituted glutamine derivatives.
  • Example phenylalanine analogs that may be suitable for use in the present invention include, but are not limited to, para-substituted phenylalanines, ortho-substituted phenyalanines, and meta-substituted phenylalanines, where the substituent comprises, including but not limited to, a hydroxy group, a methoxy group, a methyl group, an allyl group, an aldehyde, an azido, an iodo, a bromo, a keto group (including but not limited to, an acetyl group), a benzoyl, an alkynyl group, or the like.
  • unnatural amino acids include, but are not limited to, a p-acetyl-L-phenylalanine, an O-methyl-L-tyrosine, an L-3-(2- naphthyl)alanine, a 3-methyl-phenylalanine, an O-4-allyl-L-tyrosine, a 4-propyl-L-tyrosine, a tri-O-acetyl-GlcNAcP-serine, an L-Dopa, a fluorinated phenylalanine, an isopropyl-L- phenylalanine, a p-azido-L-phenylalanine, a p-acyl-L-phenylalanine, a p-benzoyl-L- phenylalanine, an L-phosphoserine, a phosphonoserine, a phosphonotyrosine, a p-iodo-
  • Amino acids with a carbonyl reactive group allow for a variety of reactions to link molecules (including but not limited to, PEG or other water soluble molecules) via nucleophilic addition or aldol condensation reactions among others.
  • R 3 HN ⁇ COR 4 wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl; R 2 is H, alkyl, aryl, substituted alkyl, and substituted aryl; and R 3 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R 4 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
  • n is 1
  • Ri is phenyl and R 2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the para position relative to the alkyl side chain.
  • n is 1
  • Ri is phenyl and R 2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the meta position relative to the alkyl side chain.
  • a non-naturally encoded amino acid bearing adjacent hydroxyl and amino groups can be incorporated into the polypeptide as a "masked" aldehyde functionality.
  • 5-hydroxylysine bears a hydroxyl group adjacent to the epsilon amine.
  • Reaction conditions for generating the aldehyde typically involve addition of molar excess of sodium metaperiodate under mild conditions to avoid oxidation at other sites within the polypeptide.
  • the pH of the oxidation reaction is typically about 7.0.
  • a typical reaction involves the addition of about 1.5 molar excess of sodium meta periodate to a buffered solution of the polypeptide, followed by incubation for about 10 minutes in the dark. See, e.g. U.S. Pat.
  • the carbonyl functionality can be reacted selectively with a hydrazine-, hydrazide-, hydroxylamine-, or semicarbazide-containing reagent under mild conditions in aqueous solution to form the corresponding hydrazone, oxime, or semicarbazone linkages, respectively, that are stable under physiological conditions. See, e.g., Jencks, W. P., J. Am. Chem. Soc. 81, 475-481 (1959); Shao, J. and Tarn, J. P., J. Am. Chem. Soc. 117:3893-3899 (1995). Moreover, the unique reactivity of the carbonyl group allows for selective
  • Non-naturally encoded amino acids containing a nucleophilic group such as a hydrazine, hydrazide or semicarbazide, allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
  • hydrazine, hydrazide or semicarbazide -containing amino acids can be represented as follows:
  • R 2 HN / ⁇ COR 3 wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X, is O, N, or S or not present; R 2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R 3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
  • n is 4, Ri is not present, and X is N. In some embodiments, n is 2, Ri is not present, and X is not present. In some embodiments, n is 1, Ri is phenyl, X is O, and the oxygen atom is positioned para to the alphatic group on the aryl ring.
  • Hydrazide-, hydrazine-, and semicarbazide-containing amino acids are available from commercial sources.
  • L-glutamate-y-hydrazide is available from Sigma Chemical (St. Louis, Mo.).
  • Other amino acids not available commercially can be prepared by one skilled in the art. See, e.g., U.S. Pat. No. 6,281,211, which is incorporated by reference herein.
  • Polypeptides containing non-naturally encoded amino acids that bear hydrazide, hydrazine or semicarbazide functionalities can be reacted efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 117:3893-3899 (1995).
  • hydrazide, hydrazine and semicarbazide functional groups make them significantly more reactive toward aldehydes, ketones and other electrophilic groups as compared to the nucleophilic groups present on the 20 common amino acids (including but not limited to, the hydroxyl group of serine or threonine or the amino groups of lysine and the N-terminus).
  • Non-naturally encoded amino acids containing an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
  • an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
  • the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 117:3893-3899 (1995); H. Hang and C. Bertozzi, Acc. Chem. Res.
  • amino acids containing aminooxy groups can be represented as follows:
  • n is 1, Ri is phenyl, X is O, m is 1, and Y is present.
  • n is 2, Ri and X are not present, m is 0, and Y is not present.
  • Aminooxy-containing amino acids can be prepared from readily available amino acid precursors (homoserine, serine and threonine). See, e.g., M. Carrasco and R. Brown, J. Org. Chem. 68: 8853-8858 (2003). Certain aminooxy-containing amino acids, such as L-2- amino-4-(aminooxy)butyric acid), have been isolated from natural sources (Rosenthal, G. et al., Life Sci. 60: 1635-1641 (1997). Other aminooxy-containing amino acids can be prepared by one skilled in the art.
  • azide and alkyne functional groups make them extremely useful for the selective modification of polypeptides and other biological molecules.
  • Organic azides, particularly alphatic azides, and alkynes are generally stable toward common reactive chemical conditions.
  • both the azide and the alkyne functional groups are inert toward the side chains (i.e., R groups) of the 20 common amino acids found in naturally-occurring polypeptides.
  • R groups side chains
  • the "spring-loaded" nature of the azide and alkyne groups is revealed and they react selectively and efficiently via Huisgen [3+2] cycloaddition reaction to generate the corresponding triazole.
  • the Huisgen cycloaddition reaction involves a selective cycloaddition reaction (see, e.g., Padwa, A., in COMPREHENSIVE ORGANIC SYNTHESIS, Vol. 4, (ed. Trost, B. M., 1991), p. 1069-1109; Huisgen, R. in 1,3-DIPOLAR CYCLOADDITION CHEMISTRY, (ed. Padwa, A., 1984), p. 1-176) rather than a nucleophilic substitution, the incorporation of non-naturally encoded amino acids bearing azide and alkyne-containing side chains permits the resultant polypeptides to be modified selectively at the position of the non- naturally encoded amino acid.
  • Cycloaddition reaction involving azide or alkyne-containing antibody can be carried out at room temperature under aqueous conditions by the addition of Cu(II) (including but not limited to, in the form of a catalytic amount of CuS0 4 ) in the presence of a reducing agent for reducing Cu(II) to Cu(I), in situ, in catalytic amount.
  • Cu(II) including but not limited to, in the form of a catalytic amount of CuS0 4
  • a reducing agent for reducing Cu(II) to Cu(I in situ, in catalytic amount.
  • Exemplary reducing agents include, including but not limited to, ascorbate, metallic copper, quinine, hydroquinone, vitamin K, glutathione, cysteine, Fe , Co , and an applied electric potential.
  • the antigen-binding polypeptide comprises a non-naturally encoded amino acid comprising an alkyne moiety and the water soluble polymer to be attached to the amino acid comprises an azide moiety.
  • the converse reaction i.e., with the azide moiety on the amino acid and the alkyne moiety present on the water soluble polymer can also be performed.
  • the azide functional group can also be reacted selectively with a water soluble polymer containing an aryl ester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage.
  • the aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with a proximal ester linkage to generate the corresponding amide. See, e.g., E. Saxon and C. Bertozzi, Science 287, 2007-2010 (2000).
  • the azide-containing amino acid can be either an alkyl azide (including but not limited to, 2- amino-6-azido-l-hexanoic acid) or an aryl azide (p-azido-phenylalanine).
  • Exemplary water soluble polymers containing an aryl ester and a phosphine moiety can be represented as follows:
  • R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups.
  • R groups include but are not limited to -CH 2 , -C(CH 3 ) 3 , -OR, -NR'R", -SR * , -halogen, -C(0)R * , - CONR'R", -S(0) 2 R, -S(0) 2 NR * R", -CN and -N0 2 .
  • R, R", R'" and R" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
  • each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present.
  • R and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
  • -NR'R is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl.
  • alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF 3 and -CH 2 CF 3 ) and acyl (including but not limited to, - C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 OCH 3 , and the like).
  • the azide functional group can also be reacted selectively with a water soluble polymer containing a thioester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage.
  • the aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with the thioester linkage to generate the corresponding amide.
  • Exemplary water soluble polymers containing a thioester and a phosphine moiety can be represented as follows:
  • alkyne-containing amino acids can be represented as follows:
  • n is 1
  • Ri is phenyl
  • X is not present
  • m is 0 and the acetylene moiety is positioned in the para position relative to the alkyl side chain.
  • n is 1
  • Ri is phenyl
  • X is O
  • m is 1
  • the propargyloxy group is positioned in the para position relative to the alkyl side chain (i.e. , O-propargyl-tyrosine).
  • n is 1
  • Ri and X are not present and m is 0 (i.e. , proparylglycine).
  • Alkyne-containing amino acids are commercially available.
  • propargylglycine is commercially available from Peptech (Burlington, Mass.).
  • alkyne-containing amino acids can be prepared according to standard methods.
  • p-propargyloxyphenylalanine can be synthesized, for example, as described in Deiters, A., et al., J. Am. Chem. Soc. 125 : 1 1782-1 1783 (2003)
  • 4-alkynyl-L-phenylalanine can be synthesized as described in Kayser, B., et al, Tetrahedron 53(7): 2475-2484 (1997).
  • Other alkyne-containing amino acids can be prepared by one skilled in the art.
  • Exemplary azide-containing amino acids can be represented as follows: wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, substituted aryl or not present; X is O, N, S or not present; m is 0-10; R 2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
  • n is 1
  • Ri is phenyl
  • X is not present
  • m is 0 and the azide moiety is positioned para to the alkyl side chain.
  • n is 1
  • Ri is phenyl
  • X is O
  • m is 2 and the P-azidoethoxy moiety is positioned in the para position relative to the alkyl side chain.
  • Azide-containing amino acids are available from commercial sources.
  • 4-azidophenylalanine can be obtained from Chem-Impex International, Inc. (Wood Dale, 111.).
  • the azide group can be prepared relatively readily using standard methods known to those of skill in the art, including but not limited to, via displacement of a suitable leaving group (including but not limited to, halide, mesylate, tosylate) or via opening of a suitably protected lactone. See, e.g., Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York).
  • beta-substituted aminothiol functional groups make them extremely useful for the selective modification of polypeptides and other biological molecules that contain aldehyde groups via formation of the thiazolidine. See, e.g., J. Shao and J. Tarn, J. Am. Chem. Soc. 1995, 1 17 (14) 3893-3899.
  • beta- substituted aminothiol amino acids can be incorporated into antibodies and then reacted with water soluble polymers comprising an aldehyde functionality.
  • a water soluble polymer, drug conjugate or other payload can be coupled to an antibody polypeptide comprising a beta-substituted aminothiol amino acid via formation of the thiazolidine.
  • non-natural amino acids include, but are not limited to, p-acetyl-L-phenylalanine, O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, 3-methyl- phenylalanine, O-4-allyl-L-tyrosine, 4-propyl-L-tyrosine, tri-O-acetyl-GlcNAc b-serine, L- Dopa, fluorinated phenylalanine, isopropyl-L-phenylalanine, p-azido-L-phenylalanine, p- acyl-L-phenylalanine, p-benzoyl-L-phenylalanine, L-phosphoserine, phosphonoserine, phosphonotyrosine, p-iodo-phenylalanine, p-bromophenylalanine, p-amino-L-pheny
  • N-acetyl-L-glucosaminyl-L-serine N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L- glucosaminyl-L-threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L- serine.
  • the non-natural amino acids are selected from p- acetyl- phenylalanine, p-ethynyl-phenylalanine, p-propargyloxyphenylalanine, and p-azido- phenylalanine.
  • One particularly useful non-natural amino acid is p-azido phenylalanine. This amino acid residue is known to those of skill in the art to facilitate Huisgen [3+2] cyloaddition reactions (so-called "click" chemistry reactions) with, for example, compounds bearing alkynyl groups. This reaction enables one of skill in the art to readily and rapidly conjugate to the antibody at the site-specific location of the non-natural amino acid.
  • the first reactive group is an alkynyl moiety (including but not limited to, in the unnatural amino acid p-propargyloxyphenylalanine, where the propargyl group is also sometimes referred to as an acetylene moiety) and the second reactive group is an azido moiety, and [3+2] cycloaddition chemistry can be used.
  • the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid p-azido-L-phenylalanine) and the second reactive group is the alkynyl moiety.
  • each L represents a divalent linker.
  • the divalent linker can be any divalent linker known to those of skill in the art. Generally, the divalent linker is capable of forming covalent bonds to the functional moiety R and the alpha carbon of the non-natural amino acid. Useful divalent linkers a bond, alkylene, substituted alkylene, heteroalkylene, substituted heteroalkylene, arylene, substituted arylene, heteroarlyene and substituted heteroarylene.
  • L is C 1-10 alkylene or C 1-10
  • non-natural amino acids used in the methods and compositions described herein have at least one of the following four properties: (1) at least one functional group on the sidechain of the non-natural amino acid has at least one characteristics and/or activity and/or reactivity orthogonal to the chemical reactivity of the 20 common, genetically- encoded amino acids (i.e.
  • the non-natural amino acid includes an oxime functional group or a functional group that can be transformed into an oxime group by reacting with a reagent, preferably under conditions that do not destroy the biological properties of the polypeptide that includes the non-natural amino acid (unless of course such a destruction of biological properties is the purpose of the modification/transformation), or where the transformation can occur under aqueous conditions at a pH between about 4 and about 8, or where the reactive site on the non-natural amino acid is an electrophilic site.
  • Illustrative, non-limiting examples of amino acids that satisfy these four properties for non-natural amino acids that can be used with the compositions and methods described herein are presented in FIGS.
  • Non-natural amino acids can be introduced into the polypeptide.
  • Non- natural amino acids may also include protected or masked oximes or protected or masked groups that can be transformed into an oxime group after deprotection of the protected group or unmasking of the masked group.
  • Non-natural amino acids may also include protected or masked carbonyl or dicarbonyl groups, which can be transformed into a carbonyl or dicarbonyl group after deprotection of the protected group or unmasking of the masked group and thereby are available to react with hydroxylamines or oximes to form oxime groups.
  • non-natural amino acids that may be used in the methods and compositions described herein include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or non-covalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analogue, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, aldehyde-containing amino acids, amino acids comprising polyethylene glycol or other polyethers, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater
  • non-natural amino acids comprise a saccharide moiety.
  • examples of such amino acids include N-acetyl-L-glucosaminyl-L-serine, N-acetyl-L- galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L-threonine, N-acetyl-L-glucosaminyl-L- asparagine and O-mannosaminyl-L-serine.
  • amino acids also include examples where the naturally-occurring N- or 0-linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature-including but not limited to, an alkene, an oxime, a thioether, an amide and the like.
  • amino acids also include saccharides that are not commonly found in naturally-occurring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
  • the chemical moieties incorporated into antibodies via incorporation of non- natural amino acids offer a variety of advantages and manipulations of polypeptides.
  • the unique reactivity of a carbonyl or dicarbonyl functional group allows selective modification of antibodies with any of a number of hydrazine- or hydroxylamine-containing reagents in vivo and in vitro.
  • a heavy atom non-natural amino acid for example, can be useful for phasing x-ray structure data.
  • the site-specific introduction of heavy atoms using non-natural amino acids also provides selectivity and flexibility in choosing positions for heavy atoms.
  • Photoreactive non-natural amino acids include but not limited to, amino acids with benzophenone and arylazides (including but not limited to, phenylazide) side chains), for example, allow for efficient in vivo and in vitro photocrosslinking of polypeptides.
  • photoreactive non-natural amino acids include, but are not limited to, p-azido-phenylalanine and p-benzoyl- phenylalanine.
  • the antibodies with the photoreactive non-natural amino acids may then be crosslinked at will by excitation of the photoreactive group-providing temporal control.
  • the methyl group of a non-natural amino can be substituted with an isotopically labeled, including but not limited to, with a methyl group, as a probe of local structure and dynamics, including but not limited to, with the use of nuclear magnetic resonance and vibrational spectroscopy.
  • Amino acids with an electrophilic reactive group allow for a variety of reactions to link molecules via various chemical reactions, including, but not limited to, nucleophilic addition reactions.
  • Such electrophilic reactive groups include a carbonyl- or dicarbonyl-group (including a keto- or aldehyde group), a carbonyl-like- or dicarbonyl-like-group (which has reactivity similar to a carbonyl- or dicarbonyl-group and is structurally similar to a carbonyl - or dicarbonyl-group), a masked carbonyl- or masked dicarbonyl-group (which can be readily converted into a carbonyl- or dicarbonyl-group), or a protected carbonyl- or protected dicarbonyl-group (which has reactivity similar to a carbonyl- or dicarbonyl-group upon deprotection).
  • Such amino acids include amino acids having the structure of Formula (I):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; each R" is independently H, alkyl, substituted alkyl, or a protecting group, or when more than one R" group is present, two R" optionally form a heterocycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R 3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R 3 and R 4 or two R 3 groups optionally form a cycloalkyl or a heterocycloalkyl; or the -A-B-J-R groups together form a bicyclic or tricyclic cycloalkyl or heterocycloalkyl comprising at least one carbonyl group, including a dicarbonyl group, protected
  • compounds of Formula (I) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (I) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (I) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
  • R is Ci-6 alkyl or cycloalkyl.
  • R is -CH 3 , -CH(CH 3 ) 2 , or cyclopropyl.
  • Ri is H, tert-butyloxycarbonyl (Boc), 9- Fluorenylmethoxycarbonyl (Fmoc), N-acetyl, tetrafluoroacetyl (TFA), or benzyloxycarbonyl (Cbz).
  • Ri is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is OH, O-methyl, O-ethyl, or O-t-butyl.
  • R 2 is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is a polynucleotide. In certain embodiments of compounds of Formula (I), R 2 is ribonucleic acid (RNA). In certain embodiments of compounds of Formula (I), R 2 is tRNA. In certain embodiments of compounds of Formula (I), the tRNA specifically recognizes a selector codon. In certain embodiments of compounds of Formula (I) the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon. In certain embodiments of compounds of Formula (I), R 2 is a suppressor tRNA.
  • A is substituted lower alkylene, C 4 -arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • B is optional, and when present is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-,
  • A is optional, and when present is substituted lower alkylene, C 4 -arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • B is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkylene, lower al
  • each R' is independently H, alkyl, or substituted alkyl
  • Ri is optional, and when present, is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 2 is optional, and when present, is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide
  • each R 3 and R 4 is independently H, halogen, lower alkyl, or substituted lower alkyl
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • amino acids having the structure of Formula (II) are included:
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • non-natural amino acids when A is phenylene, B is present; and that when A is -(CH 2 ) 4 - B is not -NHC(0)(CH 2 CH 2 )-; and that when A and B are absent, R is not methyl.
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • amino acids having the structure of Formula (III) are included:
  • B is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1 , 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-
  • each R' is independently H, alkyl, or substituted alkyl;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • each R a is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R') 2 , -C(0) k R'where k is 1, 2, or 3, -C(0)N(R') 2 , -OR, and -S(0) k R, where each R' is independently H, alkyl, or substituted alkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer
  • non-natural amino acids may be are optionally amino protected group, carboxyl protected and/or in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • -NS(0) 2 -, -OS(0) 2 - optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene)
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)-, -CON(R')-(alkylene)
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; wherein each R a is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R) 2 , -C(0) k R where k is 1, 2, or 3, -C(0)N(R * ) 2 , -OR * , and -S(0) k R, where each R is independently H, alkyl, or substituted alkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(al)-
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • non-natural amino acids described herein may include groups such as dicarbonyl, dicarbonyl like, masked dicarbonyl and protected dicarbonyl groups.
  • amino acids having the structure of Formula (V) are included:
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene)-
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; wherein each R a is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R) 2 , -C(0) k R where k is 1, 2, or 3, -C(0)N(R * ) 2 , -OR * , and -S(0) k R, where each R' is independently H, alkyl, or substituted alkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')- -CON(R')-(alkylene)
  • such compounds are optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • Xi is C, S, or S(O); and L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • Such non-natural amino acids may be in
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • Xi is C,
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • n is 0, 1, 8 9 8 9
  • each R and R on each CR R group is independently selected from the
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • n is 0, 1 ,
  • each R and R on each CR R group is independently selected from the
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • Xi is C, S, or S(O); and L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • Such non-natural amino acids may be in
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • amino acids having the structure of Formula (XXXII-B) are included:
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into
  • amino acids having the structure of Formula (XXXX) are included:
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • heterocycloalkylene substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
  • R 3 and R 4 are independently chosen from H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl, or R 3 and R 4 or two R3 groups or two R 4 groups optionally form a cycloalkyl or a heterocycloalkyl;
  • R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • T3 is a bond, C(R)(R), O, or S, and R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide.
  • amino acids having the structure of Formula (XXXXI) are included:
  • R 3 and R 4 are independently chosen from H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl, or R 3 and R 4 or two R3 groups or two R 4 groups optionally form a cycloalkyl or a heterocycloalkyl;
  • R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • T3 is a bond, C(R)(R), O, or S, and R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl;
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide;
  • amino acids having the structure of Formula (XXXII) are included:
  • R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; and T3 is O, or S.
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • amino acids having the structure of Formula (XXXXIII) are included:
  • R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • Non-natural amino acids containing a hydroxylamine (also called an aminooxy) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
  • the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain carbonyl- or dicarbonyl- groups, including but not limited to, ketones, aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tam, J., J. Am. Chem. Soc. 117:3893-3899 (1995); H. Hang and C.
  • an oxime results generally from the reaction of an aminooxy group with a carbonyl- or dicarbonyl-containing group such as, by way of example, a ketones, aldehydes or other functional groups with similar chemical reactivity.
  • non-natural amino acids with sidechains comprising a hydroxylamine group, a hydroxylamine-like group (which has reactivity similar to a hydroxylamine group and is structurally similar to a hydroxylamine group), a masked hydroxylamine group (which can be readily converted into a
  • amino acids having the structure of Formula (XIV):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-, -C(S)-
  • R 6 or R 7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide
  • Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • A is phenylene or substituted phenylene.
  • B is - (alkylene or substituted alkylene)-, -0-(alkylene or substituted alkylene)-, -S-(alkylene or substituted alkylene)-, or -C(0)-(alkylene or substituted alkylene)-.
  • B is -0(CH 2 ) 2 -, -S(CH 2 ) 2 - -NH(CH 2 ) 2 - -CO(CH 2 ) 2 - or -(CH 2 ) n - where n is 1 to 4.
  • Ri is H, tert-butyloxycarbonyl (Boc), 9-Fluorenylmethoxycarbonyl (Fmoc), N-acetyl,
  • Ri is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is OH, O-methyl, O-ethyl, or O-t- butyl.
  • R 2 is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is a polynucleotide.
  • R 2 is ribonucleic acid (RNA).
  • R 2 is tRNA.
  • the tRNA specifically recognizes a codon selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon.
  • R 2 is a suppressor tRNA.
  • each of R 6 and R 7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl.
  • each of R 6 and R 7 is independently selected from the group consisting of H, methyl, phenyl, and -[(alkylene or substituted alkylene)-0- (hydrogen, alkyl, or substituted alkyl)] x , wherein x is from 1-50.
  • K is -NR 6 R 7 .
  • X is a biologically active agent selected from the group consisting of a peptide, protein, enzyme, antibody, drug, dye, lipid, nucleosides, oligonucleotide, cell, virus, liposome, microparticle, and micelle.
  • X is a drug selected from the group consisting of an antibiotic, fungicide, anti-viral agent, anti-inflammatory agent, anti-tumor agent, cardiovascular agent, anti-anxiety agent, hormone, growth factor, and steroidal agent.
  • X is an enzyme selected from the group consisting of horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, and glucose oxidase.
  • X is a detectable label selected from the group consisting of a fluorescent, phosphorescent, chemiluminescent, chelating, electron dense, magnetic, intercalating, radioactive, chromophoric, and energy transfer moiety.
  • compounds of Formula (XIV) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (XIV) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (XIV) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
  • amino acids having the structure of Formula (XV):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-, -C(S)-
  • a non-limiting, representative amino acid has the following structure:
  • Such a non-natural amino acid may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • Non-natural amino acids containing an oxime group allow for reaction with a variety of reagents that contain certain reactive carbonyl- or dicarbonyl-groups (including but not limited to, ketones, aldehydes, or other groups with similar reactivity) to form new non- natural amino acids comprising a new oxime group.
  • Such an oxime exchange reaction allow for the further functionalization of non-natural amino acid polypeptides.
  • the original non-natural amino acids containing an oxime group may be useful in their own right as long as the oxime linkage is stable under conditions necessary to incorporate the amino acid into a polypeptide (e.g., the in vivo, in vitro and chemical synthetic methods described herein).
  • non-natural amino acids with sidechains comprising an oxime group, an oxime-like group (which has reactivity similar to an oxime group and is structurally similar to an oxime group), a masked oxime group (which can be readily converted into an oxime group), or a protected oxime group (which has reactivity similar to an oxime group upon deprotection).
  • amino acids include amino acids having the structure of Formula (XI):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-, -C(S)-
  • B is -0-(alkylene or substituted alkylene)-. In certain embodiments of compounds of Formula (XI), B is - 0(CH 2 )-. In certain embodiments of compounds of Formula (XI), R is Ci_ 4 alkyl. In certain embodiments of compounds of Formula (XI), R is -CH 3 . In certain embodiments of compounds of Formula (XI), Ri is H, tert-butyloxycarbonyl (Boc), 9- fluorenylmethoxycarbonyl (Fmoc), N-acetyl, tetrafluoroacetyl (TFA), or benzyloxycarbonyl (Cbz).
  • Ri is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is OH, O-methyl, O-ethyl, or O-t-butyl.
  • R 2 is a resin, amino acid, polypeptide, or polynucleotide.
  • R 2 is a polynucleotide.
  • R 2 is ribonucleic acid (RNA).
  • RNA ribonucleic acid
  • R 2 is tRNA.
  • the tRNA specifically recognizes a selector codon.
  • the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon.
  • R 2 is a suppressor tRNA.
  • R 5 is alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, or -C(0) 2 R".
  • R 5 is -[(alkylene or substituted alkyl ene)-0- (hydrogen, alkyl, or substituted alkyl)] x , wherein x is from 1-50. In certain embodiments of compounds of Formula (XI), R 5 is -(CH 2 CH 2 )-0-CH 3 or -COOH.
  • compounds of Formula (XI) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (XI) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (XI) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
  • Amino acids of Formula (XI) include amino acids having the structure of Formula (XI).
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene)-
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 5 is H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, substituted aralkyl, -(alkylene or substituted alkylene)-ON(R") 2 , -(alkylene or substituted alkylene)-C(0)SR", -(alkylene or substituted alkylene)-S-S-(aryl or substituted aryl), -C(0)R", -C(0) 2 R", or -C(0)N(R") 2
  • amino acids having the structure of Formula (XIII):
  • R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 5 is H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, substituted aralkyl, -(alkylene or substituted alkylene)-ON(R") 2 , -(alkylene or substituted alkylene)-C(0)SR
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • Further non-limiting examples of such amino acids include amino acids having the following structures:
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • amino acids having the structure of Formula (XIV):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • each R' is independently H, alkyl, or substituted alkyl
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide
  • each of R 3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R 3 and R 4 or two R 3 groups optionally form a cycloalkyl or a heterocycloalkyl
  • each of R 6 and R 7 is independently selected from the group consisting of H, alkyl, substituted alkyl, al
  • R 6 or R 7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules
  • amino acids further include amino acids having the structure of Formula (XVI):
  • A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, -S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene)-
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0) k - where k is 1, 2, or 3, - S(0) k (alkylene or substituted alkylene)-, -C(O)-, -NS(0) 2 - -OS(0) 2 - -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')- -CON(R')-(alkylene)
  • each R' is independently H, alkyl, or substituted alkyl
  • Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide
  • R 2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide
  • each of R 6 and R 7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0) 2 R", -
  • R 6 or R 7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide
  • polypeptide polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • the non-natural amino acid can be according to formula XIX:
  • each of Wi, W 2 , and W 3 is independently a single bond or lower alkylene; each Xi is independently -NH-, -0-, or -S-; each Yi is independently a single bond, -NH-, or -0-; each Y 2 is independently a single bond, -NH-, -0-, or an N-linked or C-linked
  • the non-natural amino acid is according to formula XlXa:
  • W 4 is Ci-Cio alkylene.
  • W 4 is Ci-C 5 alkylene.
  • W 4 is C 1 -C3 alkylene.
  • W 4 is Ci alkylene.
  • the non-natural amino acid is selected from the group consisting of:
  • non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
  • the antibody comprises a non-natural amino acid having a reactive group, as described above.
  • a reactive group can be used to link the antibody to any molecular entity capable of forming a covalent bond to the non-natural amino acid, directly or indirectly via a linker.
  • Useful linkers include those described in the section above. In certain
  • the linker is any divalent or multivalent linker known to those of skill in the art. Generally, the linker is capable of forming covalent bonds to the functional moiety R and the alpha carbon of the non-natural amino acid. Useful divalent linkers a bond, alkylene, substituted alkylene, heteroalkylene, substituted heteroalkylene, arylene, substituted arylene, heteroarlyene and substituted heteroarylene. In certain embodiments, the linker is C 1-10 alkylene or C 1-10 heteroalkylene.
  • the molecular payload can be any molecular entity that one of skill in the art might desire to conjugate to the antibody. In certain embodiments, the payload is a therapeutic moiety.
  • the antibody conjugate can be used to target the therapeutic moiety to its molecular target.
  • the payload is a labeling moiety.
  • the antibody conjugate can be used to detect binding of the antibody to its target.
  • the payload is a cytotoxic moiety.
  • the conjugate can be used target the cytotoxic moiety to a diseased cell, for example a cancer cell, to initiate destruction or elimination of the cell. Conjugates comprising other molecular payloads apparent to those of skill in the art are within the scope of the conjugates described herein.
  • a conjugate can have a payload selected from the group consisting of a label, a dye, a polymer, a water-soluble polymer, polyethylene glycol, a derivative of polyethylene glycol, a photocrosslinker, a cytotoxic compound, a radionuclide, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a peptide, a water-soluble dendrimer, a cyclodextrin, an inhibitory ribonucleic acid, a biomaterial, a nanoparticle, a spin label, a fluorophore, a metal-containing moiety, a radioactive
  • a photocaged moiety noncovalently interacts with other molecules, a photocaged moiety, a photoisomerizable moiety, biotin, a derivative of biotin, a biotin analogue, a moiety incorporating a heavy atom, a chemically cleavable group, a photocleavable group, an elongated side chain, a carbon- linked sugar, a redox-active agent, an amino thioacid, a toxic moiety, an isotopically labeled moiety, a biophysical probe, a phosphorescent group, a chemiluminescent group, an electron dense group, a magnetic group, an intercalating group, a chromophore, an energy transfer agent, a biologically active agent, a detectable label, a small molecule, or any combination thereof.
  • Useful drug paylods include any cytotoxic, cytostatic or immunomodulatory drug.
  • Useful classes of cytotoxic or immunomodulatory agents include, for example, antitubulin agents, auristatins, DNA minor groove binders, DNA replication inhibitors, alkylating agents (e.g.
  • platinum complexes such as cis-platin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and carboplatin
  • anthracyclines antibiotics, antifolates, antimetabolites, calmodulin inhibitors, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, maytansinoids, nitrosoureas, platinols, pore-forming compounds, purine antimetabolites, puromycins, radiation sensitizers, rapamycins, steroids, taxanes, topoisomerase inhibitors, vinca alkaloids, or the like.
  • Individual cytotoxic or immunomodulatory agents include, for example, an androgen, anthramycin (AMC), asparaginase, 5-azacytidine, azathioprine, bleomycin, busulfan, buthionine sulfoximine, calicheamicin, calicheamicin derivatives, camptothecin, carboplatin, carmustine (BSNU), CC-1065, chlorambucil, cisplatin, colchicine,
  • cyclophosphamide cytarabine, cytidine arabinoside, cytochalasin B, dacarbazine,
  • dactinomycin (formerly actinomycin), daunorubicin, decarbazine, DM1 , DM4, docetaxel, doxorubicin, etoposide, an estrogen, 5-fluordeoxyuridine, 5-fluorouracil, gemcitabine, gramicidin D, hydroxyurea, idarubicin, ifosfamide, irinotecan, lomustine (CCNU), maytansine, mechlorethamine, melphalan, 6-mercaptopurine, methotrexate, mithramycin, mitomycin C, mitoxantrone, nitroimidazole, paclitaxel, palytoxin, plicamycin, procarbizine, rhizoxin, streptozotocin, tenoposide, 6-thioguanine, thioTEPA, topotecan, vinblastine, vincristine, vinorelbine, VP- 16 and VM-26.
  • suitable cytotoxic agents include, for example, DNA minor groove binders (e.g., enediynes and lexitropsins, a CBI compound; see also U.S. Pat. No. 6, 130,237), duocarmycins, taxanes (e.g., paclitaxel and docetaxel), puromycins, vinca alkaloids, CC-1065, SN-38, topotecan, morpholino-doxorubicin, rhizoxin, cyanomorpholino- doxorubicin, echinomycin, combretastatin, netropsin, epothilone A and B, estramustine, cryptophycins, cemadotin, maytansinoids, discodermolide, eleutherobin, and mitoxantrone.
  • DNA minor groove binders e.g., enediynes and lexitropsins, a CBI compound; see also U.S.
  • the payload is an anti-tubulin agent.
  • anti-tubulin agents include, but are not limited to, taxanes (e.g., Taxol® (paclitaxel), Taxotere® (docetaxel)), T67 (Tularik) and vinca alkyloids (e.g., vincristine, vinblastine, vindesine, and vinorelbine).
  • antitubulin agents include, for example, baccatin derivatives, taxane analogs, epothilones (e.g., epothilone A and B), nocodazole, colchicine and colcimid, estramustine, cryptophycins, cemadotin, maytansinoids, combretastatins, discodermolide, and eleutherobin.
  • the cytotoxic agent is a maytansinoid, another group of anti-tubulin agents.
  • the maytansinoid can be maytansine or DM-1 (ImmunoGen, Inc.; see also Chari et al., 1992, Cancer Res. 52: 127-131).
  • the payload is an auristatin, such as auristatin E or a derivative thereof.
  • the auristatin E derivative can be an ester formed between auristatin E and a keto acid.
  • auristatin E can be reacted with paraacetyl benzoic acid or benzoylvaleric acid to produce AEB and AEVB, respectively.
  • Other typical auristatin derivatives include AFP, MMAF, and MMAE.
  • the synthesis and structure of auristatin derivatives are described in U.S. Patent Application Publication Nos. 2003-0083263, 2005- 0238649 and 2005-0009751 ; International Patent Publication No. WO 04/010957,
  • the payload is not a radioisotope. In some embodiments, the payload is not radioactive.
  • the payload is an antimetabolite.
  • the antimetabolite can be, for example, a purine antagonist (e.g., azothioprine or mycophenolate mofetil), a dihydrofolate reductase inhibitor (e.g., methotrexate), acyclovir, ganciclovir, zidovudine, vidarabine, ribavarin, azidothymidine, cytidine arabinoside, amantadine, dideoxyuridine, iododeoxyuridine, poscarnet, or trifluridine.
  • a purine antagonist e.g., azothioprine or mycophenolate mofetil
  • a dihydrofolate reductase inhibitor e.g., methotrexate
  • acyclovir e.g., ganciclovir, zidovudine, vidarabine, ribavarin, azidothymidine, cy
  • the payload is tacrolimus, cyclosporine, FU506 or rapamycin.
  • the Drug is aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, anastrozole, arsenic trioxide, bexarotene, bexarotene, calusterone, capecitabine, celecoxib, cladribine, Darbepoetin alfa, Denileukin diftitox, dexrazoxane, dromostanolone propionate, epirubicin, Epoetin alfa, estramustine, exemestane, Filgrastim, floxuridine, fludarabine, fulvestrant, gemcitabine, gemtuzumab ozogamicin (MYLOTARG), goserelin, idarubicin, ifo
  • the payload is an immunomodulatory agent.
  • the immunomodulatory agent can be, for example, ganciclovir, etanercept, tacrolimus, cyclosporine, rapamycin, cyclophosphamide, azathioprine, mycophenolate mofetil or methotrexate.
  • the immunomodulatory agent can be, for example, a
  • glucocorticoid e.g., Cortisol or aldosterone
  • a glucocorticoid analogue e.g., prednisone or dexamethasone
  • the immunomodulatory agent is an anti-inflammatory agent, such as arylcarboxylic derivatives, pyrazole-containing derivatives, oxicam derivatives and nicotinic acid derivatives.
  • Classes of anti-inflammatory agents include, for example, cyclooxygenase inhibitors, 5 -lipoxygenase inhibitors, and leukotriene receptor antagonists.
  • Suitable cyclooxygenase inhibitors include meclofenamic acid, mefenamic acid, carprofen, diclofenac, diflunisal, fenbufen, fenoprofen, indomethacin, ketoprofen,
  • nabumetone nabumetone, sulindac, tenoxicam and tolmetin.
  • Suitable lipoxygenase inhibitors include redox inhibitors (e.g., catechol butane derivatives, nordihydroguaiaretic acid (NDGA), masoprocol, phenidone, Ianopalen, indazolinones, naphazatrom, benzofuranol, alkylhydroxylamine), and non-redox inhibitors (e.g., hydroxythiazoles, methoxyalkylthiazoles, benzopyrans and derivatives thereof, methoxytetrahydropyran, boswellic acids and acetylated derivatives of boswellic acids, and quinolinemethoxyphenylacetic acids substituted with cycloalkyl radicals), and precursors of redox inhibitors.
  • redox inhibitors e.g., catechol butane derivatives, nordihydroguaiaretic acid (NDGA), masoprocol, phenidone, Ianopalen, indazolinones, naphaz
  • antioxidants e.g., phenols, propyl gallate, flavonoids and/or naturally occurring substrates containing flavonoids, hydroxylated derivatives of the flavones, flavonol, dihydroquercetin, luteolin, galangin, orobol, derivatives of chalcone, 4,2',4'-trihydroxychalcone, ortho-aminophenols, N-hydroxyureas, benzofuranols, ebselen and species that increase the activity of the reducing selenoenzymes), iron chelating agents (e.g., hydroxamic acids and derivatives thereof, N-hydroxyureas, 2-benzyl-l-naphthol, catechols, hydroxylamines, carnosol trolox C, catechol, naphthol, sulfasalazine, zyleuton, 5- hydroxyanthranilic acid and 4-(ome
  • lipoxygenase inhibitors include inhibitors of eicosanoids (e.g., octadecatetraenoic, eicosatetraenoic, docosapentaenoic, eicosahexaenoic and docosahexaenoic acids and esters thereof, PGE1 (prostaglandin El), PGA2 (prostaglandin A2), viprostol, 15-monohydroxyeicosatetraenoic, 15-monohydroxy-eicosatrienoic and 15- monohydroxyeicosapentaenoic acids, and leukotrienes B5, C5 and D5), compounds interfering with calcium flows, phenothiazines, diphenylbutylamines, verapamil, fuscoside, curcumin, chlorogenic acid, caffeic acid, 5,8,11,14-eicosatetrayenoic acid (ETYA), hydroxyphenylretin
  • Leukotriene receptor antagonists include calcitriol, ontazolast, Bayer Bay-x-1005, Ciba-Geigy CGS-25019C, ebselen, Leo Denmark ETH-615, Lilly LY-293111, Ono ONO- 4057, Terumo TMK-688, Boehringer Ingleheim BI-RM-270, Lilly LY 213024, Lilly LY 264086, Lilly LY 292728, Ono ONO LB457, Pfizer 105696, Perdue Frederick PF 10042, Rhone-Poulenc Rorer RP 66153, SmithKlme Beecham SB-201146, SmithKlme Beecham SB-201993, SmithKlme Beecham SB-209247, Searle SC-53228, Sumitamo SM 15178, American Home Products WAY 121006, Bayer Bay-o-8276, Warner-Lambert CI-987, Warner-Lambert CI-987BPC-15
  • Other useful drug payloads include chemical compounds useful in the treatment of cancer.
  • chemotherapeutic agents include Erlotinib (TARCEVA®,
  • Lonafarnib (SCH 66336), Sorafenib (BAY43-9006, Bayer Labs), and Gefitinib (IRESSA®, AstraZeneca), AG1478, AG1571 (SU 5271; Sugen), alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa;
  • ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analog topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogs, KW-2189 and CB1-TM1);
  • pancratistatin a sarcodictyin
  • spongistatin nitrogen mustards such as chlorambucil, chlomaphazine, chlorophosphamide, estramustine, ifosfamide,
  • calicheamicin omegall Angew Chem. Intl. Ed. Engl. (1994) 33 : 183-186
  • dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6- diazo-5-oxo-L-norleucine, ADRIAMYCIN® (doxorubicin), morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubic
  • methotrexate, pteropterin, trimetrexate purine analogs such as fludarabine, 6- mercaptopurine, thiamniprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside;
  • aminolevulinic acid aminolevulinic acid
  • eniluracil amsacrine; bestrabucil
  • bisantrene edatraxate
  • defofamine demecolcine
  • diaziquone diaziquone
  • elformithine elliptinium acetate
  • an epothilone etoglucid
  • gallium nitrate hydroxyurea
  • lentinan lonidainine
  • maytansinoids such as maytansine and
  • ansamitocins mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin;
  • vindesine dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C”); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL® (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111.), and TAXOTERE® (doxetaxel; Rhone-Poulenc Rorer, Antony, France); chloranmbucil; GEMZAR® (gemcitabine); 6-thioguanine; mercaptopurine;
  • methotrexate platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; NAVELBINE® (vinorelbine); novantrone;
  • teniposide edatrexate; daunomycin; aminopterin; capecitabine (XELODA®); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
  • Other useful payloads include: (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®;
  • SERMs selective estrogen receptor modulators
  • aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® (megestrol acetate), AROMASIN® (exemestane; Pfizer), formestanie, fadrozole, RIVISOR® (vorozole), FEMARA® (letrozole; Novartis), and ARIMIDEX® (anastrozole; AstraZeneca); (iii) anti- androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as t
  • anti- angiogenic agents include MMP-2 (matrix -metalloproteinase 2) inhibitors, MMP-9 (matrix - metalloproteinase 9) inhibitors, COX-II (cyclooxygenase II) inhibitors, and VEGF receptor tyrosine kinase inhibitors.
  • VEGF receptor tyrosine kinase inhibitors include 4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(l-methylpiperidin-4-ylmethoxy)qu- -inazoline (ZD6474; Example 2 within WO 01/32651), 4-(4-fluoro-2-methylindol-5-yloxy)-6-methoxy- 7-(3-pyrrolidin-l-ylpropoxy)- -quinazoline (AZD2171; Example 240 within WO 00/47212), vatalanib (PTK787; WO 98/35985) and SU11248 (sunitinib; WO 01/60814), and compounds such as those disclosed in PCT Publication Nos. WO 97/22596, WO 97/30035, WO
  • the payload is an antibody or an antibody fragment.
  • the payload antibody or fragment can be encoded by any of the immunoglobulin genes recognized by those of skill in the art.
  • the immunoglobulin genes include, but are not limited to, the ⁇ , ⁇ , ⁇ , ⁇ (IgGl, IgG2, IgG3, and IgG4), ⁇ , ⁇ and ⁇ constant region genes, as well as the immunoglobulin variable region genes.
  • the term includes full- length antibodies and antibody fragments recognized by those of skill in the art, and variants thereof.
  • Exemplary fragments include but are not limited to Fv, Fc, Fab, and (Fab') 2 , single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1, CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like.
  • the payload is one or more water-soluble polymers.
  • a wide variety of macromolecular polymers and other molecules can be linked to antigen- binding polypeptides of the present invention to modulate biological properties of the antibody, and/or provide new biological properties to the antibody.
  • These macromolecular polymers can be linked to the antibody via a naturally encoded amino acid, via a non- naturally encoded amino acid, or any functional substituent of a natural or non-natural amino acid, or any substituent or functional group added to a natural or non-natural amino acid.
  • the molecular weight of the polymer may be of a wide range, including but not limited to, between about 100 Da and about 100,000 Da or more.
  • the polymer selected may be water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological
  • the polymer may be branched or unbranched.
  • the polymer will be pharmaceutically acceptable.
  • the proportion of polyethylene glycol molecules to antibody molecules will vary, as will their concentrations in the reaction mixture.
  • the optimum ratio in terms of efficiency of reaction in that there is minimal excess unreacted protein or polymer
  • the molecular weight of the polyethylene glycol selected and on the number of available reactive groups available As relates to molecular weight, typically the higher the molecular weight of the polymer, the fewer number of polymer molecules which may be attached to the protein. Similarly, branching of the polymer should be taken into account when optimizing these parameters. Generally, the higher the molecular weight (or the more branches) the higher the polymer :protein ratio.
  • the water soluble polymer may be any structural form including but not limited to linear, forked or branched.
  • the water soluble polymer is a poly(alkylene glycol), such as poly(ethylene glycol) (PEG), but other water soluble polymers can also be employed.
  • PEG poly(ethylene glycol)
  • PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
  • a PEG used in the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CI3 ⁇ 4 ("methoxy PEG").
  • the PEG can terminate with a reactive group, thereby forming a bifunctional polymer.
  • Typical reactive groups can include those reactive groups that are commonly used to react with the functional groups found in the 20 common amino acids (including but not limited to, maleimide groups, activated carbonates (including but not limited to, p-nitrophenyl ester), activated esters (including but not limited to, N-hydroxysuccinimide, p-nitrophenyl ester) and aldehydes) as well as functional groups that are inert to the 20 common amino acids but that react specifically with complementary functional groups present in non-naturally encoded amino acids (including but not limited to, azide groups, alkyne groups).
  • Y may be an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the polypeptide.
  • Y may be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine).
  • Y may be a linkage to a residue not commonly accessible via the 20 common amino acids.
  • an azide group on the PEG can be reacted with an alkyne group on the antibody to form a Huisgen [3+2] cycloaddition product.
  • an alkyne group on the PEG can be reacted with an azide group present in a non-naturally encoded amino acid to form a similar product.
  • a strong nucleophile including but not limited to, hydrazine, hydrazide, hydroxylamine,
  • semicarbazide can be reacted with an aldehyde or ketone group present in a non-naturally encoded amino acid to form a hydrazone, oxime or semicarbazone, as applicable, which in some cases can be further reduced by treatment with an appropriate reducing agent.
  • the strong nucleophile can be incorporated into the antibody via a non- naturally encoded amino acid and used to react preferentially with a ketone or aldehyde group present in the water soluble polymer.
  • Any molecular mass for a PEG can be used as practically desired, including but not limited to, from about 100 Daltons (Da) to 100,000 Da or more as desired (including but not limited to, sometimes 0.1-50 kDa or 10-40 kDa).
  • Branched chain PEGs including but not limited to, PEG molecules with each chain having a MW ranging from 1-100 kDa (including but not limited to, 1-50 kDa or 5-20 kDa) can also be used.
  • a wide range of PEG molecules are described in, including but not limited to, the Shearwater Polymers, Inc. catalog, Nektar Therapeutics catalog, incorporated herein by reference.
  • the PEG molecule is available for reaction with the non-naturally-encoded amino acid.
  • PEG derivatives bearing alkyne and azide moieties for reaction with amino acid side chains can be used to attach PEG to non- naturally encoded amino acids as described herein.
  • the non-naturally encoded amino acid comprises an azide
  • the PEG will typically contain either an alkyne moiety to effect formation of the [3+2] cycloaddition product or an activated PEG species (i.e., ester, carbonate) containing a phosphine group to effect formation of the amide linkage.
  • the PEG will typically contain an azide moiety to effect formation of the [3+2] Huisgen cycloaddition product.
  • the PEG will typically comprise a potent nucleophile (including but not limited to, a hydrazide, hydrazine, hydroxylamine, or semicarbazide functionality) in order to effect formation of corresponding hydrazone, oxime, and semicarbazone linkages, respectively.
  • a reverse of the orientation of the reactive groups described above can be used, i.e., an azide moiety in the non-naturally encoded amino acid can be reacted with a PEG derivative containing an alkyne.
  • the antibody variant with a PEG derivative contains a chemical functionality that is reactive with the chemical functionality present on the side chain of the non-naturally encoded amino acid.
  • the payload is an azide- or acetylene-containing polymer comprising a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da.
  • the polymer backbone of the water-soluble polymer can be poly(ethylene glycol).
  • water soluble polymers including but not limited to poly(ethylene)glycol and other related polymers, including poly(dextran) and poly(propylene glycol), are also suitable for use in the practice of this invention and that the use of the term PEG or poly(ethylene glycol) is intended to encompass and include all such molecules.
  • PEG includes, but is not limited to, poly(ethylene glycol) in any of its forms, including bifunctional PEG, multiarmed PEG, derivatized PEG, forked PEG, branched PEG, pendent PEG (i.e. PEG or related polymers having one or more functional groups pendent to the polymer backbone), or PEG with degradable linkages therein.
  • the polymer backbone can be linear or branched.
  • Branched polymer backbones are generally known in the art.
  • a branched polymer has a central branch core moiety and a plurality of linear polymer chains linked to the central branch core.
  • PEG is commonly used in branched forms that can be prepared by addition of ethylene oxide to various polyols, such as glycerol, glycerol oligomers, pentaerythritol and sorbitol.
  • the central branch moiety can also be derived from several amino acids, such as lysine.
  • the branched poly(ethylene glycol) can be represented in general form as R(-PEG-OH) m in which R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol, and m represents the number of arms.
  • R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol
  • m represents the number of arms.
  • Multi-armed PEG molecules such as those described in U.S. Pat. Nos. 5,932,462 5,643,575; 5,229,490; 4,289,872; U.S. Pat. Appl. 2003/0143596; WO 96/21469; and WO 93/21259, each of which is incorporated by reference herein in its entirety, can also be used as the polymer backbone.
  • Branched PEG can also be in the form of a forked PEG represented by PEG(- YCHZ 2 ) n , where Y is a linking group and Z is an activated terminal group linked to CH by a chain of atoms of defined length.
  • the pendant PEG has reactive groups, such as carboxyl, along the PEG backbone rather than at the end of PEG chains.
  • the polymer can also be prepared with weak or degradable linkages in the backbone.
  • PEG can be prepared with ester linkages in the polymer backbone that are subject to hydrolysis. As shown below, this hydrolysis results in cleavage of the polymer into fragments of lower molecular weight: -PEG-C0 2 - PEG-+H 2 0 ⁇ PEG-C0 2 H+HO-PEG- It is understood by those skilled in the art that the term poly(ethylene glycol) or PEG represents or includes all the forms known in the art including but not limited to those disclosed herein.
  • polymer backbones that are water-soluble, with from 2 to about 300 termini, are particularly useful in the invention.
  • suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) ("PPG"), copolymers thereof (including but not limited to copolymers of ethylene glycol and propylene glycol), terpolymers thereof, mixtures thereof, and the like.
  • PPG poly(propylene glycol)
  • the molecular weight of each chain of the polymer backbone can vary, it is typically in the range of from about 800 Da to about 100,000 Da, often from about 6,000 Da to about 80,000 Da.
  • the polymer derivatives are "multifunctional", meaning that the polymer backbone has at least two termini, and possibly as many as about 300 termini, functionalized or activated with a functional group.
  • Multifunctional polymer derivatives include, but are not limited to, linear polymers having two termini, each terminus being bonded to a functional group which may be the same or different.
  • Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms. A heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain.
  • the alkyl chain may also be branched at a heteroatom.
  • a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms.
  • the aryl group may be substituted with one more carbon atoms, nitrogen, oxygen or sulfur atoms.
  • suitable linking groups include those linking groups described in U.S. Pat. Nos. 5,932,462; 5,643,575; and U.S. Pat. Appl. Publication 2003/0143596, each of which is incorporated by reference herein.
  • Examples of suitable functional groups for use as X include, but are not limited to, hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1-benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1-benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, tresylate,
  • the selected X moiety should be compatible with the azide group so that reaction with the azide group does not occur.
  • the azide-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an azide moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
  • the term "protected” refers to the presence of a protecting group or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions. The protecting group will vary depending on the type of chemically reactive group being protected.
  • the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldisulfide. If the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group, the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl. Other protecting groups known in the art may also be used in the present invention.
  • terminal functional groups in the literature include, but are not limited to, N-succinimidyl carbonate (see e.g., U.S. Pat. Nos. 5,281,698, 5,468,478), amine (see, e.g., Buckmann et al. Makromol. Chem. 182: 1379 (1981), Zaplipsky et al. Eur. Polym. J. 19: 1177 (1983)), hydrazide (See, e.g., Andresz et al. Makromol. Chem. 179:301 (1978)), succinimidyl propionate and succinimidyl butanoate (see, e.g., Olson et al.
  • succinimidyl succinate See, e.g., Abuchowski et al. Cancer Biochem. Biophys. 7: 175 (1984) and Joppich et al. Macrolol. Chem. 180: 1381 (1979), succinimidyl ester (see, e.g., U.S. Pat. No.
  • benzotriazole carbonate see, e.g., U.S. Pat. No. 5,650,234
  • glycidyl ether see, e.g., Pitha et al. Eur. J Biochem. 94: 11 (1979), Elling et al, Biotech. Appl. Biochem. 13:354 (1991)
  • oxycarbonylimidazole see, e.g., Beauchamp, et al, Anal. Biochem. 131 :25 (1983), Tondelli et al. J. Controlled Release 1 :251 (1985)
  • p-nitrophenyl carbonate see, e.g., Veronese, et al, Appl.
  • the azide-containing PEG derivatives of the invention can be prepared by a variety of methods known in the art and/or disclosed herein.
  • a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da is reacted with an azide anion (which may be paired with any of a number of suitable counter-ions, including sodium, potassium, tert-butylammonium and so forth).
  • the leaving group undergoes a nucleophilic displacement and is replaced by the azide moiety, affording the desired azide-containing PEG polymer as shown in the following: X-PEG-L+N3 ⁇ ⁇ X-PEG-N3.
  • a suitable polymer backbone for use in the present invention has the formula X-PEG-L, wherein PEG is poly(ethylene glycol) and X is a functional group which does not react with azide groups and L is a suitable leaving group.
  • suitable functional groups include, but are not limited to, hydroxyl, protected hydroxyl, acetal, alkenyl, amine, aminooxy, protected amine, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, maleimide, dithiopyridine, and vinylpyridine, and ketone.
  • suitable leaving groups include, but are not limited to, chloride, bromide, iodide, mesylate, tresylate, and tosylate.
  • a linking agent bearing an azide functionality is contacted with a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, wherein the linking agent bears a chemical functionality that will react selectively with a chemical functionality on the PEG polymer, to form an azide-containing polymer derivative product wherein the azide is separated from the polymer backbone by a linking group.
  • PEG polyethylene glycol
  • X is a capping group such as alkoxy or a functional group as described above
  • M is a functional group that is not reactive with the azide functionality but that will react efficiently and selectively with the N functional group.
  • suitable functional groups include, but are not limited to, M being a carboxylic acid, carbonate or active ester if N is an amine; M being a ketone if N is a hydrazide or aminooxy moiety; M being a leaving group if N is a nucleophile.
  • Purification of the crude product may be accomplished by known methods including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
  • the amine group can be coupled to the carboxylic acid group using a variety of activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole to create an amide bond between the monoamine PEG derivative and the azide-bearing linker moiety.
  • activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole to create an amide bond between the monoamine PEG derivative and the azide-bearing linker moiety.
  • the resulting N-tert-butyl-Boc-protected azide-containing derivative can be used directly to modify bioactive molecules or it can be further elaborated to install other useful functional groups.
  • the N-t-Boc group can be hydrolyzed by treatment with strong acid to generate an omega-amino-PEG-azide.
  • the resulting amine can be used as
  • Heterobifunctional derivatives are particularly useful when it is desired to attach different molecules to each terminus of the polymer.
  • the omega-N-amino-N- azido PEG would allow the attachment of a molecule having an activated electrophilic group, such as an aldehyde, ketone, activated ester, activated carbonate and so forth, to one terminus of the PEG and a molecule having an acetylene group to the other terminus of the PEG.
  • Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms.
  • a heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain.
  • the alkyl chain may also be branched at a heteroatom.
  • Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms.
  • the aryl group may be substituted with one more carbon atoms, nitrogen, oxygen, or sulfur atoms.
  • Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos.
  • linking moieties is by no means exhaustive and is intended to be merely illustrative, and that a wide variety of linking moieties having the qualities described above are contemplated to be useful in the present invention.
  • Examples of suitable functional groups for use as X include hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1-benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1-benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, ketone, ket
  • the selected X moiety should be compatible with the acetylene group so that reaction with the acetylene group does not occur.
  • the acetylene-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an acetylene moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
  • the acetylene-containing PEG derivatives of the invention can be prepared using methods known to those skilled in the art and/or disclosed herein.
  • a preferred polymer backbone for use in the reaction has the formula X-PEG-Nu, wherein PEG is poly(ethylene glycol), Nu is a nucleophilic moiety and X is a functional group that does not react with Nu, L or the acetylene functionality.
  • Nu examples include, but are not limited to, amine, alkoxy, aryloxy, sulfhydryl, imino, carboxylate, hydrazide, aminoxy groups that would react primarily via a SN2-type mechanism. Additional examples of Nu groups include those functional groups that would react primarily via an nucleophilic addition reaction. Examples of L groups include chloride, bromide, iodide, mesylate, tresylate, and tosylate and other groups expected to undergo nucleophilic displacement as well as ketones, aldehydes, thioesters, olefins, alpha- beta unsaturated carbonyl groups, carbonates and other electrophilic groups expected to undergo addition by nucleophiles.
  • A is an aliphatic linker of between 1-10 carbon atoms or a substituted aryl ring of between 6-14 carbon atoms.
  • X is a functional group which does not react with azide groups and L is a suitable leaving group.
  • a PEG polymer having an average molecular weight from about 800 Da to about 100,000 Da, bearing either a protected functional group or a capping agent at one terminus and a suitable leaving group at the other terminus is contacted by an acetylene anion.
  • Water soluble polymers can be linked to the antibodies of the invention.
  • the water soluble polymers may be linked via a non-naturally encoded amino acid incorporated in the antibodies or any functional group or substituent of a non-naturally encoded or naturally encoded amino acid, or any functional group or substituent added to a non-naturally encoded or naturally encoded amino acid.
  • the water soluble polymers are linked to an antigen-binding polypeptide incorporating a non-naturally encoded amino acid via a naturally-occurring amino acid (including but not limited to, cysteine, lysine or the amine group of the N-terminal residue).
  • the antibodies of the invention comprise 1,
  • the antibodies of the invention further comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 non-natural amino acids, wherein one or more non-naturally-encoded amino acid(s) are linked to water soluble polymer(s) (including but not limited to, PEG and/or oligosaccharides).
  • the antibodies of the invention further comprise 1, 2,
  • the antibody of the invention comprise one or more non-naturally encoded amino acid(s) linked to water soluble polymers and one or more naturally-occurring amino acids linked to water soluble polymers.
  • the water soluble polymers used in the present invention enhance the serum half-life of the antibodies relative to the unconjugated form.
  • the number of water soluble polymers linked to an antigen-binding polypeptide i.e., the extent of PEGylation or glycosylation
  • the number of water soluble polymers linked to an antigen-binding polypeptide can be adjusted to provide an altered (including but not limited to, increased or decreased) pharmacologic, pharmacokinetic or pharmacodynamic characteristic such as in vivo half-life.
  • the half-life of antibody is increased at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 percent, 2-fold, 5-fold, 10-fold, 50-fold, or at least about 100-fold over an unmodified polypeptide.
  • an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety that is linked directly to the PEG backbone.
  • the hydroxylamine-terminal PEG derivative will have the structure: RO-(CH 2 CH 2 0) n -0-(CH 2 ) m -0-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
  • the hydrazine- or hydrazide-containing PEG derivative will have the structure: RO-(CH 2 CH 2 0) n -0-(CH 2 ) m -X-NH-NH 2 where R is a simple alkyl
  • the semicarbazide-containing PEG derivative will have the structure: RO-(CH 2 CH 2 0) n -0-(CH 2 ) m -NH-C(0)-NH-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
  • an antigen-binding polypeptide comprising a carbonyl-containing amino acid is modified with a PEG derivative that contains a terminal hydroxylamine, hydrazide, hydrazine, or semicarbazide moiety that is linked to the PEG backbone by means of an amide linkage.
  • the hydroxylamine-terminal PEG derivatives have the structure: RO-(CH 2 CH 2 0) generous-0-(CH 2 ) 2 -NH-C(0)(CH 2 ) m -0-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
  • the semicarbazide-containing PEG derivatives have the structure: RO-(CH 2 CH 2 0) relieve-0-(CH 2 ) 2 -NH-C(0)(CH 2 ) m -NH-C(0)-NH-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
  • an antibody comprising a carbonyl- containing amino acid is modified with a branched PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
  • an antibody comprising a non-naturally encoded amino acid is modified with a PEG derivative having a branched structure.
  • the PEG derivatives containing a semicarbazide group will have the structure: [RO-(CH 2 CH 2 0) n -0-(CH 2 ) 2 -C(0)-NH-CH 2 - CH 2 ] 2 CH-X-(CH 2 ) m - NH-C(0)-NH-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1,000.
  • the PEG derivatives containing a hydroxylamine group will have the structure: [RO-(CH 2 CH 2 0) n -0-(CH 2 ) 2 -C(0)-NH-CH 2 - CH 2 ] 2 CH-X- (CH 2 ) m -0-NH 2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1,000.
  • the degree and sites at which the water soluble polymer(s) are linked to the antibodies can modulate the binding of the antibodies to an antigen or receptor.
  • PEGylation i.e., addition of any water soluble polymer
  • antigen-binding polypeptides containing a non-naturally encoded amino acid such as p-azido-L- phenylalanine
  • the aqueous solution is buffered with a buffer having a pK a near the pH at which the reaction is to be carried out (generally about pH 4-10).
  • a buffer having a pK a near the pH at which the reaction is to be carried out generally about pH 4-10.
  • suitable buffers for PEGylation at pH 7.5 include, but are not limited to, HEPES, phosphate, borate, TRIS-HCl, EPPS, and TES.
  • the pH is continuously monitored and adjusted if necessary.
  • the reaction is typically allowed to continue for between about 1-48 hours.
  • the eluent containing the desired conjugates is concentrated by ultrafiltration and desalted by diafiltration.
  • chromatography can be purified further by one or more procedures known to those skilled in the art including, but are not limited to, affinity chromatography; anion- or cation-exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal- chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility
  • a water soluble polymer linked to an amino acid of an antibody of the invention can be further derivatized or substituted without limitation.
  • an antigen-binding polypeptide is modified with a PEG derivative that contains an azide moiety that will react with an alkyne moiety present on the side chain of the non-naturally encoded amino acid.
  • the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
  • the azide-terminal PEG derivative will have the structure: RO-(CH 2 CH 2 0) n -0-(CH 2 ) m -N3 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
  • the azide-terminal PEG derivative will have the structure: RO-(CH 2 CH20) n -0-(CH2) m -NH-C(0)-(CH2)p-N 3 , where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
  • an antibody comprising a alkyne- containing amino acid is modified with a branched PEG derivative that contains a terminal azide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
  • an antigen-binding polypeptide is modified with a PEG derivative that contains an alkyne moiety that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
  • an antibody comprising an alkyne- containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal azide or terminal alkyne moiety that is linked to the PEG backbone by means of an amide linkage.
  • an antigen-binding polypeptide comprising an azide-containing amino acid is modified with a branched PEG derivative that contains a terminal alkyne moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
  • an antibody is modified with a PEG derivative that contains an activated functional group (including but not limited to, ester, carbonate) further comprising an aryl phosphine group that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
  • an activated functional group including but not limited to, ester, carbonate
  • an aryl phosphine group that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
  • the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
  • PEG molecules that may be linked to antibodies, as well as PEGylation methods include those described in, e.g., U.S. Patent Publication Nos.
  • 2004/0001838 ; 2002/0052009; 2003/0162949; 2004/0013637; 2003/0228274; 2003/0220447; 2003/0158333; 2003/0143596; 2003/0114647; 2003/0105275; 2003/0105224; 2003/0023023; 2002/0156047; 2002/0099133; 2002/0086939; 2002/0082345; 2002/0072573; 2002/0052430; 2002/0040076; 2002/0037949; 2002/0002250; 2001/0056171; 2001/0044526; 2001/0027217; 2001/0021763; U.S. Pat. Nos.
  • the antibodies can be linked to the payloads with one or more linkers capable of reacting with the non-natural amino acid.
  • the one or more linkers can be any linkers apparent to those of skill in the art.
  • linker is used herein to refer to groups or bonds that normally are formed as the result of a chemical reaction and typically are covalent linkages.
  • Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time, perhaps even indefinitely.
  • Hydrolytically unstable or degradable linkages mean that the linkages are degradable in water or in aqueous solutions, including for example, blood.
  • Enzymatically unstable or degradable linkages mean that the linkage can be degraded by one or more enzymes.
  • PEG and related polymers may include degradable linkages in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule.
  • ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent generally hydrolyze under physiological conditions to release the agent.
  • hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
  • Branched linkers may be used in antibodies of the invention.
  • a number of different cleavable linkers are known to those of skill in the art. See U.S. Pat. Nos. 4,618,492; 4,542,225, and 4,625,014.
  • the mechanisms for release of an agent from these linker groups include, for example, irradiation of a photolabile bond and acid-catalyzed hydrolysis.
  • 4,671,958 includes a description of immunoconjugates comprising linkers which are cleaved at the target site in vivo by the proteolytic enzymes of the patient's complement system.
  • the length of the linker may be predetermined or selected depending upon a desired spatial relationship between the antibody and the molecule linked to it.
  • Any hetero- or homo-bifunctional linker can be used to link the conjugates.
  • the linker may have a wide range of molecular weight or molecular length. Larger or smaller molecular weight linkers may be used to provide a desired spatial relationship or
  • Linkers having longer or shorter molecular length may also be used to provide a desired space or flexibility between the antibody and the linked entity.
  • a linker having a particular shape or conformation may be utilized to impart a particular shape or conformation to the antibody or the linked entity, either before or after the antibody reaches its target.
  • the functional groups present on each end of the linker may be selected to modulate the release of an antibody or a payload under desired conditions. This optimization of the spatial relationship between the antibody and the linked entity may provide new, modulated, or desired properties to the molecule.
  • the invention provides water-soluble bifunctional linkers that have a dumbbell structure that includes: a) an azide, an alkyne, a hydrazine, a hydrazide, a hydroxylamine, or a carbonyl-containing moiety on at least a first end of a polymer backbone; and b) at least a second functional group on a second end of the polymer backbone.
  • the second functional group can be the same or different as the first functional group.
  • the second functional group in some embodiments, is not reactive with the first functional group.
  • the invention provides, in some embodiments, water-soluble compounds that comprise at least one arm of a branched molecular structure.
  • the branched molecular structure can be dendritic.
  • the parent antibody can be any antibody known to those of skill in the art, or later discovered, without limitation.
  • the parent antibody may be substantially encoded by an antibody gene or antibody genes from any organism, including but not limited to humans, mice, rats, rabbits, camels, llamas, dromedaries, monkeys, particularly mammals and particularly human and particularly mice and rats.
  • the parent antibody may be fully human, obtained for example from a patient or subject, by using transgenic mice or other animals (Bruggemann & Taussig, 1997, Curr. Opin. Biotechnol. 8:455-458) or human antibody libraries coupled with selection methods (Griffiths & Duncan, 1998, Curr. Opin. Biotechnol. 9: 102-108).
  • the parent antibody may be from any source, including artificial or naturally occurring.
  • parent antibody can be an engineered antibody, including but not limited to chimeric antibodies and humanized antibodies (Clark, 2000, Immunol. Today 21 :397-402) or derived from a combinatorial library.
  • the parent antibody may be an engineered variant of an antibody that is substantially encoded by one or more natural antibody genes.
  • the parent antibody is an antibody that has been identified by affinity maturation.
  • the parent antibody can have affinity to any antigen known to those of skill in the art, or later discovered. Virtually any substance may be an antigen for a parent antibody, or an antibody of the present description. Examples of useful antigens include, but are not limited to, Alpha- 1 antitrypsin, Angiostatin, Antihemo lytic factor, antibodies,
  • chemoattractant protein- 1 monocyte chemoattractant protein-2, monocyte chemoattractant protein-3, monocyte inflammatory protein- 1 alpha, monocyte inflammatory protein- 1 beta, RANTES, 1309, R83915, R91733, HCC1, T58847, D31065, T64262), CD40 ligand, C-kit ligand, collagen, colony stimulating factor (CSF), complement factor 5a, complement inhibitor, complement receptor 1, cytokines, (e.g., epithelial neutrophil activating peptide-78, GRO/MGSA, GRO, GRO, MIP-1, MIP-1, MCP-1), epidermal growth factor (EGF), erythropoietin ("EPO"), exfoliating toxins A and B, factor IX, factor VII, factor VIII, factor X, fibroblast growth factor (FGF), fibrinogen, fibronectin, G-CSF, GM-CSF,
  • glucocerebrosidase gonadotropin, growth factors, hedgehog proteins (e.g., Sonic, Indian, Desert), hemoglobin, hepatocyte growth factor (HGF), hirudin, human serum albumin, insulin, insulin-like growth factor (IGF), interferons (e.g., IFN-a, IFN-, IFN- ⁇ ), interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, etc.), keratinocyte growth factor (KGF), lactoferrin, leukemia inhibitory factor, luciferase, neurturin, neutrophil inhibitory factor (NIF), oncostatin M, osteogenic protein, parathyroid hormone, PD-ECSF, PDGF, peptide hormones (e.g., human growth hormone), pleiotropin, protein A, protein G, pyrogenic
  • Additional antigens include, but are not limited to, transcriptional and expression activators.
  • exemplary transcriptional and expression activators include genes and proteins that modulate cell growth, differentiation, regulation, or the like.
  • transcriptional activators are found in prokaryotes, viruses, and eukaryotes, including fungi, plants, and animals, including mammals, providing a wide range of therapeutic targets. It will be appreciated that expression and transcriptional activators regulate transcription by many mechanisms, e.g., by binding to receptors, stimulating a signal transduction cascade, regulating expression of transcription factors, binding to promoters and enhancers, binding to proteins that bind to promoters and enhancers, unwinding DNA, splicing pre-mRNA, polyadenylating RNA, and degrading RNA.
  • Antigens include, but are not limited to, expression activators such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL-1, IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-a, TGF- ⁇ , EGF, KGF, SCF/c-Kit,
  • expression activators such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL-1, IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-a, TGF- ⁇ , EGF, KGF, SCF/c-Kit,
  • CD40L/CD40, VLA-4VCAM-1, ICAM-l/LFA-1 , and hyalurin/CD44 signal transduction molecules and corresponding oncogene products, e.g. , Mos, Ras, Raf, and Met; and transcriptional activators and suppressors, e.g., p53, Tat, Fos, Myc, Jun, Myb, Rel, and steroid hormone receptors such as those for estrogen, progesterone, testosterone, aldosterone, the LDL receptor ligand and corticosterone.
  • Vaccine proteins may be antigens including, but not limited to, proteins from infectious fungi, e.g., Aspergillus, Candida species; bacteria, particularly E. coli, which serves a model for pathogenic bacteria, as well as medically important bacteria such as Staphylococci ⁇ e.g., aureus), or Streptococci ⁇ e.g., pneumoniae); protozoa such as sporozoa ⁇ e.g., Plasmodia), rhizopods ⁇ e.g., Entamoeba) and flagellates ⁇ Trypanosoma, Leishmania, Trichomonas, Giardia, etc.); viruses such as (+) RNA viruses (examples include Poxviruses e.g., vaccinia; Picornaviruses, e.g.
  • RNA viruses ⁇ e.g., Rhabdoviruses, e.g., VSV; Paramyxovimses, e.g., RSV; Orthomyxovimses, e.g., influenza; Bunyaviruses; and Arenaviruses), dsDNA viruses (Reoviruses, for example), RNA to DNA viruses, i.e., Retroviruses, e.g., HIV and HTLV, and certain DNA to RNA viruses such as Hepatitis B.
  • Rhabdoviruses e.g., VSV
  • Paramyxovimses e.g., RSV
  • Orthomyxovimses e.g., influenza
  • Bunyaviruses Bunyaviruses
  • Arenaviruses dsDNA viruses
  • Reoviruses for example
  • RNA to DNA viruses i.e., Retroviruses, e.g., HIV and HTLV
  • certain DNA to RNA viruses such as Hepatit
  • Antigens may be enzymes including, but not limited to, amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases, glycosidases, glycosyl transferases, haloperoxidases, monooxygenases ⁇ e.g., p450s), lipases, lignin peroxidases, nitrile hydratases, nitrilases, proteases, phosphatases, subtilisins, transaminase, and nucleases.
  • amidases amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases
  • Agriculturally related proteins such as insect resistance proteins ⁇ e.g., the Cry proteins), starch and lipid production enzymes, plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins, plant growth enzymes ⁇ e.g., Ribulose 1,5- Bisphosphate Carboxylase/Oxygenase, "RUBISCO"), lipoxygenase (LOX), and
  • Phosphoenolpyruvate (PEP) carboxylase may also be antigens.
  • the antigen may be a disease-associated molecule, such as tumor surface antigen such as B-cell idiotypes, CD20 on malignant B cells, CD33 on leukemic blasts, and HER2/neu on breast cancer.
  • the antigen may be a growth factor receptor.
  • the growth factors include, but are not limited to, epidermal growth factors (EGFs), transferrin, insulin-like growth factor, transforming growth factors (TGFs), interleukin-1, and interleukin-2.
  • EGFs epidermal growth factors
  • TGFs transforming growth factors
  • interleukin-1 interleukin-1
  • interleukin-2 interleukin-2
  • Antibodies of the invention may be used to treat a variety of cancers.
  • the antigen may also be cell surface protein or receptor associated with coronary artery disease such as platelet glycoprotein Ilb/IIIa receptor, autoimmune diseases such as CD4, CAMPATH-1 and lipid A region of the gram-negative bacterial lipopolysaccharide.
  • autoimmune diseases such as CD4
  • CAMPATH-1 lipid A region of the gram-negative bacterial lipopolysaccharide.
  • Humanized antibodies against CD4 have been tested in clinical trials in the treatment of patients with mycosis fungoides, generalized postular psoriasis, severe psoriasis, and rheumatoid arthritis.
  • Antibodies against lipid A region of the gram-negative bacterial lipopolysaccharide have been tested clinically in the treatment of septic shock.
  • Antibodies against CAMPATH-1 have also been tested clinically in the treatment of against refractory rheumatoid arthritis.
  • antibodies provided herein may be used to treat a variety of autoimmune diseases.
  • Useful antigens also include proteins or peptides associated with human allergic diseases, such as inflammatory mediator proteins, e.g. interleukin-1 (IL-1), tumor necrosis factor (TNF), leukotriene receptor and 5 -lipoxygenase, and adhesion molecules such as V- CAM/VLA-4.
  • IgE may also serve as the antigen because IgE plays pivotal role in type I immediate hypersensitive allergic reactions such as asthma. Studies have shown that the level of total serum IgE tends to correlate with severity of diseases, especially in asthma. Burrows et al. (1989) "Association of asthma with serum IgE levels and skin-test reactivity to allergens" New Engl. L. Med. 320:271-277.
  • Antibodies selected against IgE may be used to reduce the level of IgE or block the binding of IgE to mast cells and basophils in the treatment of allergic diseases without having substantial impact on normal immune functions.
  • the antigen may also be a viral surface or core protein which may serve as an antigen to trigger immune response of the host.
  • viral proteins include, but are not limited to, glycoproteins (or surface antigens, e.g., GP120 and GP41) and capsid proteins (or structural proteins, e.g., P24 protein); surface antigens or core proteins of hepatitis A, B, C, D or E virus (e.g.
  • SHBsAg small hepatitis B surface antigen (SHBsAg) of hepatitis B virus and the core proteins of hepatitis C virus, NS3, NS4 and NS5 antigens); glycoprotein (G-protein) or the fusion protein (F-protein) of respiratory syncytial virus (RSV); surface and core proteins of herpes simplex virus HSV-1 and HSV-2 (e.g., glycoprotein D from HSV-2).
  • SHBsAg small hepatitis B surface antigen
  • G-protein glycoprotein
  • F-protein fusion protein
  • RSV respiratory syncytial virus
  • HSV-1 and HSV-2 e.g., glycoprotein D from HSV-2
  • the antigen may also be a mutated tumor suppressor gene product that has lost its tumor-suppressing function and may render the cells more susceptible to cancer.
  • Tumor suppressor genes are genes that function to inhibit the cell growth and division cycles, thus preventing the development of neoplasia. Mutations in tumor suppressor genes cause the cell to ignore one or more of the components of the network of inhibitory signals, overcoming the cell cycle check points and resulting in a higher rate of controlled cell growth-cancer.
  • tumor suppressor genes include, but are not limited to, DPC-4, NF-1 , NF-2, RB, p53, WTl , BRCAl and BRCA2.
  • DPC-4 is involved in pancreatic cancer and participates in a cytoplasmic pathway that inhibits cell division.
  • NF-1 codes for a protein that inhibits Ras, a cytoplasmic inhibitory protein.
  • NF-1 is involved in neurofibroma and
  • NF-2 encodes a nuclear protein that is involved in meningioma, schwanoma, and ependymoma of the nervous system.
  • RB codes for the pRB protein, a nuclear protein that is a major inhibitor of cell cycle. RB is involved in retinoblastoma as well as bone, bladder, small cell lung and breast cancer.
  • p53 codes for p53 protein that regulates cell division and can induce apoptosis. Mutation and/or inaction of p53 is found in a wide ranges of cancers. WTl is involved in Wilms tumor of the kidneys. BRCAl is involved in breast and ovarian cancer, and BRCA2 is involved in breast cancer.
  • Antibodies may be used to block the interactions of the gene product with other proteins or biochemicals in the pathways of tumor onset and development.
  • the antigen may be a CD molecule including but not limited to, CD la, CD lb, CDlc, CDld, CD2, CD3y, CD35, CD3s, CD4, CD5, CD6, CD7, CD8a, CD8p, CD9, CD10, CDl la, CDl lb, CDl lc, CDwl2, CD13, CD14, CD15, CD15s, CD16a, CD16b, CD18, CD19, CD20, CD21 , CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31 , CD32, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45R, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD41 , CD
  • the antigen may be VEGF, VEGF receptor, EGFR, Her2, TNFa, TNFRI receptor, GPIIb/IIIa, IL-2R alpha chain, IL-2R beta chain, RSV F protein, alpha4 integrin, IgE, IgE receptor, digoxin, carpet viper venom, complement C5, OPGL, CA-125 tumor antigen, Staphylococci proteins, Staphylococcus epider
  • the antigen is CD74.
  • the antigen may be a fragment of a molecule.
  • Parent antibodies can be any antibody known in the art or any antibody developed by those of skill in the art without limitation. Examples include, but are not limited to anti- TNF antibody (U.S. Pat. No. 6,258,562), anti-IL-12 and/or anti-IL-12p40 antibody (U.S. Pat. No. 6,914,128); anti-IL-18 antibody (U.S. Patent Publication No. 2005/0147610), anti-05, anti-CBL, anti-CD147, anti-gpl20, anti-VLA-4, anti-CDl la, anti-CD18, anti-VEGF, anti- CD40L, anti CD-40 (e.g., see PCT Publication No.
  • anti-CD4, anti-CD3, anti-CD23, anti-beta2- integrin, anti-alpha4beta7, anti-CD52, anti-HLA DR, anti-CD22 e.g., see U.S. Pat. No.
  • Parent antibodies may also be selected from various therapeutic antibodies approved for use, in clinical trials, or in development for clinical use.
  • therapeutic antibodies include, but are not limited to, rituximab (Rituxan®, IDEC/Genentech/Roche) (see, for example, U.S. Pat. No. 5,736,137), a chimeric anti-CD20 antibody approved to treat Non-Hodgkin's lymphoma; HuMax-CD20, an anti-CD20 currently being developed by Genmab, an anti-CD20 antibody described in U.S. Pat. No.
  • trastuzumab Herceptin®, Genentech
  • trastuzumab Herceptin®, Genentech
  • WO 01/62931A2 SCI 00 (Scancell) (PCT Publication No. WO 01/88138); alemtuzumab (Campath®, Millenium), a humanized mAb currently approved for treatment of B-cell chronic lymphocytic leukemia; muromonab-CD3 (Orthoclone OKT3®), an anti-CD3 antibody developed by Ortho
  • infliximab (Remicade®), an anti-TNF alpha antibody developed by Centocor, adalimumab (Humira®), an anti-TNF alpha antibody developed by Abbott, Humicade®, an anti-TNF alpha antibody developed by Celltech, golimumab (CNTO-148), a fully human TNF antibody developed by Centocor, etanercept (Enbrel®), an p75 TNF receptor Fc fusion developed by Immunex/Amgen, Ienercept, an p55TNF receptor Fc fusion previously developed by Roche, ABX-CBL, an anti-CD 147 antibody being developed by Abgenix,
  • ABX-IL8 an anti-IL8 antibody being developed by Abgenix
  • ABX-MA1 an anti-MUC18 antibody being developed by Abgenix
  • Pemtumomab R1549, 90Y-muHMFGl
  • an anti-IL8 antibody being developed by Abgenix
  • Pemtumomab R1549, 90Y-muHMFGl
  • MUC1 in development by Antisoma, Therex (R1550), an anti-MUCl antibody being developed by Antisoma, AngioMab (AS 1405), being developed by Antisoma, HuBC-1, being developed by Antisoma, Thioplatin (AS 1407) being developed by Antisoma, Antegren®
  • VLA-4-beta-l an anti-alpha-4-beta-l
  • alpha-4-beta-7 antibody being developed by Biogen, VLA-1 mAb, an anti-VLA-1 integrin antibody being developed by Biogen, LTBR mAb, an anti-lymphotoxin beta receptor (LTBR) antibody being developed by Biogen, CAT-
  • ATF an anti-Tissue Factor antibody being developed by Genentech, Xolair®
  • CD4 an anti-CD4 antibody being developed by Genmab, HuMax-IL15, an anti-IL15 antibody being developed by Genmab and Amgen, HuMax-Inflam, being developed by
  • CD40L antibody being developed by IDEC Pharmaceuticals, IDEC-151 (Clenoliximab), an anti-CD4 antibody being developed by IDEC Pharmaceuticals, IDEC- 114, an anti-CD80 antibody being developed by IDEC Pharmaceuticals, IDEC- 152, an anti-CD 23 being developed by IDEC Pharmaceuticals, anti-macrophage migration factor (MIF) antibodies being developed by IDEC Pharmaceuticals, BEC2, an anti-idiotypic antibody being developed by Imclone, IMC-1C11, an anti-KDR antibody being developed by Imclone,
  • MIF microphage migration factor
  • DC101 an anti-flk-1 antibody being developed by Imclone
  • anti-VE cadherin antibodies being developed by Imclone
  • CEA-Cide® Iabetuzumab
  • CEA antibody being developed by Immunomedics, LymphoCide® (Epratuzumab), an anti-
  • CD22 antibody being developed by Immunomedics, AFP-Cide, being developed by
  • Immunomedics MyelomaCide, being developed by Immunomedics, LkoCide, being developed by Immunomedics, ProstaCide, being developed by Immunomedics, MDX-010, an anti-CTLA4 antibody being developed by Medarex, MDX-060, an anti-CD30 antibody being developed by Medarex, MDX-070 being developed by Medarex, MDX-018 being developed by Medarex, Osidem® (IDM-1), and anti-Her2 antibody being developed by
  • HuMax®-CD4 an anti-CD4 antibody being developed by Medarex and Genmab
  • HuMax-IL15 an anti-IL15 antibody being developed by Medarex and Genmab
  • CNTO 148 an anti-TNFa antibody being developed by Medarex and Centocor/J&J
  • CNTO 1275 an anti-cytokine antibody being developed by Centocor/J&J
  • MOR101 and MOR102 anti-intercellular adhesion molecule-1 (ICAM-1) (CD54) antibodies being developed by MorphoSys, MOR201, an anti-fibroblast growth factor receptor 3
  • ICM-1 intercellular adhesion molecule-1
  • FGFR-3 antibody being developed by MorphoSys, Nuvion® (visilizumab), an anti-CD3 antibody being developed by Protein Design Labs, HuZAF®, an anti-gamma interferon antibody being developed by Protein Design Labs, ⁇ - ⁇ 5 ⁇ 1 Integrin, being developed by
  • CAM antibody being developed by Xoma
  • Xolair® Opannazumab
  • MLNOl an anti-Beta2 integrin antibody being developed by Xoma
  • the therapeutics include KRN330 (Kirin); huA33 antibody (A33, Ludwig Institute for Cancer Research); CNTO 95 (alpha V integrins,
  • Centocor Centocor
  • MEDI-522 alpha Vp3integrin, Medimmune
  • volociximab alpha ⁇ integrin
  • Biogen/PDL Human mAb 216 (B cell glycosolated epitope, NCI); BiTE MT103 (bispecific
  • rM28 (Bispecific CD28xMAPG, EP Patent No. EP1444268); MDX447 (EMD 82633) (Bispecific CD64xEGFR, Medarex); Catumaxomab (removab) (Bispecific EpCAMx anti-
  • CNTO 888 CCL2, Centocor
  • TRC105 CD 105 (endoglin), Tracon
  • BMS-663513 CD 137 agonist, Brystol Myers Squibb
  • MDX-1342 CD19, Medarex
  • Siplizumab MEDI-507
  • CD20 Genentech
  • veltuzumab hA20
  • CD20 Immunomedics
  • Epratuzumab CD22
  • lumiliximab (IDEC 152) (CD23, Biogen); muromonab-CD3 (CD3, Ortho);
  • HuM291 CD3 fc receptor, PDL Biopharma
  • HeFi-1 CD30, NCI
  • MDX-060 CD30,
  • HCD122 CD40, Novartis
  • SGN-40 CD40, Seattle Genentics
  • Campathlh Almtuzumab
  • Tremelimumab Ticilimumab, CP-675,2) (CTLA4, Pfizer); HGS-ETR1
  • Mapatumumab (DR4TRAIL-R1 agonist, Human Genome Science/Glaxo Smith Kline);
  • AMG-655 (DR5, Amgen); Apomab (DR5, Genentech); CS-1008 (DR5, Daiichi Sankyo);
  • HGS-ETR2 lexatumumab
  • DR5TRAIL-R2 agonist HGS
  • Cetuximab Erbitux
  • Imclone IMC-11F8, (EGFR, Imclone); Nimotuzumab (EGFR, YM Bio); Panitumumab
  • EGFRvIII AVANT Immunotherapeutics
  • MT201 adecatumumab (MT201) (Epcam, Merck);
  • edrecolomab Panorex, 17-1A (Epcam, Glaxo/Centocor); MORAb-003 (folate receptor a,
  • Morphotech Morphotech
  • KW-2871 ganglioside GD3, Kyowa
  • MORAb-009 GP-9, Morphotech
  • CDX-1307 (MDX-1307) (hCGb, Celldex); Trastuzumab (Herceptin) (HER2, Celldex);
  • Pertuzumab (rhuMAb 2C4) (HER2 (DI), Genentech); apolizumab (HLA-DR beta chain, PDL
  • IGF1-R Pfizer
  • IMC-A12 IGF1-R, Imclone
  • BIIB022 IGF-1R, Biogen
  • Mik-beta-1 IL-
  • hCBE-11 LTP, Biogen
  • HuHMFGl MUC1, Antisoma/NCl
  • RAVI 2 N- linked carbohydrate epitope, Raven
  • CAL parathyroid hormone-related protein
  • CT-011 CureTech
  • MDX-1106 ono-4538
  • bispecific parent antibodies include, but are not limited to, those with one antibody directed against a tumor cell antigen and the other antibody directed against a cytotoxic trigger molecule such as anti-FcyRI/anti-CD 15, anti-pl85 HER2 /FcYRIII (CD 16), anti-CD3/anti-malignant B-cell (ID 10), anti-CD3/anti-pl85 HER2 , anti-CD3/anti-p97, anti-CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-Dl (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti- CD3, anti-CD3/anti-CAMAl, anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/anti-
  • FcyRI, FcyRII or FcyRIII bispecific antibodies for use in therapy of infectious diseases such as anti-CD3/anti-herpes simplex virus (HSV), anti-T-cell receptor: CD3 complex/anti-influenza, anti-FcyR/anti-HIV; bispecific antibodies for tumor detection in vitro or in vivo such as anti- CEA/anti-EOTUBE, anti-CEA/anti-DPTA, anti- anti-pl85 HER2 /anti-hapten; bispecific antibodies as vaccine adjuvants (see Fanger, M W et al, Crit Rev Immunol. 1992;
  • bispecific antibodies as diagnostic tools such as anti-rabbit IgG/anti-ferritin, anti-horse radish peroxidase (HRP)/anti- hormone, anti-somatostatin/anti-substance P, anti-HRP/anti-FITC, anti-CEA/anti- ⁇ - galactosidase (see Nolan, O et R. O'Kennedy, Biochim Biophys Acta. 1990 Aug. 1;
  • trispecific antibodies include anti-CD3/anti-CD4/anti-CD37, anti-CD3/anti-CD5/anti-CD37 and anti-CD3/anti-
  • the antibody comprising one or more non-natural amino acid residues at site-specific positions has high sequence identity to any parent antibody described herein.
  • the antibody is substantially identical to a parent antibody described herein.
  • the antibody has about 60% identity, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% identity to a parent antibody described herein.
  • the antibody has greater than about 65%o, greater than about 70%>, greater than about 75%, greater than about 80%>, greater than about 85%, greater than about 90%, or greater than about 95% identity to a parent antibody described herein.
  • Antibodies are substantially identical if at least one polypeptide chain of one antibody has sequence identity to a corresponding polypeptide chain of another antibody.
  • the antibody comprising one or more non-natural amino acid residues at site-specific positions has at least one polypeptide chain having greater than about 65%o, greater than about 70%>, greater than about 75%, greater than about 80%>, greater than about 85%, greater than about 90%, or greater than about 95% identity to any of SEQ ID NOS: l-6 over at least one domain, at least two domains or at least three domains.
  • Antibodies described herein can be formulated into compositions using methods available in the art and those disclosed herein. Any of the compounds disclosed herein can be provided in the appropriate pharmaceutical composition and be administered by a suitable route of administration.
  • the antibody compositions provided herein further comprise a pharmaceutically acceptable carrier.
  • the carrier can be a diluent, excipient, or vehicle with which the pharmaceutical composition is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained- release formulations and the like.
  • Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
  • suitable pharmaceutical carriers are described in E.W. Martin, 1990, Remington's Pharmaceutical Sciences, Mack Publishing Co.
  • the pharmaceutical composition is provided in a form suitable for administration to a human subject.
  • the pharmaceutical composition will contain a prophylactically or therapeutically effective amount of the antibody together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
  • the formulation should suit the mode of administration.
  • the pharmaceutical composition is provided in a form suitable for intravenous administration.
  • compositions suitable for intravenous administration are solutions in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
  • Such compositions may be administered by a route other than intravenous administration.
  • the pharmaceutical composition is suitable for subcutaneous administration.
  • the pharmaceutical composition is suitable for intramuscular administration.
  • compositions of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject.
  • antibodies are supplied as a water free concentrate.
  • the antibody is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
  • the pharmaceutical composition is supplied in liquid form.
  • the pharmaceutical composition is provided in liquid form and is substantially free of surfactants and/or inorganic salts.
  • the antibody is supplied as in liquid form at a unit dosage of at least 0.1 mg/ml, at least 0.5 mg/ml, at least 1 mg/ml, at least 2.5 mg/ml, at least 3 mg/ml, at least 5 mg/ml, at least 8 mg/ml, at least 10 mg/ml, at least 15 mg/ml, at least 25 mg/ml, at least 30 mg/ml, or at least 60 mg/ml.
  • the pharmaceutical composition is formulated as a salt form.
  • Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • doses are from about 1 to about 1000 mg per day for an adult, or from about 5 to about 250 mg per day or from about 10 to 50 mg per day for an adult. In certain embodiments, doses are from about 5 to about 400 mg per day or 25 to 200 mg per day per adult. In certain embodiments, dose rates of from about 50 to about 500 mg per day are also contemplated.
  • Certain antibodies provided herein can be used for the treatment or prevention of any disease or condition deemed suitable to the practitioner of skill in the art.
  • a method of treatment or prevention encompasses the administration of a therapeutically or prophylactically effective amount of the antibody or antibody composition to a subject in need thereof to treat or prevent the disease or condition.
  • a therapeutically effective amount of the antibody or composition is an amount that is effective to reduce the severity, the duration and/or the symptoms of a particular disease or condition.
  • the amount of the antibody or composition that will be therapeutically effective in the prevention, management, treatment and/or amelioration of a particular disease can be determined by standard clinical techniques.
  • the precise amount of the antibody or composition to be administered with depend, in part, on the route of administration, the seriousness of the particular disease or condition, and should be decided according to the judgment of the practitioner and each subject's circumstances.
  • the effective amount of the antibody provided herein is between about 0.025 mg/kg and about 1000 mg/kg body weight of a human subject.
  • the antibody is administered to a human subject at an amount of about 1000 mg/kg body weight or less, about 950 mg/kg body weight or less, about 900 mg/kg body weight or less, about 850 mg/kg body weight or less, about 800 mg/kg body weight or less, about 750 mg/kg body weight or less, about 700 mg/kg body weight or less, about 650 mg/kg body weight or less, about 600 mg/kg body weight or less, about 550 mg/kg body weight or less, about 500 mg/kg body weight or less, about 450 mg/kg body weight or less, about 400 mg/kg body weight or less, about 350 mg/kg body weight or less, about 300 mg/kg body weight or less, about 250 mg/kg body weight or less, about 200 mg/kg body weight or less, about 150 mg/kg body weight or less, about 100 mg/kg body weight or
  • the effective amount of antibody provided herein is between about 0.025 mg/kg and about 60 mg/kg body weight of a human subject.
  • the effective amount of an antibody of the pharmaceutical composition provided herein is about 0.025 mg/kg or less, about 0.05 mg/kg or less, about 0.10 mg/kg or less, about 0.20 mg/kg or less, about 0.40 mg/kg or less, about 0.80 mg/kg or less, about 1.0 mg/kg or less, about 1.5 mg/kg or less, about 3 mg/kg or less, about 5 mg/kg or less, about 10 mg/kg or less, about 15 mg/kg or less, about 20 mg/kg or less, about 25 mg/kg or less, about 30 mg/kg or less, about 35 mg/kg or less, about 40 mg/kg or less, about 45 mg/kg or less, about 50 mg/kg or about 60 mg/kg or less.
  • the pharmaceutical composition of the method can be administered using any method known to those skilled in the art.
  • the pharmaceutical composition can be administered intramuscularly, intradermally, intraperitoneally, intravenously,
  • the pharmaceutical composition is administered subcutaneously. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intramuscularly.
  • the antibodies provided herein can be used for the detection of any target or for the diagnosis of any disease or condition deemed suitable to the practitioner of skill in the art.
  • the methods encompass detecting the binding of an antibody to a target antigen in the appropriate location, e.g., the appropriate body, tissue, or cell.
  • the formation of a complex between the antibody and antigen can be detected by any method known to those of skill in the art. Examples include assays that use secondary reagents for detection, ELISA's and immunoprecipitation and agglutination assays.
  • the antibody may be administered to a subject by methods known in the art such as, for example, intravenous, intranasal, intraperitoneal, intracerebral, intraarterial injection such that a specific binding between an antibody according to the invention with an eptitopic region on the amyloid protein may occur.
  • the antibody/antigen complex may conveniently be detected through a label attached to the antibody or any other art-known method of detection.
  • kits for detection or diagnosis comprise one or more antibodies provided herein along with one or more reagents useful for detecting a complex between the one or more antibodies and their target antigens.
  • the antibodies described herein can be prepared by any technique apparent to those of skill in the art without limitation.
  • Useful techniques for preparation include in vivo synthesis, for example with modified tRNA and tRNA synthetase, cell-free synthesis, for example with modified tRNA and tRNA synthetase, solid phase polypeptide synthesis and liquid phase polypeptide synthesis. Exemplary techniques are described in this section and in the examples below.
  • the antibody is translated and/or transcribed from one or more polynucleotides encoding the polypeptide chains of the antibody.
  • polynucleotides capable of encoding the antibodies having one or more non-natural amino acids at site-specific positions in one or more polypeptide chains.
  • the polynucleotides comprise a codon not normally associated with an amino acid at the polynucleotide position corresponding to the site-specific polypeptide position for the non-natural amino acid. Examples of such codons include stop codons, 4 bp codons, 5 bp codons, and the like.
  • the reaction mixture typically comprises a tRNA synthetase capable of making tRNAs that complement (suppress) said codon.
  • suppressor tRNAs are linked to the non-natural amino acids to facilitate their incorporation into the polypeptide at the site of the suppressor codon.
  • the antibodies can be prepared by techniques known to those of skill in the art for expressing such polynucleotides to incorporate non-natural amino acids into site specific positions of a polypeptide chain. Such techniques are described, for example, in U.S. Patent No. 7,045,337 and 7,083,970, in U.S. Published Patent Application Nos. US 2008/0317670, US 2009/0093405, US 2010/0093082, US 2010/0098630, US 2008/0085277 and in international patent publication nos. WO 2004/016778 Al and WO 2008/066583 A2, the contents of which are hereby incorporated by reference in their entireties.
  • an antibody can be prepared in a cell-free reaction mixture comprising at least one orthogonal tRNA aminoacylated with an unnatural amino acid, where the orthogonal tRNA base pairs with a codon that is not normally associated with an amino acid, e.g. a stop codon; a 4 bp codon, etc.
  • the reaction mixture also comprises a tRNA synthetase capable of aminoacylating the orthogonal tRNA with an unnatural amino acid.
  • the orthogonal tRNA synthetase which is susceptible to degradation by proteases present in bacterial cell extracts, is exogenously synthesized and added to the reaction mix prior to initiation of polypeptide synthesis.
  • the orthogonal tRNA may be synthesized in the bacterial cells from which the cell extract is obtained, may be synthesized de novo during the polypeptide synthesis reaction, or may be exogenously added to the reaction mix.
  • components that affect unnatural amino acid insertion and protein insertion or folding are optionally added to the reaction mixture.
  • Protein chaperones Dsb System of oxidoreductases and isomerases, GroES, GroEL, DNAJ, DNAK, Skp, etc.
  • the reactions may utilize a large scale reactor, small scale, or may be multiplexed to perform a plurality of simultaneous syntheses.
  • a reactor may be run in any mode such as batch, extended batch, semi-batch, semi-continuous, fed-batch and continuous, and which will be selected in accordance with the application purpose.
  • the reactions may be of any volume, either in a small scale, usually at least about 1 ⁇ and not more than about 15 ⁇ , or in a scaled up reaction, where the reaction volume is at least about 15 ⁇ , usually at least about 50 ⁇ , more usually at least about 100 ⁇ , and may be 500 ⁇ , 1000 ⁇ , or greater. In principle, reactions may be conducted at any scale as long as sufficient oxygen (or other electron acceptor) is supplied when needed.
  • Useful methods for synthesis where at least one unnatural amino acid is introduced into the polypeptide strand during elongation include but are not limited to: (I) addition of exogenous purified orthogonal synthetase, unnatural amino acid, and orthogonal tRNA to the cell-free reaction, (II) addition of exogenous purified orthogonal synthetase and unnatural amino acid to the reaction mixture, but with orthogonal tRNA transcribed during the cell-free reaction, (III) addition of exogenous purified orthogonal synthetase and unnatural amino acid to the reaction mixture, but with orthogonal tRNA synthesized by the cell extract source organism.
  • the orthogonal components are driven by regulatable promoters, so that synthesis levels can be controlled although other measures may be used such as controlling the level of the relevant DNA templates by addition or specific digestion.
  • a bacterial cell-free expression system is used to produce protein or peptide variants with non-native amino acids (nnAA).
  • nnAA non-native amino acids
  • the inactivation of proteins that decrease the efficiency of protein synthesis should increase the yield of polypeptides having non-native amino acids incorporated at a defined amino acid residue.
  • the introduction of nnAA into polypeptides is useful for increasing the biological diversity and function of proteins.
  • One approach for producing polypeptides having a nnAA incoroporated at a defined amino acid residue is to use an nnAA, aminoacylated orthogonal CUA containing tRNA for introduction of the nnAA into the nascent polypeptide at an amber (stop) codon during protein translation.
  • stop amber
  • the incorporation of nnAA at an amber codon can be inhibited by the native bacterial termination complex, which normally recognizes the stop codon and terminates translation.
  • Release Factor 1 is a termination complex protein that facilitates the termination of translation by recognizing the amber codon in an mRNA sequence. RFl recognition of the amber stop codon can promote pre-mature truncation products at the site of non-native amino acid incorporation, and thus decreased protein yield. Therefore, attenuating the activity of RFl may increase nnAA incorporation into recombinant proteins.
  • nnAA incorporation can be increased by attenuating RFl activity in 3 ways: 1) neutralizing antibody inactivation of RFl, 2) genomic knockout of RFl (in an RF2 bolstered strain), and 3) site specific removal of RFl using a strain engineered to express RFl containing a protein tag for removal by affinity
  • Another method for inactivating RFl comprises introducing proteolytic cleavage sites into the RFl amino acid sequence.
  • the cleavage sites are not accessible to the protease during bacterial cell growth, but are cleaved by the protease when the bacterial cells are lysed to produce cell-free extract.
  • the yield of full length polypeptides having a nnAA incorporated at an amber codon is increased in bacterial cell extracts expressing such modified RFl variants.
  • nucleic acid template in order to produce antibodies comprising a non-natural amino acid, one needs a nucleic acid template.
  • the templates for cell-free protein synthesis can be either mRNA or DNA.
  • the template can comprise sequences for any particular antibody of interest, and may encode a full-length antibody or a fragment of any length thereof.
  • Nucleic acids that serve as protein synthesis templates are optionally derived from a natural source or they can be synthetic or recombinant.
  • DNAs can be recombinant DNAs, e.g., plasmids, viruses or the like.
  • the template is used to synthesize the antibody in a cell-free translation system.
  • the template can be added to a cell lysate under conditions sufficient to translate the template into protein.
  • the cell lysate can be from bacterial cells or eukaryotic cells.
  • the expressed protein can then be purified using methods known in the art, as described below.
  • a translation system e.g., an in vitro protein synthesis system
  • An exemplary translation system comprises a cell free extract, cell lysate, or reconstituted translation system, along with the nucleic acid template for synthesis of the desired polypeptide or protein having non-native amino acids at preselected (defined) positions.
  • the reaction mixture will further comprise monomers for the macromolecule to be synthesized, e.g. amino acids, nucleotides, etc., and such co-factors, enzymes and other reagents that are necessary for the synthesis, e.g. ribosomes, tRNA, polymerases, transcriptional factors, etc.
  • materials specifically required for protein synthesis may be added to the reaction.
  • the materials include salts, folinic acid, cyclic AMP, inhibitors for protein or nucleic acid degrading enzymes, inhibitors or regulators of protein synthesis, adjusters of oxidation/reduction potentials, non-denaturing surfactants, buffer components, spermine, spermidine, putrescine, etc.
  • Various cell-free synthesis reaction systems are well known in the art. See, e.g., Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng. 66: 180-8 (1999); Kim, D.M. and Swartz, J.R. Biotechnol. Prog. 16:385-90 (2000); Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng.
  • a DNA template is used to drive in vitro protein synthesis, and RNA polymerase is added to the reaction mixture to provide enhanced transcription of the DNA template.
  • RNA polymerases suitable for use herein include any RNA polymerase that functions in the bacteria from which the bacterial extract is derived. In other words,
  • an RNA template is used to drive in vitro protein synthesis, and the components of the reaction mixture can be admixed together in any convenient order, but are preferably admixed in an order wherein the RNA template is added last, thereby minimizing potential degradation of the RNA template by nucleases.
  • a cell-free translation system is used to produce the antibody with one or more nnAAs incorporated therein.
  • Cell-free protein synthesis exploits the catalytic power of the cellular machinery. Obtaining maximum protein yields in vitro requires adequate substrate supply, e.g. nucleoside triphosphates and amino acids, a homeostatic environment, catalyst stability, and the removal or avoidance of inhibitory byproducts. The optimization of in vitro synthetic reactions benefits from recreating the in vivo state of a rapidly growing organism.
  • cell-free synthesis is therefore performed in a reaction where oxidative phosphorylation is activated. Additional details are described in United States Patent No. 7,338,789, the contents of which are incorporated by reference herein in its entirety.
  • tRNA synthetase is exogenously synthesized and added to the cell-free reaction mix.
  • the reaction mix is prepared from bacterial cells in which ompT has been inactivated or is naturally inactive. OmpT is believed to degrade components of the reaction mixture including tRNA synthetase.
  • materials specifically required for protein synthesis may be added to the reaction. These materials include salts, folinic acid, cyclic AMP, inhibitors for protein or nucleic acid degrading enzymes, inhibitors or regulators of protein synthesis, adjusters of oxidation/reduction potential(s), non-denaturing surfactants, buffer components, spermine, spermidine, putrescine, etc.
  • the salts preferably include potassium, magnesium, and ammonium salts ⁇ e.g. of acetic acid or glutamic acid).
  • One or more of such salts may have an alternative amino acid as a counter anion.
  • ionic species are typically optimized with regard to protein production.
  • concentrations of several components such as nucleotides and energy source compounds may be simultaneously adjusted in accordance with the change in those of other components.
  • concentration levels of components in the reactor may be varied over time.
  • oxidation/reduction potential may be dithiothreitol, ascorbic acid, glutathione and/or their oxidized forms.
  • the reaction can proceed in a dialysis mode, in a diafiltration batch mode, in a fed-batch mode of in a semi-continuous operation mode.
  • a feed solution can be supplied to the reactor through a membrane or through an injection unit.
  • Synthesized antibody can accumulate in the reactor followed by isolation or purification after completion of the system operation. Vesicles containing the antibody may also be continuously isolated, for example by affinity adsorption from the reaction mixture either in situ or in a circulation loop as the reaction fluid is pumped past the adsorption matrix.
  • the protein isolating means for selectively isolating the desired protein may include a unit packed with particles coated with antibody molecules or other molecules for adsorbing the synthesized, desired protein.
  • the protein isolating means comprises two columns for alternating use.
  • the resulting antibody can be purified or isolated by standard techniques.
  • Antibodies can be assayed for their expected activity, or for a new activity, according to any assay apparent to those of skill in the art.
  • the resulting antibody can be assayed activity in a functional assay or by quantitating the amount of protein present in a non-functional assay, e.g. immunostaining, ELISA, quantitation on Coomasie or silver stained gel, etc., and determining the ratio of biologically active protein to total protein.
  • the amount of protein produced in a translation reaction can be measured in various fashions.
  • One method relies on the availability of an assay which measures the activity of the particular protein being translated.
  • An example of an assay for measuring protein activity is a luciferase assay system, or chloramphenical acetyl transferase assay system. These assays measure the amount of functionally active protein produced from the translation reaction. Activity assays will not measure full length protein that is inactive due to improper protein folding or lack of other post translational modifications necessary for protein activity.
  • Another method of measuring the amount of protein produced in coupled in vitro transcription and translation reactions is to perform the reactions using a known quantity of radiolabeled amino acid such as 35 S-methionine, 3 H-leucine or 14 C-leucine and subsequently measuring the amount of radiolabeled amino acid incorporated into the newly translated protein. Incorporation assays will measure the amount of radiolabeled amino acids in all proteins produced in an in vitro translation reaction including truncated protein products.
  • the radiolabeled protein may be further separated on a protein gel, and by autoradiography confirmed that the product is the proper size and that secondary protein products have not been produced.
  • the following example describes exemplary antibodies containing non-natural amino acids at defined positions along with methods of their construction and expression.
  • the antibodies were assessed for expression, suppression efficiency, efficiency of conjugation with a cell-killing agent, cell binding, and cell killing, as set forth below.
  • the exemplary antibodies are based on parent antibody trastuzumab (U.S. Patent Nos. 6,165,464 and 2006/0018899 Al; Carter et al, 1992, Proc. Natl. Acad. Sci. USA
  • constructs were made incorporating a TAG amber codon at a defined position in the heavy chain of trastuzumab.
  • Site directed mutagenesis was performed using a pYD plasmid containing the coding region of trastuzumab with a C-terminal-(His)6 tag (SD02005) as DNA template and synthetic oligonucleotides (Eurofms MWS Operon;
  • Oligonucleotides of each mutation were added to the DNA template and PHUSION® polymerase (New England Biolabs; Ipswich, MA) to a final volume of 20 ⁇ The final concentration of each component was 0.16 ⁇ of each oligonucleotide, 0.5 ng/ ⁇ template DNA, 0.02 ⁇ / ⁇ .
  • PHUSION® polymerase in HF buffer containing 1.5 mM MgCl 2 and 200 ⁇ dNTP. Mixture was incubated at 98°C 5m, 18 PCR cycles ( 98°C 30s, 55 °C 1 min, 72°C 4 min), 10 min at 72°C and stored at 4°C.
  • Dpnl New England Biolabs; Ipswich, MA was added to the mixture to final concentration of 0.6 ⁇ / ⁇ and incubated for 37°C lh to digest parent DNA.
  • SEQUENCHER® software (Gene Codes Corp; Ann Arbor, MI), and clones containing mutations were picked and arrayed into 96 well plates. Overnight cultures of selected variants were grown and used for preparing plasmid DNA using the standard 96 well mini-prep protocol according to the manufacturer (Qiagen; Germantown, MD). Concentration of mini- prepped DNA was measured using absorbance at 260 nm (and 280 nm).
  • the variants were then expressed in a cell-free protein synthesis reaction as follows as described in Zawada et al., 2011, Biotechnol. Bioeng.108(7)1570-1578 with the modifications described below. Unsubstituted trastuzumab was also made as a control. Cell- free extracts were treated with 50 ⁇ iodoacetamide for 30 min at RT (20°C) and added to a premix containing all other components except for heavy chain DNA from variants of interest. Cell free reactions were initiated by addition of plasmid DNA of heavy chain DNA variants and incubated at 30°C for 12h on a shaker at 450 rpm in 96 deep well plates.
  • the reaction was incubated further at 4°C for 5h.
  • the final concentration in the protein synthesis reaction was 30% cell extract, 1 mM para-azido phenylalanine (pAzF) (RSP Amino Acids), 0.125 mg/mL Mjannaschii amber suppressor tRNA, 0.37 mg/mL Mjannaschii pAzF- specific amino-acyl tRNA synthetase (FRS), 2 mM GSSG, 0.29 mg/mL PDI (Mclab), 100 ⁇ g/mL E.
  • pAzF para-azido phenylalanine
  • coli DsbC 8 mM magnesium glutamate, 10 mM ammonium glutamate, 130 mM potassium glutamate, 35 mM sodium pyruvate, 1.2 mM AMP, 0.86 mM each of GMP, UMP, and CMP, 2 mM amino acids (except 0.5 mM for Tyrosine and Phenylalanine), 4 mM sodium oxalate, 1 mM putrescine, 1.5 mM spermidine, 15 mM potassium phosphate, 100 nM T7 RNAP, 2 ⁇ g/mL trastuzumab light chain DNA, 8 ⁇ g/mL trastuzumab-(His)6 heavy chain DNA.
  • trastuzamab variant was produced in 1 mL scale in 96 deep well plates in duplicates. A total of three plates were used to express the variants, each compared to expression of an unsubstituted trastuzumab to normalize for expression across the plates. It should be noted that all trastuzumab variants thus produced were aglycosylated.
  • the mixture was centrifuged at 5000x g 4°C for 15 min. Supernatant was captured with IMAC Phytip containing 40 ⁇ resin (PhyNexus, Inc.; San Jose, CA) by pipetting up and down 4 times slowly at a flow rate of 4.2 ⁇ /min. Resin was washed with 925 IMAC binding buffer (50 mM Tris pH 8.0, 300mM NaCl, 10 mM imidazole) by pipetting up and down twice at a flow rate of 8.3 ⁇ / ⁇ . This process was repeated once with an additional 925 ⁇ , IMAC binding buffer.
  • IMAC binding buffer 50 mM Tris pH 8.0, 300mM NaCl, 10 mM imidazole
  • Bound protein was eluted with 250 ⁇ , IMAC elution buffer (50 mM Tris pH 8.0, 300mM NaCl, 500 mM Imidazole) by pipetting up and down 4 times at a flow rate of 4.2 ⁇ / ⁇ .
  • IMAC elution buffer 50 mM Tris pH 8.0, 300mM NaCl, 500 mM Imidazole
  • this procedure allows isolation of full length protein.
  • IMAC purified samples were mixed with 2x gel loading buffer (Bio-Rad# 161-0737) resolved by of 4-15% Stain-FreeTM gel (Bio-Rad CriterionTM TGX #567-8085). Samples were not heated before loading into wells of the gel. Protein bands were visualized and quantitated by Bio-Rad Gel Doc EZ System using Image Lab software (v3). Band intensities of samples were determined based on mass standards of HERCEPTIN® loaded on the same gel.
  • the trastuzumab variants were conjugated to an exemplary cytotoxic agent, MMAF, using a constrained cyclooctyne reagent.
  • DBCO-MMAF structure shown as Figure 1; ACME Bioscience; Palo Alto, CA
  • the compound was diluted into with PBS to 1 mM and then added to trastuzumab-(His)6 variants in IMAC elution buffer to final drug concentration of 100 ⁇ . Mixture was incubated at RT (20°C) for 17 hours.
  • Reaction was stopped by adding Sodium Azide to final concentration of 100 mM and buffer exchanged using Zeba plates (Thermo Scientific; Waltham, MA) equilibrated in IX PBS. Filtrate was then passed through a MUSTANG® Q plate (Pall Corp.; Port Washington, NY) to remove endotoxin.
  • HIC Hydrophobic Interaction Chromatography
  • the mobile phase B was 50mM Sodium Phosphate, pH 7.0 in 80:20 water :Isopropyl Alcohol (Honeywell). The mobile phase was delivered at a flow rate of 1.0 mL/minute. The separation was performed with a linear gradient of 15% mobile phase B to 100% mobile phase B in 10 minutes. The UV data was acquired at both 210 and 280nm. The peak areas were quantitated using Chemstation software (Agilent) and the Drug Antibody Ratio (DAR) was calculated from the percent of the total peak area.
  • Chemstation software Algilent
  • DAR Drug Antibody Ratio
  • a binding assay to cells expressing HER2 was performed as follows. The binding of the purified conjugated variants to HER2 on SKBR3 cells, which overexpress the HER2/c-erb-2 gene product, with over 1.5 million receptor copies per cell (ATCC # HTB-30, Manassas, VA) was compared to clinical grade Herceptin®, unglycosylated trastuzumab produced by cell-free protein synthesis, or human serum IgGl as a negative control (Sigma-Aldrich; St. Louis, MO).
  • SKBR3 cells were cultured in DMEM:Ham's F-12 (50:50), high glucose (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum (Hyclone; Thermo Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASETM (Hyclone; Thermo Scientific; Waltham, MA).
  • HBSS Hanks Balanced Salt Solution
  • a total of 200,000 cells per sample in total volume of 10 were incubated with serial dilutions of either conjugated trastuzumab variant, clinical grade HERCEPTIN®, or aglycosylated trastuzumab made in ⁇ ⁇ ⁇ FACS buffer (DPBS buffer supplemented with 1%> bovine serum albumin). Cells plus antibody or ADC were incubated for 60 minutes on ice. Unstained cells, human IgGl (Isotype control) and Secondary antibody (goat anti-human IgG) were used as controls.
  • Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASETM (Hyclone; Thermo Scientific; Waltham, MA). A total of 10 3 cells were seeded in a volume of 40 ⁇ in a 96-well half area flat bottom white Polystyrene plate. The cells were allowed to adhere overnight at 37°C in a C0 2 incubator. ADC variants were formulated at 2x concentration in DMEM/F12 medium and filtered through MultiScreen H TS 96- Well Filter Plates (Millipore; Billerica, MA).
  • Single Peak corresponds to a profile that resolved well as a single peak (an example of such a profile is shown as Figure 2)
  • NWR corresponds to a poorly resolved profile (an example of such a profile is shown as Figure 3)
  • WR corresponds to a well-resolved HIC profile (an example of such a profile is shown as Figure 4).
  • Several of the variants that exhibited a single peak profile also exhibited potent killing, which indicates that the variant was indeed conjugated with drug, but failed to resolve on the HIC column.
  • preferred variants exhibit an IC 50 of about 20 ng/ml or below, even more preferably below about 10 ng/ml, and even more preferably below about 5 ng/ml.
  • the variants are in the top 50% of expression, and even more preferably, are in the top 25% of expression.
  • Variants that have a DAR of at least about 1.0 are also preferred.
  • Preferred variants include those with a non-natural amino acid replacing positions V005, A023, G042, G065, S074, A084, Al 18, SI 19, S132, S134, T135, S136, G137, G138, T139, T155, S160, A162, S165, A172, L174, S176, S177, S191, G194, S219, P238, S239, F241, F243, K246, E356, M358, K360, V262, V264, D265, S267, H268, E269, D270, P271, E272, K274, F275, Y278,D280, G281, V282, E283, N286, T289, R292, E293, E294, Q295, Y296, N297, S298, T299,Y300, R
  • variants including those with a non-natural amino acid replacing positions V005, A023, S074, A084, A118, S119, S132, S134, T135, S136, G137, T139, S160, A162, S165, A172, S191, G194, S239, F241, K246, S267, H268, E269, D270, P271, E272, K274, F275, D280, G281, V282, E283, N286, T289, R292, E293, E294, Q295, Y296, N297, S298, T299,Y300, R301, V303, V305, K317, K320, S324, K326, A327, P329, A330, 1332, E333, K334, T335, S337, A339, R344, R355, T359, L398, S375, Q386, N389, K392, G420, K340, Q342, Q438, and N421.
  • variants including those with a non-natural amino acid replacing positions V005, A023, A084, Al 18, SI 19, S132, S134, S136, G137, S160, A162, A172, S239, F241, S267, E269, D270, P271, E272, V282, N286, R292, E293, Y296, S298, P329, A330, K334, T335, K340, R355, T359, Q386, N389, F404, G420, N421, Q438, and Q342.
  • Variants with a non-natural amino acid replacing positions V005, A084, Al 18, S132, S136, S239, E293, K334, R355, Q342, T359, and N389 were identified as particularly preferred.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Oncology (AREA)
  • Veterinary Medicine (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)

Abstract

Provided herein are antibodies comprising non-natural amino acid residues at site-specific positions, compositions comprising the antibodies, methods of their production and methods of their use. The antibodies are useful for methods of treatment and prevention, methods of detection and methods of diagnosis.

Description

ANTIBODIES COMPRISING SITE-SPECIFIC NON-NATURAL
AMINO ACID RESIDUES, METHODS OF THEIR PREPARATION AND
METHODS OF THEIR USE
FIELD
[0001] Provided herein are antibodies comprising non-natural amino acid residues at site- specific positions, compositions comprising the antibodies, methods of their production and methods of their use.
BACKGROUND
[0002] Antibodies are biological molecules with remarkable affinity for their target antigens. Nature provides antibodies as part of a defense system in certain vertebrates for the elimination or destruction of foreign proteins, cells and organisms. If a certain vertebrate is presented with a foreign protein on, for example, an infected cell or an infectious bacterium, an antibody can bind its target foreign protein to direct the foreign entity to its elimination or destruction.
[0003] The selective affinity of antibodies can be used by man to target nearly any antigen desired. The antigen can be a protein on an infected cell or infectious
microorganism. It can also be, for example, a protein on a cancer cell, a protein on a cell of a target tissue, a protein in the bloodstream, a protein on an inflamed or inflammatory cell or any other protein whose selective binding is useful. Antibodies have thus found use in therapy for conditions such as cancer, inflammatory diseases, autoimmune diseases and transplant rejection. The antibody can signal the immune system to destroy or eliminate a diseased cell, or an engineered antibody can carry a molecular payload to destroy the target. In certain applications therapeutic antibodies are linked to molecular shields to increase their lifetime within an organism. Antibodies have also found use as diagnostics. These antibodies can carry a label to indicate the presence of a target antigen on a cell or in a tissue. These labels are typically linked to the antibodies by covalent bonds.
[0004] To date, techniques for linking antibodies molecular entities such as molecular payloads, molecular shields and labels have been limited by their heterogeneity in degree and location of linking to the antibodies, by their low yields and by losses in activity. Typical conjugation sites include random locations on antibody chains, e.g. random amines on amino acid side chains, and the N-terminus of certain antibody chains. In such techniques, some antibodies might be linked to the conjugate at one location while some antibodies are linked to the same conjugate at another location, and some antibodies might not be linked at all.
[0005] There is a need for antibodies modified at site-specific positions optimized for uniformity, yield and/or activity to further the promising use of antibodies in, for example, therapy and diagnostics.
SUMMARY
[0006] Provided herein are antibodies modified at one or more site-specific positions with one or more non-natural amino acid residues. These site-specific positions are optimal for substitution of a natural amino acid residue with a non-natural amino acid residue. In certain embodiments, substitution at these site-specific positions yields antibodies that are uniform in substitution, i.e. that are substantially modified in the selected position. In certain
embodiments, an antibody substituted at one or more of these site-specific positions has advantageous production yield, advantageous solubility, advantageous binding and/or advantageous activity. The properties of these antibodies are described in detail in the sections below.
[0007] In one aspect, provided herein are antibodies comprising a polypeptide chain having at least one non-natural amino acid residue at a position in the polypeptide chain that is optimally substitutable. The antibody can be any polypeptide or multimeric polypeptide recognized as an antibody to those of skill in the art. The polypeptide chain can be any polypeptide chain of the antibody, including any heavy chain and any light chain. The position in the polypeptide chain that is optimally substitutable is any position in the polypeptide chain that can provide a substitution with optimal yield, uniformity, solubility, binding and/or activity. The sections below describe in detail the optimally substitutable positions of such polypeptide chains. Also described below are useful antibodies useful non- natural amino acids.
[0008] In another aspect, provided herein are compositions comprising said antibodies. Advantageously, such compositions can have high uniformity because of the uniformity of the substitution of the antibodies provided herein. In certain embodiments, the compositions comprise a substantial amount of the antibody when measured by total weight of protein or when measured by total weight of antibody. In certain embodiments, the compositions comprise at least 80 % of the antibody, at least 85 % of the antibody, at least 90 % of the antibody or at least 95 % of the antibody by weight. [0009] In another aspect, provided herein are methods of making the antibodies. The antibodies can be made by any technique apparent to those of skill in the art for incorporating non-natural amino acids into site-specific positions of antibody chains. In certain
embodiments, the antibodies are made by solid phase synthesis, semi-synthesis, in vivo translation, in vitro translation or cell-free translation.
[0010] In another aspect, provided herein are methods of using the antibodies for therapy. Antibodies directed to a therapeutic target can incorporate one or more site-specific non- natural amino acids according to the description herein. These antibodies can be used for treating or preventing a disease or condition associated with the therapeutic target.
Advantageously, a site-specific non-natural amino acid can be used to link the antibody to a therapeutic payload to facilitate efficacy. Exemplary antibodies, therapeutic targets and diseases or conditions are described herein.
[0011] In another aspect, provided herein are methods of using the antibodies for detection. Antibodies directed to a detection target can incorporate one or more site-specific non-natural amino acids according to the description herein. These antibodies can be used with a label to signal binding to the detection target. Advantageously, a site-specific non- natural amino acid can be used to link the antibody to a label to facilitate detection.
Exemplary antibodies, detection targets and labels are described herein.
[0012] In another aspect, provided herein are methods of modifying the stability of antibodies. Antibodies can be modified with a non-natural amino acid as described herein to facilitate linking to a molecular entity that can modify the stability of the antibody. For instance, a site-specific non-natural amino acid can facilitate linking to a molecular shield, for example polyethylene glycol, to increase the stability of an antibody. Exemplary non-natural amino acids and linking moieties are described herein.
BRIEF DESCRIPTION OF THE FIGURES
[0013] FIG. 1 provides the structure of exemplary cytotoxic reagent DBCO-MMAF.
[0014] FIG. 2 provides a single peak hydrophobic interaction chromatography (HIC) assay profile.
[0015] FIG. 3 provides a not-well-resolved (NWR) HIC assay profile. [0016] FIG. 4 provides a well-resolved (WR) HIC assay profile. [0017] FIGS. 5A and 5B depict exemplary HIC traces of two variants (HC Tl 10 and HC SI 12), showing peaks corresponding to unconjugated, partially conjugated and fully conjugated IgGs.
[0018] FIGS. 6A-6E depict exemplary embodiments showing site-specific conjugation.
[0019] FIGS. 7 A and 7B depict suppression efficiency and soluble yield comparison data of antibodies comprising different unnatural amino acids
[0020] FIG. 8 depicts cell killing of CD-30 positive cell lines by exemplary brentuximab antibody-drug conjugates.
[0021] FIG. 9 provides experimental results demonstrating that exemplary brentuximab antibody-drug conjugates do not kill cells that do not express CD-30.
[0022] FIG. 10 depicts binding to CD-30 positive cell lines by exemplary brentuximab (ADCETRIS®) antibody-drug conjugates.
[0023] FIGS. 11A, 1 IB, 11C, and 1 ID provide the structure of exemplary cytotoxic reagents DBCO-MMAF 2, DBCO-DM4, DBCO-DM4 2, and DBCO-MMAE, respectively.
[0024] FIG. 12 provides a graphical representation of the pharmacokinetics of an exemplary scFv-Fc site-specific antibody-drug conjugate.
[0025] FIGS. 13A and 13B depict a graphical representation of the in vivo effectiveness of exemplary site-specific antibody-drug conjugates to retard tumor growth and/or to regress tumor size in an animal model.
DESCRIPTION OF EXEMPLARY EMBODIMENTS
[0026] Provided herein are antibodies having non-natural amino acids at one or more site- specific positions, compositions comprising the antibodies, methods of making the antibodies, and methods of their use.
Definitions
[0027] When referring to the antibodies provided herein, the following terms have the following meanings unless indicated otherwise. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art. In the event that there is a plurality of definitions for a term herein, those in this section prevail unless stated otherwise. [0028] As used herein, the singular forms "a," "an," and "the" include the plural reference unless the context clearly indicates otherwise. Thus, for example, reference to an "antibody" is a reference to one or more such antibodies, etc.
[0029] The term "substantially pure" with respect to a composition comprising an antibody refers to a composition that includes at least 80, 85, 90 or 95 % by weight or, in certain embodiments, 95, 98, 99 or 100 % by weight, e.g. dry weight, of the antibody relative to the remaining portion of the composition. The weight percentage can be relative to the total weight of protein in the composition or relative to the total weight of antibodies in the composition. Purity can be determined by techniques apparent to those of skill in the art, for instance SDS-PAGE.
[0030] The term "isolated" refers to an antibody that is substantially or essentially free of components that normally accompany or interact with the antibody as found in its naturally occurring environment or in its production environment, or both. Isolated antibody preparations have less than about 30%, less than about 25%, less than about 20%, less than about 15%), less than about 10%>, less than about 5%, less than about 4%, less than about 3%, less than about 2% or less than about 1% of contaminating protein by weight, e.g. dry weight.
[0031] The term "antibody" refers to any macromolecule that would be recognized as an antibody by those of skill in the art. Antibodies share common properties including binding and at least one polypeptide chain that is substantially identical to a polypeptide chain that can be encoded by any of the immunoglobulin genes recognized by those of skill in the art. The immunoglobulin genes include, but are not limited to, the κ, λ, α, γ (IgGl, IgG2, IgG3, and IgG4), δ, ε and μ constant region genes, as well as the immunoglobulin variable region genes. The term includes full-length antibodies and antibody fragments recognized by those of skill in the art, and variants thereof. The term further includes glycosylated and aglycosylated antibodies.
[0032] The term "antibody fragment" refers to any form of an antibody other than the full-length form. Antibody fragments herein include antibodies that are smaller components that exist within full-length antibodies, and antibodies that have been engineered. Antibody fragments include but are not limited to Fv, Fc, Fab, and (Fab')2, single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1, CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like (Maynard & Georgiou, 2000, Annu. Rev. Biomed. Eng. 2:339-76; Hudson, 1998, Curr. Opin. Biotechnol. 9:395-402).
[0033] The term "immunoglobulin (Ig)" refers to a protein consisting of one or more polypeptides substantially encoded by one of the immunoglobulin genes, or a protein substantially identical thereto in amino acid sequence. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to VH, Cyl, Cy2, Cy3, VL, and CL.
[0034] The term "immunoglobulin (Ig) domain" refers to a protein domain consisting of a polypeptide substantially encoded by an immunoglobulin gene. Ig domains include but are not limited to VH, Cyl, Cy2, Cy3, VL, and CL.
[0035] The term "variable region" of an antibody refers to a polypeptide or polypeptides composed of the VH immunoglobulin domain, the VL immunoglobulin domains, or the VH and VL immunoglobulin domains. Variable region may refer to this or these polypeptides in isolation, as an Fv fragment, as a scFv fragment, as this region in the context of a larger antibody fragment, or as this region in the context of a full-length antibody or an alternative, non-antibody scaffold molecule.
[0036] The term "variable" refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are responsible for the binding specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed through the variable domains of antibodies. It is concentrated in three segments called Complementarity Determining Regions (CDRs) both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a β-sheet configuration, connected by three or four CDRs, which form loops connecting, and in some cases forming part of, the β-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
[0037] The constant domains are not typically involved directly in binding an antibody to an antigen, but exhibit various effector functions. Depending on the amino acid sequence of the constant region of their heavy chains, antibodies or immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGl, IgG2, IgG3, and IgG4; IgAl and IgA2. The heavy chain constant regions that correspond to the different classes of immunoglobulins are called α, δ, ε, γ and μ, respectively. Of the various human immunoglobulin classes, only human IgGl, IgG2, IgG3 and IgM are known to activate complement.
[0038] The term "variant protein sequence" refers to a protein sequence that has one or more residues that differ in amino acid identity from another similar protein sequence. Said similar protein sequence may be the natural wild type protein sequence, or another variant of the wild type sequence. Variants include proteins that have one or more amino acid insertions, deletions or substitutions. Variants also include proteins that have one or more post-translationally modified amino acids.
[0039] The term "parent antibody" refers to an antibody known to those of skill in the art that is modified according to the description provided herein. The modification can be physical, i.e., chemically or biochemically replacing or modifying one or more amino acids of the parent antibody to yield an antibody within the scope of the present description. The modification can also be conceptual, i.e., using the sequence of one or more polypeptide chains of the parent antibody to design an antibody comprising one or more site-specific non- natural amino acids according to the present description. Parent antibodies can be naturally occurring antibodies or antibodies designed or developed in a laboratory. Parent antibodies can also be artificial or engineered antibodies, e.g., chimeric or humanized antibodies.
[0040] The term "conservatively modified variant" refers to an antibody that differs from a related antibody by conservative substitutions in amino acid sequence. One of skill will recognize that individual substitutions, deletions or additions to a peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention. [0041] The following eight groups each contain amino acids that are conservative substitutions for one another:
1) Alanine (A), Glycine (G);
2) Aspartic acid (D), Glutamic acid (E);
3) Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K), Histidine (H);
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
7) Serine (S), Threonine (T); and
8) Cysteine (C), Methionine (M)
(see, e.g., Creighton, Proteins: Structures and Molecular Properties (W H Freeman & Co.; 2nd edition (December 1993)
[0042] The terms "identical" or "identity," in the context of two or more polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are "substantially identical" if they have a percentage of amino acid residues or nucleotides that are the same {i.e., about 60% identity, optionally about 65%, about 70%>, about 75%, about 80%), about 85%), about 90%>, or about 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. The identity can exist over a region that is at least about 50 amino acids or nucleotides in length, or over a region that is 75-100 amino acids or nucleotides in length, or, where not specified, across the entire sequence or a polypeptide. In the case of antibodies, identity can be measured outside the variable CDRs. Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.); or by manual alignment and visual inspection (see, e.g., Ausubel et al, Current Protocols in Molecular Biology (1995 supplement)). [0043] Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11 , an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. The BLAST algorithm is typically performed with the "low complexity" filter turned off.
[0044] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
[0045] The term "amino acid" refers to naturally occurring and non-naturally occurring amino acids, as well as imino acids such as proline, amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
[0046] Naturally encoded amino acids are the proteinogenic amino acids known to those of skill in the art. They include the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and the less common pyrrolysine and selenocysteine. Naturally encoded amino acids include post-translational variants of the 22 naturally occurring amino acids such as prenylated amino acids, isoprenylated amino acids, myrisoylated amino acids, palmitoylated amino acids, N- linked glycosylated amino acids, O-linked glycosylated amino acids, phosphorylated amino acids and acylated amino acids. [0047] The term "non-natural amino acid" refers to an amino acid that is not a proteinogenic amino acid, or a post-translationally modified variant thereof. In particular, the term refers to an amino acid that is not one of the 20 common amino acids or pyrrolysine or selenocysteine, or post-translationally modified variants thereof.
[0048] A "functional Releasing Factor 1 (RFl) protein" refers to RFl that retains activity equal to or substantially similar to wild-type or unmodified RFl protein. Functional RFl activity can be tested, for example, by measuring the growth rate of bacteria expressing the modified RFl protein, and comparing the growth rate to bacteria expressing wild-type or unmodified RFl . Functional RFl activity can also be tested, for example, by the ability of the modified RFl protein to reduce orthogonal tRNA incorporation of a nnAA at a specified position in an mRNA encoding a target protein, thereby increasing the amount of premature chain termination (i.e., increasing the amount of truncated protein).
[0049] An "attenuated Releasing Factor 1 (RFl) protein" refers to a modified RFl that retains reduced activity relative to wild-type or unmodified RFl protein. RFl activity can be tested, for example, by measuring the growth rate of bacteria expressing the modified RFl protein, and comparing the growth rate to bacteria expressing wild-type or unmodified RFl . RFl activity can also be tested, for example, by the ability of the modified RFl protein to reduce orthogonal tRNA incorporation of a nnAA at a specified position in an mRNA encoding a target protein, thereby increasing the amount of premature chain termination (i.e., increasing the amount of truncated protein). In some embodiments, the attenuated RFl protein comprises transcriptional modifications; for example, the expression level of the RFl protein (wild type or modified) can be reduced to achieve attenuation. The reduction can also achieved by using RNAi technologies. In some embodiments, the attenuated RFl protein comprises translational modifications; for example, the amount of the synthesized RFl protein (wild type or modified) can be reduced to achieve attenuation, e.g., by increasing the rate at which the protein is digested by protease via insertion of protease-specific sequence into the RFl sequence.
Antibodies
[0050] Provided herein are antibodies comprising one or more non-natural amino acid residues at site-specific positions in the amino acid sequence of at least one polypeptide chain. [0051] The antibody can share high sequence identity with any antibody recognized by those of skill in the art, i.e. a parent antibody. In certain embodiments, the amino acid sequence of the antibody is identical to the amino acid sequence of the parent antibody, other than the non-natural amino acids at site-specific position. In further embodiments, the antibody provided herein can have one or more insertions, deletions or mutations relative to the parent antibody in addition to the one or more non-natural amino acids at the site-specific positions. In certain embodiments, the antibody provided herein can have a unique primary sequence, so long as it would be recognized as an antibody by those of skill in the art.
[0052] The antibody is typically a protein comprising multiple polypeptide chains. In certain embodiments, the antibody is a heterotetramer comprising two identical light (L) chains and two identical heavy (H) chains. Each light chain can be linked to a heavy chain by one covalent disulfide bond. Each heavy chain can be linked to the other heavy chain by one or more covalent disulfide bonds. Each heavy chain and each light chain can also have one or more intrachain disulfide bonds. As is known to those of skill in the art, each heavy chain typically comprises a variable domain (VH) followed by a number of constant domains. Each light chain typically comprises a variable domain at one end (VL) and a constant domain. As is known to those of skill in the art, antibodies typically have selective affinity for their target molecules, i.e. antigens.
[0053] The antibodies provided herein can have any antibody form known to those of skill in the art. They can be full-length, or fragments. Exemplary full length antibodies include IgA, IgAl, IgA2, IgD, IgE, IgG, IgGl, IgG2, IgG3, IgG4, IgM, etc. Exemplary fragments include Fv, Fab, Fc, sFv, etc.
[0054] The antibodies provided herein comprise at least one non-natural amino acid. The non-natural amino acid can be any non-natural amino acid known to those of skill in the art. Exemplary non-natural amino acids are described in the sections below.
[0055] The non-natural amino acids are positioned at select locations in a polypeptide chain of the antibody. These locations were identified as providing optimum sites for substitution with the non-natural amino acids. Each site is capable of bearing a non-natural amino acid with optimum structure, function and/or methods for producing the antibody.
[0056] In certain embodiments, a site-specific position for substitution provides an antibody that is stable. Stability can be measured by any technique apparent to those of skill in the art. [0057] In certain embodiments, a site-specific position for substitution provides an antibody that is has optimal functional properties. For instance, the antibody can show little or no loss of binding affinity for its target antigen compared to an antibody without the site- specific non-natural amino acid. In certain embodiments, the antibody can show enhanced binding compared to an antibody without the site-specific non-natural amino acid.
[0058] In certain embodiments, a site-specific position for substitution provides an antibody that can be made advantageously. For instance, in certain embodiments, the antibody shows advantageous properties in its methods of synthesis, discussed below. In certain embodiments, the antibody can show little or no loss in yield in production compared to an antibody without the site-specific non-natural amino acid. In certain embodiments, the antibody can show enhanced yield in production compared to an antibody without the site- specific non-natural amino acid. In certain embodiments, the antibody can show little or no loss of tRNA suppression, described below, compared to an antibody without the site-specific non-natural amino acid. In certain embodiments, the antibody can show enhanced tRNA suppression, described below, in production compared to an antibody without the site- specific non-natural amino acid.
[0059] In certain embodiments, a site-specific position for substitution provides an antibody that has advantageous solubility. In certain embodiments, the antibody can show little or no loss in solubility compared to an antibody without the site-specific non-natural amino acid. In certain embodiments, the antibody can show enhanced solubility compared to an antibody without the site-specific non-natural amino acid.
[0060] In certain embodiments, a site-specific position for substitution provides an antibody that has advantageous expression. In certain embodiments, the antibody can show little or no loss in expression compared to an antibody without the site-specific non-natural amino acid. In certain embodiments, the antibody can show enhanced expression compared to an antibody without the site-specific non-natural amino acid.
[0061] In certain embodiments, a site-specific position for substitution provides an antibody that has advantageous folding. In certain embodiments, the antibody can show little or no loss in proper folding compared to an antibody without the site-specific non-natural amino acid. In certain embodiments, the antibody can show enhanced folding compared to an antibody without the site-specific non-natural amino acid. [0062] In certain embodiments, a site-specific position for substitution provides an antibody that is capable of advantageous conjugation. As described below, several non- natural amino acids have side chains or functional groups that facilitate conjugation of the antibody to a second agent, either directly or via a linker. In certain embodiments, the antibody can show enhanced conjugation efficiency compared to an antibody without the same or other non-natural amino acids at other positions. In certain embodiments, the antibody can show enhanced conjugation yield compared to an antibody without the same or other non-natural amino acids at other positions. In certain embodiments, the antibody can show enhanced conjugation specificity compared to an antibody without the same or other non-natural amino acids at other positions.
[0063] The one or more non-natural amino acids are located at selected site-specific positions in at least one polypeptide chain of the antibody. The polypeptide chain can be any polypeptide chain of the antibody without limitation, including either light chain or either heavy chain. The site-specific position can be in any domain of the antibody, including any variable domain and any constant domain.
[0064] In certain embodiments, the antibodies provided herein comprise one non-natural amino acid at a site-specific position. In certain embodiments, the antibodies provided herein comprise two non-natural amino acids at site-specific positions. In certain embodiments, the antibodies provided herein comprise three non-natural amino acids at site-specific positions. In certain embodiments, the antibodies provided herein comprise more than three non-natural amino acids at site-specific positions.
[0065] The site-specific positions for substituting can be described with any antibody nomenclature system known to those of skill in the art. In the Kabat numbering system, these positions are at heavy chain residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H356, H358, H359, H360, H375, H383, H384, H386, H389, H392, H398, H404, H420, H421, H436, and H438. In other words, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H356, H358, H359, H360, H375, H383, H384, H386, H389, H392, H398, H404, H420, H421, H436, and H438.
[0066] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H074, H084, H118, H119, H132, H134, H135, H136, H137, H139, H160, H162, H165, H172, H191, H194, H239, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301 , H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H359, H375, H386, H389, H392, H398, H404, H420, H421, and H438.
[0067] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H023, H084, HI 18, HI 19, H132, H134, H136, H137, H160, H162, H172, H239, H241, H267, H269, H270, H271, H272, H282, H286, H292, H293, H296, H298, H329, H330, H334, H335, H340, H355, H359, H386, H389, H404, H420, H421, H438, and H342.
[0068] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H005, H084, HI 18, H132, H136, H239, H293, H334, H355, H359, and H389.
[0069] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H023, H074, H119, H134, H135, H137, H139, H160, H162, H165, H172, H191, H194, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H335, H337, H339, H342, H344, H355, H375, H386, H392, H398, H404, H420, H421, H340 and H438.
[0070] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues H042, H065, H138, H155, H174, H176, H177, H219, H238, H243, H262, H264, H265, H278, H342, H356, H358, H360, H383, H384 H404, and H436.
[0071] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues corresponding to H292-H301, H303, and H305.
[0072] In the Chothia numbering system, these positions are at heavy chain residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H356, H358, H359, H360, H375, H383, H384, H386, H389, H392, H398, H404, H420, H421, H436, and H438. In other words, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H023, H042, H065, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H138, H139, H155, H160, H162, H165, H172, H174, H176, H177, H191, H194, H219, H238, H239, H241, H243, H246, H262, H264, H265, H267, H268, H269, H270, H271, H272, H274, H275, H278, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299,H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H356, H358, H359, H360, H375, H383, H384, H386, H389, H392, H398, H404, H420, H421, H436, and H438.
[0073] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H023, H074, H084, HI 18, HI 19, H132, H134, H135, H136, H137, H139, H160, H162, H165, H172, H191, H194, H239, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H293, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H334, H335, H337, H339, H340, H342, H344, H355, H359, H375, H386, H389, H392, H398, H404, H420, H421, and H438. [0074] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H005, H084, HI 18, H132, H136, H239, H293, H334, H342, H355, H359, H389 and H404.
[0075] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Kabat residues corresponding to H292-H301, H303, and H305.
[0076] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H023, H074, H119, H134, H135, H137, H139, H160, H162, H165, H172, H191, H194, H241, H246, H267, H268, H269, H270, H271, H272, H274, H275, H280, H281, H282, H283, H286, H289, H292, H294, H295, H296, H297, H298, H299, H300, H301, H303, H305, H317, H320, H324, H326, H327, H329, H330, H332, H333, H335, H337, H339, H342, H344, H355, H375, H386, H392, H398, H420, H421, H340, H404, and H438.
[0077] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from Chothia residues H042, H065, H138, H155, H174, H176, H177, H219, H238, H243, H262, H264, H265, H278, H342, H356, H358, H360, H383, H384, H404, and H436.
[0078] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H005, H023, H084, HI 18, HI 19, H132, H134, H136, H137, H160, H162, H172, H239, H241, H267, H269, H270, H271, H272, H282, H286, H292, H293, H296, H298, H329, H330, H334, H335, H340, H355, H359, H386, H389, H404, H420, H421, H438, and H342, according to the Kabat or Chothia numbering scheme.
[0079] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, LI 12, LI 14, L144, L153, L156, L157, L168, L184, L202, L203, and L206, according to the Kabat or Chothia numbering scheme. In certain
embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, LI 12, LI 14, L144, L153, L156, L168, L184, L202, and L203, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L043, L049, L056, L057, L060, L067, L068, L109, L144, L153, L156, L184, L202, and L203, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues L049, L056, L057, L060, L067, L109, L153, L202, and L203, according to the Kabat or Chothia numbering scheme.
[0080] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, H119, H135, H136, H137, H160, H161, H162, H164, H195, H197, H219, H282, H289, H296, H330, H335, H361, H400, H404, H422, H440, H260, H267, H268, H272, H274, H292, H293, H297, H298, H303, H305, H332, H333, H334, H340, H341, H342, H343, H355, H362, H386, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H137, H160, H161, H162, H164, H195, H197, H219, H282, H296, H335, H361, H422, H440, H267, H272, H274, H293, H297, H298, H303, H305, H334, H340, H341, H342, H343, H355, H362, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H137, H160, H161, H162, H195, H197, H219, H282, H296, H422, H440, H267, H272, H293, H297, H298, H303, H305, H334, H340, H341, H342, H355, H392, H404, H424, H438, H442 and H443, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H023, H084, HI 18, HI 19, H135, H136, H160, H162, H195, H219, H282, H296, H267, H293, H297, H298, H303, H305, H334, H340, H341, H392, and H438, H442, according to the Kabat or Chothia numbering scheme.
[0081] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, H014, H016, H019, H025, H040, H043, H051, H052, H053, H056, H070, H082A, H098, H100, HI 10, HI 12, H121, H180, H184, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, HO 14, HO 16, H019, H025, H040, H043, H052, H053, H056, H070, H082A, H100, HI 10, HI 12, H121, H180, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H042, H003, H007, HO 14, HO 16, HO 19, H025, H040, H043, H052, H070, H082A, H100, HI 10, HI 12, H121, H180, H190, H192, H214, H216, H221, H222, H225, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues H007, HO 14, H019, H025, H040, H043, H052, H070, H100, HI 10, HI 12, H121, H180, H214, H216, H222, H227, H230, H231, H232, and H236, according to the Kabat or Chothia numbering scheme.
[0082] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L003, L005, L007, L008, L009, L010, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L138, L142, L143, L152, L171, L182, L188, L199, and L201 , according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues minus 1, L003, L005, L007, L008, L009, L010, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L142, L143, L152, L171, L182, L188, L199, and L201, according to the Kabat or Chothia numbering scheme. In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L003, L005, L007, L008, L009, L016, L017, L018, L020, L022, L026, L027, L045, L058, L063, L065, L066, L070, L077, L079, L107, L142, L152, L171, L182, L188, and L199, according to the Kabat or Chothia numbering scheme. In certain
embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues minus 1, L005, L007, L008, L016, L017, L018, L020, L022, L027, L045, L058, L063, L077, L079, L107, L142, L152, L182, L188, and L199, according to the Kabat or Chothia numbering scheme. In certain
embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L016, L063, and LI 99, according to the Kabat or Chothia numbering scheme. [0083] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues HO 19, H025, H051, H070, H098, HI 10, HI 12, H121, H136, H180, H187, H190, H214, H216, H221, and H222, according to the Kabat or Chothia numbering scheme.
[0084] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L007, L008, L016, L022, L063, L014, L070, L138, L142, L143 and L152, according to the Kabat or Chothia numbering scheme.
[0085] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues HO 19, H025, H051, H070, H077, H079, H098, HI 10, HI 12, H121, H136, H180, H187, H190, H214, H216, H221, and H222, according to the Kabat or Chothia numbering scheme.
[0086] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from residues (-)L001, L007, L008, L016, L022, L063, L070, L138, L142, L143, L152 and L201, according to the Kabat or Chothia numbering scheme.
[0087] The site-specific positions can also be identified relative to the amino acid sequences of the polypeptide chains of a reference antibody. For example, the amino acid sequence of a reference heavy chain is provided at SEQ ID NO: 1. In the reference heavy chain, the site-specific positions are at residues 5, 23, 42, 66, 75, 88, 121, 122, 135, 137, 138, 139, 140, 141, 142, 158, 163, 165, 168, 175, 177, 179, 180, 194, 197, 222, 241, 242, 244, 246, 249, 265, 267, 268, 270, 271, 272, 273, 274, 275, 277, 278, 281, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343, 345, 347, 358, 359, 361, 362, 363, 378, 386, 387, 389, 392, 395, 401, 407, 423, 424, 439 and 441. In other words, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 42, 66, 75, 88, 121, 122, 135, 137, 138, 139, 140, 141, 142, 158, 163, 165, 168, 175, 177, 179, 180, 194, 197, 222, 241, 242, 244, 246, 249, 265, 267, 268, 270, 271, 272, 273, 274, 275, 277, 278, 281, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343, 345, 347, 358, 359, 361, 362, 363, 378, 386, 387, 389, 392, 395, 401, 407, 423, 424, 439 and 441 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0088] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 75, 88, 121, 122, 135, 137, 138, 139, 140, 142, 163, 165, 168, 175, 194, 197, 242, 244, 249, 270, 271, 272, 273, 274, 275, 277, 278, 283, 284, 285, 286, 289, 292, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 337, 338, 340, 342, 343, 345, 347, 358, 362, 378, 389, 392, 395, 401, 407, 423, 424, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0089] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 23, 88, 121, 122, 135, 137, 138, 139, 140, 163, 165, 168, 175, 242, 244, 270, 273, 274, 275, 285, 289, 295, 296, 299, 300, 301, 332, 333, 337, 338, 343, 345, 358, 362, 389, 407, 423, 424, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: l .
[0090] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 5, 88,
121, 135, 139, 242, 296, 337, 358, 362, and 392 of the representative heavy chain
polypeptide according to SEQ ID NO: l .
[0091] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 75,
122, 137, 138, 140, 142, 163, 165, 168, 175, 194, 197, 244, 249, 270, 271, 272, 273, 274, 275, 277, 278, 283, 284, 285, 286, 289, 292, 295, 297, 298, 299, 300, 301, 302, 303, 304, 306, 308, 320, 323, 327, 329, 330, 332, 333, 335, 336, 338, 340, 342, 343, 345, 347, 358, 378, 389, 395, 401, 407, 423, 424, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0092] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 66, 141, 158, 177, 179, 180, 222, 241, 246, 265, 267, 268, 281, 359, 361, 363, 386, 387, 407, and 439 of the representative heavy chain polypeptide according to SEQ ID NO: l .
[0093] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 292- 301, 303, and 305 of the representative heavy chain polypeptide according to SEQ ID NO: l . [0094] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 292, 299, 333, 338, 364, 403, 407, 425, 443, 263, 270, 271, 275, 277, 295, 296, 300, 301, 306, 308, 335, 336, 337,
343, 344, 345, 346, 358, 365, 389, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0095] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 299, 338, 364, 425, 443, 270, 275, 277, 295, 296, 300, 301, 306, 308, 337, 343, 344, 345, 346, 358, 365, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: l .
[0096] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 167, 198, 200, 222, 285, 299, 364, 425, 443, 270, 275, 296, 300, 301, 306, 308, 337, 343, 344, 345, 358, 365, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0097] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 140, 163, 164, 165, 198, 200, 222, 285, 299, 425, 443, 270, 275, 296, 300, 301, 306, 308, 337, 343, 344, 345, 358, 395, 407, 427, 441, 445, and 446 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[0098] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 23, 88, 121, 122, 138, 139, 163, 165, 198, 222, 285, 299, 270, 296, 300, 301, 306, 308, 337, 343,
344, 395, 407, and 441 of the representative heavy chain polypeptide according to SEQ ID NO: l .
[0099] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 3, 7, 14, 16, 19, 25, 40, 43, 51, 52, 54, 57, 71, 84, 102, 104, 114, 119, 124, 183, 187, 193, 195, 217, 219, 224, 225, 228, 230, 233, 234, 235 and 239 of the representative heavy chain polypeptide according to SEQ ID NO: l . [00100] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 42, 3, 7, 14, 16, 19, 25, 40, 43, 52, 54, 57, 71, 84, 104, 114, 119, 124, 183, 193, 195, 217, 219, 224, 225, 228, 230, 233, 234, 235 and 239 of the representative heavy chain polypeptide according to SEQ ID NO: l .
[00101] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 7, 14, 19, 25, 40, 43, 52, 71, 104, 114, 119, 124, 183, 195, 217, 219, 230, 233, 234, 235, and 239 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[00102] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 10, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 138, 142, 143, 152, 171, 182, 188, 199, and 201 of the representative light chain polypeptide according to SEQ ID NO:2.
[00103] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 142, 143, 152, 171, 182, 188, 199, and 201 of the representative light chain polypeptide according to SEQ ID NO:2.
[00104] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 3, 5, 7, 8, 9, 16, 17, 18, 20, 22, 26, 27, 45, 58, 63, 65, 66, 70, 77, 79, 107, 142, 152, 171, 182, 188, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
[00105] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 5, 7, 8, 16, 17, 18, 20, 22, 27, 45, 58, 63, 77, 79, 107, 142, 152, 182, 188, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
[00106] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 16, 63, and 199 of the representative light chain polypeptide according to SEQ ID NO:2.
[00107] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 19, 25, 51, 71, 102, 114, 119, 124, 139, 183, 187, 193, 217, 219, 224, and 225 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[00108] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 7, 8, 16, 22, 63, 14, 70, 138, 142, 143 and 152 of the representative light chain polypeptide according to SEQ ID NO:2.
[00109] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 19, 25, 51, 71, 78, 80, 102, 114, 119, 124, 139, 183, 187, 193, 217, 219, 224, and 225 of the representative heavy chain polypeptide according to SEQ ID NO: 1.
[00110] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to minus 1, 7, 8, 16, 22, 63, 70, 138, 142, 143, 152, and 201of the representative light chain
polypeptide according to SEQ ID NO:2.
[00111] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49, 56, 57, 60, 67, 68, 109, 112, 114, 144, 153, 156, 157, 168, 184, 202, 203, and 206 of the representative light chain polypeptide according to SEQ ID NO:2.
[00112] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49, 56, 57, 60, 67, 68, 109, 112, 144, 153, 156, 168, 184, 202, and 203 of the representative light chain polypeptide according to SEQ ID NO:2.
[00113] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 43, 49,
56, 57, 60, 67, 68, 109, 144, 153, 156, 184, 202, and 203 of the representative light chain polypeptide according to SEQ ID NO:2.
[00114] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from those corresponding to 49, 56,
57, 60, 67, 109, 153, 202, and 203 of the representative light chain polypeptide according to SEQ ID NO:2. [00115] In certain embodiments, the antibody comprises a polypeptide chain that can be described by the following formula (I):
Xaa1- ... -(Naap(i))n- ... -Xaaq (I).
In Formula (I), each Xaa represents an amino acid in the polypeptide chain of any identity. In other words, each Xaa can be any amino acid, typically any naturally occurring amino acid, or a variant thereof. The superscript to the right of each Xaa represents the position of the amino acid within the primary sequence of the polypeptide chain. Xaa1 represents the first, or N-terminal, amino acid in the polypeptide chain, and Xaaq represents the last, or C- terminal, amino acid in the polypeptide chain. The variable q is an integer that is equal to the total number of amino acids in the polypeptide chain. Each Naa represents a non-natural amino acid within the polypeptide chain. Useful non-natural amino acids are described in the sections below. The integer n represents the number of non-natural amino acids in the polypeptide chain. In typical embodiments, n is an integer greater than 1. Each integer p(i) is greater than 1 and less than q, and the variable i is an integer that varies from 1 to n. Each integer p(i) represents a site-specific location in the amino acid sequence for the
corresponding Naa. Each site specific location p(i) is optimal for substitution of a naturally occurring amino acid with a non-natural amino acid, such as Naap^, according to the techniques described herein.
[00116] Analysis of the data from TAG screening as presented in the Examples allowed selection of sites which are ideal candidates for making ADCs on the basis of cell killing, expression levels, drug-to-antibody ratio, solvent accessibility and (where available) thermal stability. The most preferred sites have lower solvent accessibility, and higher
thermostability than the other tested variants. The preferred sites for nnAA incorporation are listed in Table I, below.
Table I: Preferred Sites for nnAA Incorporation
Site of nnAA Preference
HC-F404 Most Preferred
HC-K121 Most Preferred
HC-S136 Most Preferred
HC-Y180 Most Preferred
HC-F241 Most Preferred
LC-T22 Most Preferred
LC-S7 Most Preferred
LC-N152 Most Preferred
HC-S25 More Preferred
HC-A40 More Preferred HC-S119 More Preferred
HC-S190 More Preferred
HC-K222 More Preferred
HC-R19 Preferred
HC-Y52 Preferred
HC-S70 Preferred
[00117] Accordingly, in certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC-N152, HC-S136, HC-S25, HC-A40, HC-S119, HC-S190, HC-K222, HC-R19, HC-Y52, or HC-S70 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
[00118] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC- N152, HC-S136, HC-S25, HC-A40, HC-S119, HC-S190, and HC-K222 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
[00119] In certain embodiments, provided herein are antibodies comprising one or more non-natural amino acids at one or more positions selected from the group consisting of heavy chain or light chain residues HC-F404, HC-K121, HC-Y180, HC-F241, LC-T22, LC-S7, LC- N152, and HC-S136 according to the Kabat or Chothia numbering scheme, or a post- translationally modified variant thereof.
[00120] In certain embodiments, further provided herein are conservatively modified variants of the above antibodies. Conservatively modified variants of an antibody include one or more insertions, deletions or substitutions that do not disrupt the structure and/or function of the antibody when evaluated by one of skill in the art. In certain embodiments, conservatively modified variants include 20 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 15 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 10 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 9 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 8 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 7 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 6 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 5 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 4 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 3 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 2 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, conservatively modified variants include 1 amino acid insertion, deletion or substitution. In particular embodiments the substitutions are conservative, substituting an amino acid within the same class, as described above.
[00121] In certain embodiments, the antibodies can be modified to modulate structure, stability and/or activity. In such embodiments, the modifications can be conservative or other than conservative. The modifications need only be suitable to the practitioner carrying out the methods and using the compositions described herein. In certain embodiments, the modifications decrease but do not eliminate antigen binding affinity. In certain embodiments, the modifications increase antigen binding affinity. In certain embodiments, the
modifications enhance structure or stability of the antibody. In certain embodiments, the modifications reduce but do not eliminate structure or stability of the antibody. In certain embodiments, modified variants include 20 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 15 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 10 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 9 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 8 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 7 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 6 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 5 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 4 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 3 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 2 or fewer amino acid insertions, deletions or substitutions. In certain embodiments, modified variants include 1 amino acid insertion, deletion or substitution.
[00122] Also within the scope are post-translationally modified variants. Any of the antibodies provided herein can be post-translationally modified in any manner recognized by those of skill in the art. Typical post-translational modifications for antibodies include interchain disulfide bonding, intrachain disulfide bonding, N-linked glycosylation and proteolysis. Also provided herein are other post-translationally modified antibodies having modifications such as phosphorylation, O-linked glycosylation, methylation, acetylation, lipidation, GPI anchoring, myristoylation and prenylation. The post-translational
modification can occur during production, in vivo, in vitro or otherwise. In certain embodiments, the post-translational modification can be an intentional modification by a practitioner, for instance, using the methods provided herein.
[00123] Further included within the scope are antibodies fused to further peptides or polypeptides. Exemplary fusions include, but are not limited to, e.g., a methionyl antibody in which a methionine is linked to the N-terminus of the antibody resulting from the
recombinant expression, fusions for the purpose of purification (including but not limited to, to poly-histidine or affinity epitopes), fusions for the purpose of linking to other biologically active molecules, fusions with serum albumin binding peptides, and fusions with serum proteins such as serum albumin. The antibodies may comprise protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including but not limited to, FLAG, poly-His, GST, etc.). The antibodies may also comprise linked molecules (including but not limited to, biotin) that improve detection (including but not limited to, GFP), purification or other features of the antibody. In certain embodiments, the antibodies comprise a C-terminal affinity sequence that facilitates purification of full length antibodies. In certain embodiments, such C-terminal affinity sequence is a poly-His sequence, e.g., a 6-His sequence.
[00124] The antibody can have any antibody form recognized by those of skill in the art. The antibody can comprise a single polypeptide chain - a single heavy chain or a single light chain. The antibody can also form multimers that will be recognized by those of skill in the art including homodimers, heterodimers, homomultimers, and heteromultimers. These multimers can be linked or unlinked. Useful linkages include interchain disulfide bonds typical for antibody molecules. The multimers can also be linked by other amino acids, including the non-natural amino acids introduced according to the present description. The antibody can be an immunoglobulin such as of any class or subclass including IgA, IgAl, IgA2, IgD, IgE, IgG, IgGl, IgG2, IgG3, IgG4 and IgM. The antibody can be of the form of any antibody fragment including Fv, Fc, Fab, and (Fab')2 and scFv.
[00125] The antibody may further be glycosylated or aglycosyated. Accordingly, in certain embodiments, the antibody is glycosylated. In certain embodiments, the antibody is aglycosylated. Agylcosylated antibodies comprising a non-natural amino acid may be made, for example, as described in the Examples provided herein or through bacterial expression systems known to those skilled in the art. Glycosylated antibodies comprising a non-natural amino acid may be made, for example, as described by Axup et ah, 2012, Proc. Nat. Acad. Sci. USA 109(40): 16101-16106.
[00126] Also provided herein are antibodies that are conjugated to one or more
conjugation moieties. The conjugation moiety can be any conjugation moiety deemed useful to one of skill in the art. For instance, the conjugation moiety can be a polymer, such as polyethylene glycol, that can improve the stability of the antibody in vitro or in vivo. The conjugation moiety can have therapeutic activity, thereby yielding an antibody-drug conjugate. The conjugation moiety can be a molecular payload that is harmful to target cells. The conjugation moiety can be a label useful for detection or diagnosis. In certain embodiments, the conjugation moiety is linked to the antibody via a direct covalent bond. In certain embodiments, the conjugation moiety is linked to the antibody via a linker. In advantageous embodiments, the conjugation moiety or the linker is attached via one of the non-natural amino acids of the antibody. Exemplary conjugation moieties and linkers are discussed in the sections below.
Non-natural amino acids
[00127] The non-natural amino acid can be any non-natural amino acid known to those of skill in the art. In some embodiments, the non-naturally encoded amino acid comprises a functional group. The functional group can be any functional group known to those of skill in the art. In certain embodiments the functional group is a label, a polar group, a non-polar group or a reactive group.
[00128] Reactive groups are particularly advantageous for linking further functional groups to the antibody at the site-specific position of the antibody chain. In certain embodiments, the reactive group is selected from the group consisting of amino, carboxy, acetyl, hydrazino, hydrazido, semicarbazido, sulfanyl, azido and alkynyl. [00129] In certain embodiments, the amino acid residue is according to any of the following formulas:
Figure imgf000030_0001
Those of skill in the art will recognize that antibodies are generally comprised of L-amino acids. However, with non-natural amino acids, the present methods and compositions provide the practitioner with the ability to use L-, D- or racemic non-natural amino acids at the site-specific positions. In certain embodiments, the non-natural amino acids described herein include D- versions of the natural amino acids and racemic versions of the natural amino acids.
[00130] In the above formulas, the wavy lines indicate bonds that connect to the remainder of the polypeptide chains of the antibodies. These non-natural amino acids can be incorporated into polypeptide chains just as natural amino acids are incorporated into the same polypeptide chains. In certain embodiments, the non-natural amino acids are incorporated into the polypeptide chain via amide bonds as indicated in the formulas.
[00131] In the above formulas R designates any functional group without limitation, so long as the amino acid residue is not identical to a natural amino acid residue. In certain embodiments, R can be a hydrophobic group, a hydrophilic group, a polar group, an acidic group, a basic group, a chelating group, a reactive group, a therapeutic moiety or a labeling
1 2 3 moiety. In certain embodiments, R is selected from the group consisting of R NR R , R1C(=0)R2, R1C(=0)OR2, R1^, R^CH). In these embodiments, R1 is selected from the
2 3 group consisting of a bond, alkylene, heteroalkylene, arylene, heteroarylene. R and R are each independently selected from the group consisting of hydrogen, alkyl and heteroalklyl.
[00132] In some embodiments, the non-naturally encoded amino acids include side chain functional groups that react efficiently and selectively with functional groups not found in the 20 common amino acids (including but not limited to, azido, ketone, aldehyde and aminooxy groups) to form stable conjugates. For example, antigen-binding polypeptide that includes a non-naturally encoded amino acid containing an azido functional group can be reacted with a polymer (including but not limited to, poly(ethylene glycol) or, alternatively, a second polypeptide containing an alkyne moiety to form a stable conjugate resulting for the selective reaction of the azide and the alkyne functional groups to form a Huisgen [3+2] cycloaddition product.
[00133] Exemplary non-naturally encoded amino acids that may be suitable for use in the present invention and that are useful for reactions with water soluble polymers include, but are not limited to, those with carbonyl, aminooxy, hydrazine, hydrazide, semicarbazide, azide and alkyne reactive groups. In some embodiments, non-naturally encoded amino acids comprise a saccharide moiety. Examples of such amino acids include N-acetyl-L- glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L- threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L-serine. Examples of such amino acids also include examples where the naturally-occurring N- or O-linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature-including but not limited to, an alkene, an oxime, a thioether, an amide and the like. Examples of such amino acids also include saccharides that are not commonly found in naturally-occurring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
[00134] Many of the non-naturally encoded amino acids provided herein are commercially available, e.g., from Sigma-Aldrich (St. Louis, Mo., USA), Novabiochem (a division of EMD Biosciences, Darmstadt, Germany), or Peptech (Burlington, Mass., USA). Those that are not commercially available are optionally synthesized as provided herein or using standard methods known to those of skill in the art. For organic synthesis techniques, see, e.g., Organic Chemistry by Fessendon and Fessendon, (1982, Second Edition, Willard Grant Press, Boston Mass.); Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York); and Advanced Organic Chemistry by Carey and Sundberg (Third Edition, Parts A and B, 1990, Plenum Press, New York). See, also, U.S. Patent Application Publications 2003/0082575 and 2003/0108885, which is incorporated by reference herein. In addition to unnatural amino acids that contain novel side chains, unnatural amino acids that may be suitable for use in the present invention also optionally comprise modified backbone structures, including but not limited to, as illustrated by the structures of Formula II and III:
Figure imgf000031_0001
wherein Z typically comprises OH, NH2, SH, NH-R', or S-R'; X and Y, which can be the same or different, typically comprise S or O, and R and R', which are optionally the same or different, are typically selected from the same list of constituents for the R group described above for the unnatural amino acids having Formula I as well as hydrogen. For example, unnatural amino acids of the invention optionally comprise substitutions in the amino or carboxyl group as illustrated by Formulas II and III. Unnatural amino acids of this type include, but are not limited to, a-hydroxy acids, a-thioacids, a-aminothiocarboxylates, including but not limited to, with side chains corresponding to the common twenty natural amino acids or unnatural side chains. In addition, substitutions at the a-carbon optionally include, but are not limited to, L, D, or α-α-disubstituted amino acids such as D-glutamate, D- alanine, D-methyl-O-tyrosine, aminobutyric acid, and the like. Other structural alternatives include cyclic amino acids, such as proline analogues as well as 3, 4, 6, 7, 8, and 9 membered ring proline analogues, P and y amino acids such as substituted β-alanine and γ-amino butyric acid.
[00135] Many unnatural amino acids are based on natural amino acids, such as tyrosine, glutamine, phenylalanine, and the like, and are suitable for use in the present invention.
Tyrosine analogs include, but are not limited to, para-substituted tyrosines, ortho-substituted tyrosines, and meta substituted tyrosines, where the substituted tyrosine comprises, including but not limited to, a keto group (including but not limited to, an acetyl group), a benzoyl group, an amino group, a hydrazine, an hydroxyamine, a thiol group, a carboxy group, an isopropyl group, a methyl group, a C6-C2o straight chain or branched hydrocarbon, a saturated or unsaturated hydrocarbon, an O-methyl group, a polyether group, a nitro group, an alkynyl group or the like. In addition, multiply substituted aryl rings are also contemplated.
Glutamine analogs that may be suitable for use in the present invention include, but are not limited to, a-hydroxy derivatives, γ-substituted derivatives, cyclic derivatives, and amide substituted glutamine derivatives. Example phenylalanine analogs that may be suitable for use in the present invention include, but are not limited to, para-substituted phenylalanines, ortho-substituted phenyalanines, and meta-substituted phenylalanines, where the substituent comprises, including but not limited to, a hydroxy group, a methoxy group, a methyl group, an allyl group, an aldehyde, an azido, an iodo, a bromo, a keto group (including but not limited to, an acetyl group), a benzoyl, an alkynyl group, or the like. Specific examples of unnatural amino acids that may be suitable for use in the present invention include, but are not limited to, a p-acetyl-L-phenylalanine, an O-methyl-L-tyrosine, an L-3-(2- naphthyl)alanine, a 3-methyl-phenylalanine, an O-4-allyl-L-tyrosine, a 4-propyl-L-tyrosine, a tri-O-acetyl-GlcNAcP-serine, an L-Dopa, a fluorinated phenylalanine, an isopropyl-L- phenylalanine, a p-azido-L-phenylalanine, a p-acyl-L-phenylalanine, a p-benzoyl-L- phenylalanine, an L-phosphoserine, a phosphonoserine, a phosphonotyrosine, a p-iodo- phenylalanine, a p-bromophenylalanine, a p-amino-L-phenylalanine, an isopropyl-L- phenylalanine, and a p-propargyloxy-phenylalanine, and the like. Examples of structures of a variety of unnatural amino acids that may be suitable for use in the present invention are provided in, for example, WO 2002/085923 entitled "In vivo incorporation of unnatural amino acids." See also Kiick et al., (2002) Incorporation of azides into recombinant proteins for chemoselective modification by the Staudinger ligation, PNAS 99: 19-24, for additional methionine analogs.
[00136] Many of the unnatural amino acids suitable for use in the present invention are commercially available, e.g., from Sigma (USA) or Aldrich (Milwaukee, Wis., USA). Those that are not commercially available are optionally synthesized as provided herein or as provided in various publications or using standard methods known to those of skill in the art. For organic synthesis techniques, see, e.g., Organic Chemistry by Fessendon and Fessendon, (1982, Second Edition, Willard Grant Press, Boston Mass.); Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York); and Advanced Organic Chemistry by Carey and Sundberg (Third Edition, Parts A and B, 1990, Plenum Press, New York). Additional publications describing the synthesis of unnatural amino acids include, e.g., WO 2002/085923 entitled "In vivo incorporation of Unnatural Amino Acids;" Matsoukas et al., (1995) J. Med. Chem., 38, 4660-4669; King, F. E. & Kidd, D. A. A. (1949) A New Synthesis of Glutamine and of γ-Dipeptides of Glutamic Acid from Phthylated Intermediates. J. Chem. Soc, 3315-3319; Friedman, O. M. & Chatterrji, R. (1959) Synthesis of Derivatives of Glutamine as Model Substrates for Anti-Tumor Agents. J. Am. Chem. Soc. 81, 3750-3752; Craig, J. C. et al. (1988) Absolute Configuration of the Enantiomers of 7-Chloro-4 [[4- (diethylamino)-l-methylbutyl] amino] quino line (Chloroquine). J. Org. Chem. 53, 1167-1170; Azoulay, M., Vilmont, M. & Frappier, F. (1991) Glutamine analogues as Potential
Antimalarials, Eur. J. Med. Chem. 26, 201-5; Koskinen, A. M. P. & Rapoport, H. (1989) Synthesis of 4-Substituted Prolines as Conformationally Constrained Amino Acid Analogues. J. Org. Chem. 54, 1859-1866; Christie, B. D. & Rapoport, H. (1985) Synthesis of Optically Pure Pipecolates from L-Asparagine. Application to the Total Synthesis of (+)-Apovincamine through Amino Acid Decarbonylation and Iminium Ion Cyclization. J. Org. Chem. 1989: 1859-1866; Barton et al, (1987) Synthesis of Novel a-Amino-Acids and Derivatives Using Radical Chemistry: Synthesis of L- and D-a-Amino-Adipic Acids, L-a-aminopimelic Acid and Appropriate Unsaturated Derivatives. Tetrahedron Lett. 43:4297-4308; and, Subasinghe et al, (1992) Quisqualic acid analogues: synthesis of beta-heterocyclic 2- aminopropanoic acid derivatives and their activity at a novel quisqualate-sensitized site. J. Med. Chem. 35:4602-7. See also, patent applications entitled "Protein Arrays," filed Dec. 22, 2003, Ser. No. 10/744,899 and Ser. No. 60/435,821 filed on Dec. 22, 2002.
[00137] Amino acids with a carbonyl reactive group allow for a variety of reactions to link molecules (including but not limited to, PEG or other water soluble molecules) via nucleophilic addition or aldol condensation reactions among others.
[00138] Exemplary carbonyl-containing amino acids can be represented as follows:
(CH2)f7R1COR2
R3HN^COR4 wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl; R2 is H, alkyl, aryl, substituted alkyl, and substituted aryl; and R3 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R4 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1, Ri is phenyl and R2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the para position relative to the alkyl side chain. In some embodiments, n is 1, Ri is phenyl and R2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the meta position relative to the alkyl side chain.
[00139] In the present invention, a non-naturally encoded amino acid bearing adjacent hydroxyl and amino groups can be incorporated into the polypeptide as a "masked" aldehyde functionality. For example, 5-hydroxylysine bears a hydroxyl group adjacent to the epsilon amine. Reaction conditions for generating the aldehyde typically involve addition of molar excess of sodium metaperiodate under mild conditions to avoid oxidation at other sites within the polypeptide. The pH of the oxidation reaction is typically about 7.0. A typical reaction involves the addition of about 1.5 molar excess of sodium meta periodate to a buffered solution of the polypeptide, followed by incubation for about 10 minutes in the dark. See, e.g. U.S. Pat. No. 6,423,685, which is incorporated by reference herein. [00140] The carbonyl functionality can be reacted selectively with a hydrazine-, hydrazide-, hydroxylamine-, or semicarbazide-containing reagent under mild conditions in aqueous solution to form the corresponding hydrazone, oxime, or semicarbazone linkages, respectively, that are stable under physiological conditions. See, e.g., Jencks, W. P., J. Am. Chem. Soc. 81, 475-481 (1959); Shao, J. and Tarn, J. P., J. Am. Chem. Soc. 117:3893-3899 (1995). Moreover, the unique reactivity of the carbonyl group allows for selective
modification in the presence of the other amino acid side chains. See, e.g., Cornish, V. W., et al, J. Am. Chem. Soc. 118:8150-8151 (1996); Geoghegan, K. F. & Stroh, J. G., Bioconjug. Chem. 3: 138-146 (1992); Mahal, L. K., et al, Science 276: 1125-1128 (1997).
[00141] Non-naturally encoded amino acids containing a nucleophilic group, such as a hydrazine, hydrazide or semicarbazide, allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
[00142] Exemplary hydrazine, hydrazide or semicarbazide -containing amino acids can be represented as follows:
(CH2)nRiX-C(0)-NH-HN2
R2HN /^COR3 wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X, is O, N, or S or not present; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
[00143] In some embodiments, n is 4, Ri is not present, and X is N. In some embodiments, n is 2, Ri is not present, and X is not present. In some embodiments, n is 1, Ri is phenyl, X is O, and the oxygen atom is positioned para to the alphatic group on the aryl ring.
[00144] Hydrazide-, hydrazine-, and semicarbazide-containing amino acids are available from commercial sources. For instance, L-glutamate-y-hydrazide is available from Sigma Chemical (St. Louis, Mo.). Other amino acids not available commercially can be prepared by one skilled in the art. See, e.g., U.S. Pat. No. 6,281,211, which is incorporated by reference herein.
[00145] Polypeptides containing non-naturally encoded amino acids that bear hydrazide, hydrazine or semicarbazide functionalities can be reacted efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 117:3893-3899 (1995). The unique reactivity of hydrazide, hydrazine and semicarbazide functional groups makes them significantly more reactive toward aldehydes, ketones and other electrophilic groups as compared to the nucleophilic groups present on the 20 common amino acids (including but not limited to, the hydroxyl group of serine or threonine or the amino groups of lysine and the N-terminus).
[00146] Non-naturally encoded amino acids containing an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers). Like hydrazines, hydrazides and semicarbazides, the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 117:3893-3899 (1995); H. Hang and C. Bertozzi, Acc. Chem. Res. 34: 727-736 (2001). Whereas the result of reaction with a hydrazine group is the corresponding hydrazone, however, an oxime results generally from the reaction of an aminooxy group with a carbonyl-containing group such as a ketone.
[00147] Exemplary amino acids containing aminooxy groups can be represented as follows:
(CH2)„Ri— X-(CH2)„-Y— O— NH2
R2HN ^COR3 wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X is O, N, S or not present; m is 0-10; Y=C(0) or not present; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1, Ri is phenyl, X is O, m is 1, and Y is present. In some embodiments, n is 2, Ri and X are not present, m is 0, and Y is not present.
[00148] Aminooxy-containing amino acids can be prepared from readily available amino acid precursors (homoserine, serine and threonine). See, e.g., M. Carrasco and R. Brown, J. Org. Chem. 68: 8853-8858 (2003). Certain aminooxy-containing amino acids, such as L-2- amino-4-(aminooxy)butyric acid), have been isolated from natural sources (Rosenthal, G. et al., Life Sci. 60: 1635-1641 (1997). Other aminooxy-containing amino acids can be prepared by one skilled in the art.
[00149] The unique reactivity of azide and alkyne functional groups makes them extremely useful for the selective modification of polypeptides and other biological molecules. Organic azides, particularly alphatic azides, and alkynes are generally stable toward common reactive chemical conditions. In particular, both the azide and the alkyne functional groups are inert toward the side chains (i.e., R groups) of the 20 common amino acids found in naturally-occurring polypeptides. When brought into close proximity, however, the "spring-loaded" nature of the azide and alkyne groups is revealed and they react selectively and efficiently via Huisgen [3+2] cycloaddition reaction to generate the corresponding triazole. See, e.g., Chin J., et al, Science 301 :964-7 (2003); Wang, Q., et al, J. Am. Chem. Soc. 125, 3192-3193 (2003); Chin, J. W., et al, J. Am. Chem. Soc. 124:9026- 9027 (2002).
[00150] Because the Huisgen cycloaddition reaction involves a selective cycloaddition reaction (see, e.g., Padwa, A., in COMPREHENSIVE ORGANIC SYNTHESIS, Vol. 4, (ed. Trost, B. M., 1991), p. 1069-1109; Huisgen, R. in 1,3-DIPOLAR CYCLOADDITION CHEMISTRY, (ed. Padwa, A., 1984), p. 1-176) rather than a nucleophilic substitution, the incorporation of non-naturally encoded amino acids bearing azide and alkyne-containing side chains permits the resultant polypeptides to be modified selectively at the position of the non- naturally encoded amino acid. Cycloaddition reaction involving azide or alkyne-containing antibody can be carried out at room temperature under aqueous conditions by the addition of Cu(II) (including but not limited to, in the form of a catalytic amount of CuS04) in the presence of a reducing agent for reducing Cu(II) to Cu(I), in situ, in catalytic amount. See, e.g., Wang, Q., et al, J. Am. Chem. Soc. 125, 3192-3193 (2003); Tornoe, C. W., et al, J. Org. Chem. 67:3057-3064 (2002); Rostovtsev, et al, Angew. Chem. Int. Ed. 41 :2596-2599 (2002). Exemplary reducing agents include, including but not limited to, ascorbate, metallic copper, quinine, hydroquinone, vitamin K, glutathione, cysteine, Fe , Co , and an applied electric potential.
[00151] In some cases, where a Huisgen [3+2] cycloaddition reaction between an azide and an alkyne is desired, the antigen-binding polypeptide comprises a non-naturally encoded amino acid comprising an alkyne moiety and the water soluble polymer to be attached to the amino acid comprises an azide moiety. Alternatively, the converse reaction (i.e., with the azide moiety on the amino acid and the alkyne moiety present on the water soluble polymer) can also be performed.
[00152] The azide functional group can also be reacted selectively with a water soluble polymer containing an aryl ester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage. The aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with a proximal ester linkage to generate the corresponding amide. See, e.g., E. Saxon and C. Bertozzi, Science 287, 2007-2010 (2000). The azide-containing amino acid can be either an alkyl azide (including but not limited to, 2- amino-6-azido-l-hexanoic acid) or an aryl azide (p-azido-phenylalanine).
[00153] Exemplary water soluble polymers containing an aryl ester and a phosphine moiety can be represented as follows:
Figure imgf000038_0001
wherein X can be O, N, S or not present, Ph is phenyl, W is a water soluble polymer and R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups. Exemplary R groups include but are not limited to -CH2, -C(CH3)3, -OR, -NR'R", -SR*, -halogen, -C(0)R*, - CONR'R", -S(0)2R, -S(0)2NR*R", -CN and -N02. R, R", R'" and R"" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present. When R and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring. For example, -NR'R" is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term "alkyl" is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF3 and -CH2CF3) and acyl (including but not limited to, - C(0)CH3, -C(0)CF3, -C(0)CH2OCH3, and the like).
[00154] The azide functional group can also be reacted selectively with a water soluble polymer containing a thioester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage. The aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with the thioester linkage to generate the corresponding amide. Exemplary water soluble polymers containing a thioester and a phosphine moiety can be represented as follows:
Figure imgf000039_0001
wherein n is 1-10; X can be O, N, S or not present, Ph is phenyl, and W is a water soluble polymer.
[00155] Exemplary alkyne-containing amino acids can be represented as follows:
Figure imgf000039_0002
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X is O, N, S or not present; m is 0-10, R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1 , Ri is phenyl, X is not present, m is 0 and the acetylene moiety is positioned in the para position relative to the alkyl side chain. In some embodiments, n is 1 , Ri is phenyl, X is O, m is 1 and the propargyloxy group is positioned in the para position relative to the alkyl side chain (i.e. , O-propargyl-tyrosine). In some embodiments, n is 1 , Ri and X are not present and m is 0 (i.e. , proparylglycine).
[00156] Alkyne-containing amino acids are commercially available. For example, propargylglycine is commercially available from Peptech (Burlington, Mass.). Alternatively, alkyne-containing amino acids can be prepared according to standard methods. For instance, p-propargyloxyphenylalanine can be synthesized, for example, as described in Deiters, A., et al., J. Am. Chem. Soc. 125 : 1 1782-1 1783 (2003), and 4-alkynyl-L-phenylalanine can be synthesized as described in Kayser, B., et al, Tetrahedron 53(7): 2475-2484 (1997). Other alkyne-containing amino acids can be prepared by one skilled in the art.
[00157] Exemplary azide-containing amino acids can be represented as follows:
Figure imgf000040_0001
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, substituted aryl or not present; X is O, N, S or not present; m is 0-10; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1 , Ri is phenyl, X is not present, m is 0 and the azide moiety is positioned para to the alkyl side chain. In some embodiments, n is 0-4 and Ri and X are not present, and m=0. In some embodiments, n is 1 , Ri is phenyl, X is O, m is 2 and the P-azidoethoxy moiety is positioned in the para position relative to the alkyl side chain.
[00158] Azide-containing amino acids are available from commercial sources. For instance, 4-azidophenylalanine can be obtained from Chem-Impex International, Inc. (Wood Dale, 111.). For those azide-containing amino acids that are not commercially available, the azide group can be prepared relatively readily using standard methods known to those of skill in the art, including but not limited to, via displacement of a suitable leaving group (including but not limited to, halide, mesylate, tosylate) or via opening of a suitably protected lactone. See, e.g., Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York).
[00159] The unique reactivity of beta-substituted aminothiol functional groups makes them extremely useful for the selective modification of polypeptides and other biological molecules that contain aldehyde groups via formation of the thiazolidine. See, e.g., J. Shao and J. Tarn, J. Am. Chem. Soc. 1995, 1 17 (14) 3893-3899. In some embodiments, beta- substituted aminothiol amino acids can be incorporated into antibodies and then reacted with water soluble polymers comprising an aldehyde functionality. In some embodiments, a water soluble polymer, drug conjugate or other payload can be coupled to an antibody polypeptide comprising a beta-substituted aminothiol amino acid via formation of the thiazolidine.
[00160] Particular examples of useful non-natural amino acids include, but are not limited to, p-acetyl-L-phenylalanine, O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, 3-methyl- phenylalanine, O-4-allyl-L-tyrosine, 4-propyl-L-tyrosine, tri-O-acetyl-GlcNAc b-serine, L- Dopa, fluorinated phenylalanine, isopropyl-L-phenylalanine, p-azido-L-phenylalanine, p- acyl-L-phenylalanine, p-benzoyl-L-phenylalanine, L-phosphoserine, phosphonoserine, phosphonotyrosine, p-iodo-phenylalanine, p-bromophenylalanine, p-amino-L-phenylalanine, isopropyl-L-phenylalanine, and p-propargyloxy-phenylalanine. Further useful examples include N-acetyl-L-glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L- glucosaminyl-L-threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L- serine.
[00161] In particular embodiments, the non-natural amino acids are selected from p- acetyl- phenylalanine, p-ethynyl-phenylalanine, p-propargyloxyphenylalanine, and p-azido- phenylalanine. One particularly useful non-natural amino acid is p-azido phenylalanine. This amino acid residue is known to those of skill in the art to facilitate Huisgen [3+2] cyloaddition reactions (so-called "click" chemistry reactions) with, for example, compounds bearing alkynyl groups. This reaction enables one of skill in the art to readily and rapidly conjugate to the antibody at the site-specific location of the non-natural amino acid.
[00162] In certain embodiments, the first reactive group is an alkynyl moiety (including but not limited to, in the unnatural amino acid p-propargyloxyphenylalanine, where the propargyl group is also sometimes referred to as an acetylene moiety) and the second reactive group is an azido moiety, and [3+2] cycloaddition chemistry can be used. In certain embodiments, the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid p-azido-L-phenylalanine) and the second reactive group is the alkynyl moiety.
[00163] In the above formulas, each L represents a divalent linker. The divalent linker can be any divalent linker known to those of skill in the art. Generally, the divalent linker is capable of forming covalent bonds to the functional moiety R and the alpha carbon of the non-natural amino acid. Useful divalent linkers a bond, alkylene, substituted alkylene, heteroalkylene, substituted heteroalkylene, arylene, substituted arylene, heteroarlyene and substituted heteroarylene. In certain embodiments, L is C1-10 alkylene or C1-10
heteroalkylene.
[00164] The non-natural amino acids used in the methods and compositions described herein have at least one of the following four properties: (1) at least one functional group on the sidechain of the non-natural amino acid has at least one characteristics and/or activity and/or reactivity orthogonal to the chemical reactivity of the 20 common, genetically- encoded amino acids (i.e. , alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine), or at least orthogonal to the chemical reactivity of the naturally occurring amino acids present in the polypeptide that includes the non-natural amino acid; (2) the introduced non-natural amino acids are substantially chemically inert toward the 20 common, genetically-encoded amino acids; (3) the non-natural amino acid can be stably incorporated into a polypeptide, preferably with the stability commensurate with the naturally-occurring amino acids or under typical
physiological conditions, and further preferably such incorporation can occur via an in vivo system; and (4) the non-natural amino acid includes an oxime functional group or a functional group that can be transformed into an oxime group by reacting with a reagent, preferably under conditions that do not destroy the biological properties of the polypeptide that includes the non-natural amino acid (unless of course such a destruction of biological properties is the purpose of the modification/transformation), or where the transformation can occur under aqueous conditions at a pH between about 4 and about 8, or where the reactive site on the non-natural amino acid is an electrophilic site. Illustrative, non-limiting examples of amino acids that satisfy these four properties for non-natural amino acids that can be used with the compositions and methods described herein are presented in FIGS. 2, 3, 35 and 40- 43. Any number of non-natural amino acids can be introduced into the polypeptide. Non- natural amino acids may also include protected or masked oximes or protected or masked groups that can be transformed into an oxime group after deprotection of the protected group or unmasking of the masked group. Non-natural amino acids may also include protected or masked carbonyl or dicarbonyl groups, which can be transformed into a carbonyl or dicarbonyl group after deprotection of the protected group or unmasking of the masked group and thereby are available to react with hydroxylamines or oximes to form oxime groups.
[00165] In further embodiments, non-natural amino acids that may be used in the methods and compositions described herein include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or non-covalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analogue, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, aldehyde-containing amino acids, amino acids comprising polyethylene glycol or other polyethers, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater than about 5 or greater than about 10 carbons, carbon- linked sugar-containing amino acids, redox- active amino acids, amino thioacid containing amino acids, and amino acids comprising one or more toxic moiety.
[00166] In some embodiments, non-natural amino acids comprise a saccharide moiety. Examples of such amino acids include N-acetyl-L-glucosaminyl-L-serine, N-acetyl-L- galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L-threonine, N-acetyl-L-glucosaminyl-L- asparagine and O-mannosaminyl-L-serine. Examples of such amino acids also include examples where the naturally-occurring N- or 0-linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature-including but not limited to, an alkene, an oxime, a thioether, an amide and the like. Examples of such amino acids also include saccharides that are not commonly found in naturally-occurring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
[00167] The chemical moieties incorporated into antibodies via incorporation of non- natural amino acids offer a variety of advantages and manipulations of polypeptides. For example, the unique reactivity of a carbonyl or dicarbonyl functional group (including a keto- or aldehyde-functional group) allows selective modification of antibodies with any of a number of hydrazine- or hydroxylamine-containing reagents in vivo and in vitro. A heavy atom non-natural amino acid, for example, can be useful for phasing x-ray structure data. The site-specific introduction of heavy atoms using non-natural amino acids also provides selectivity and flexibility in choosing positions for heavy atoms. Photoreactive non-natural amino acids (including but not limited to, amino acids with benzophenone and arylazides (including but not limited to, phenylazide) side chains), for example, allow for efficient in vivo and in vitro photocrosslinking of polypeptides. Examples of photoreactive non-natural amino acids include, but are not limited to, p-azido-phenylalanine and p-benzoyl- phenylalanine. The antibodies with the photoreactive non-natural amino acids may then be crosslinked at will by excitation of the photoreactive group-providing temporal control. In a non-limiting example, the methyl group of a non-natural amino can be substituted with an isotopically labeled, including but not limited to, with a methyl group, as a probe of local structure and dynamics, including but not limited to, with the use of nuclear magnetic resonance and vibrational spectroscopy. [00168] Amino acids with an electrophilic reactive group allow for a variety of reactions to link molecules via various chemical reactions, including, but not limited to, nucleophilic addition reactions. Such electrophilic reactive groups include a carbonyl- or dicarbonyl-group (including a keto- or aldehyde group), a carbonyl-like- or dicarbonyl-like-group (which has reactivity similar to a carbonyl- or dicarbonyl-group and is structurally similar to a carbonyl - or dicarbonyl-group), a masked carbonyl- or masked dicarbonyl-group (which can be readily converted into a carbonyl- or dicarbonyl-group), or a protected carbonyl- or protected dicarbonyl-group (which has reactivity similar to a carbonyl- or dicarbonyl-group upon deprotection). Such amino acids include amino acids having the structure of Formula (I):
Figure imgf000044_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, - N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N- - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N- and -C(R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; J is
Figure imgf000045_0001
R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; each R" is independently H, alkyl, substituted alkyl, or a protecting group, or when more than one R" group is present, two R" optionally form a heterocycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 groups optionally form a cycloalkyl or a heterocycloalkyl; or the -A-B-J-R groups together form a bicyclic or tricyclic cycloalkyl or heterocycloalkyl comprising at least one carbonyl group, including a dicarbonyl group, protected carbonyl group, including a protected dicarbonyl group, or masked carbonyl group, including a masked dicarbonyl group; or the -J-R group together forms a monocyclic or bicyclic cycloalkyl or heterocycloalkyl comprising at least one carbonyl group, including a dicarbonyl group, protected carbonyl group, including a protected dicarbonyl group, or masked carbonyl group, including a masked dicarbonyl group; with a proviso that when A is phenyl ene and each R3 is H, B is present; and that when A is -(CH2)4- and each R3 is H, B is not -NHC(0)(CH2CH2)-; and that when A and B are absent and each R3 is H, R is not methyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00169] In certain embodiments, compounds of Formula (I) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (I) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (I) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
[00170] In certain embodiments of compounds of Formula (I), B is lower alkylene, substituted lower alkylene, -0-(alkylene or substituted alkylene)-, -C(R')=N-N(R')-, - N(R)CO- -C(O)-, -C(R*)=N- -C(0)-(alkylene or substituted alkylene)-, -CON(R*)- (alkylene or substituted alkylene)-, -S(alkylene or substituted alkylene)-, -S(0)(alkylene or substituted alkylene)-, or -S(0)2(alkylene or substituted alkylene)-. In certain embodiments of compounds of Formula (I), B is -0(CH2)-, -CH=N- -CH=N-NH- -NHCH2-, - NHCO-, -C(O)-, -C(0)-(CH2)-, -CONH-(CH2)-, -SCH2- -S(=0)CH2- or -S(0)2CH2-. In certain embodiments of compounds of Formula (I), R is Ci-6 alkyl or cycloalkyl. In certain embodiments of compounds of Formula (I) R is -CH3, -CH(CH3)2, or cyclopropyl. In certain embodiments of compounds of Formula (I), Ri is H, tert-butyloxycarbonyl (Boc), 9- Fluorenylmethoxycarbonyl (Fmoc), N-acetyl, tetrafluoroacetyl (TFA), or benzyloxycarbonyl (Cbz). In certain embodiments of compounds of Formula (I), Ri is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (I), R2 is OH, O-methyl, O-ethyl, or O-t-butyl. In certain embodiments of compounds of Formula (I), R2 is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (I), R2 is a polynucleotide. In certain embodiments of compounds of Formula (I), R2 is ribonucleic acid (RNA). In certain embodiments of compounds of Formula (I), R2 is tRNA. In certain embodiments of compounds of Formula (I), the tRNA specifically recognizes a selector codon. In certain embodiments of compounds of Formula (I) the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon. In certain embodiments of compounds of Formula (I), R2 is a suppressor tRNA.
[00171] In certain embodiments of compounds of Formula (I),
Figure imgf000046_0001
is selected from the group consisting of: (i) A is substituted lower alkylene, C4-arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-,
-S(O)-, -S(0)2- -NS(0)2- -OS(0)2- -C(O)-, -C(0)-(alkylene or substituted alkylene)-,
-C(S)-, -N(R)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -
N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -N(R*)C(S)-, -S(0)N(R*), -
S(0)2N(R*), -N(R*)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)N(R*)-, -N(R*)S(0)2N(R)-, - N(R)-N=, -C(R')=N-N(R')-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R*)2-N(R)-N(R*)-; (ii) A is optional, and when present is substituted lower alkylene, C4-arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S(0)-, -S(0)2- -NS(0)2- -0S(0)2- - C(0)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -N(R')-, -C(0)N(R)-, - CON(R)-(alkylene or substituted alkylene)-, -CSN(R)-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -N(R)C(S)-, -S(0)N(R*), -S(0)2N(R*), -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)N(R*)-, -N(R*)S(0)2N(R*)-, -N(R*)-N=, -C(R)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N-, and -C(R*)2-N(R*)-N(R*)-; (iii) A is lower alkylene; B is optional, and when present is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, -0-, - 0-(alkylene or substituted alkylene)-, -S-, -S(0)-, -S(0)2- -NS(0)2- -0S(0)2- -C(0)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -N(R)-, -C(0)N(R*)-, -CSN(R)-, - CON(R)-(alkylene or substituted alkylene)-, -N(R)C(0)0- -N(R*)C(S)-, -S(0)N(R*), - S(0)2N(R*), -N(R*)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)N(R*)-, -N(R*)S(0)2N(R)-, - N(R)-N=, -C(R*)=N-N(R)-, -C(R*)=N-N=, -C(R)2-N=N- and -C(R*)2-N(R)-N(R*)-; and (iv) A is phenylene; B is a divalent linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, -0-, - 0-(alkylene or substituted alkylene)-, -S-, -S(0)-, -S(0)2- -NS(0)2- -0S(0)2- -C(0)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -N(R)-, -C(0)N(R*)-, -CON(R)- (alkylene or substituted alkylene)-, -CSN(R')-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -N(R)C(S)-, -S(0)N(R*), -S(0)2N(R*), -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)N(R*)-, -N(R*)S(0)2N(R*)-, -N(R*)-N=, -C(R')TSi-N(R')-, - C(R')=N-N=, -C(R*)2-N=N-, and -C (R')2-N(R')-N(R')-; J is
Figure imgf000048_0001
each R' is independently H, alkyl, or substituted alkyl; Ri is optional, and when present, is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is optional, and when present, is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; and each R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl; and R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
[00172] In addition, amino acids having the structure of Formula (II) are included:
Figure imgf000048_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, - N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N- - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide. In certain embodiments, when A is phenylene, B is present; and that when A is -(CH2)4- B is not -NHC(0)(CH2CH2)-; and that when A and B are absent, R is not methyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00173] In addition, amino acids having the structure of Formula (III) are included:
Figure imgf000049_0001
wherein: B is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1 , 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-
, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -
CSN(R')-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-,
-N(R*)C(0)0- -S(0)kN(R)-, -N(R*)C(0)N(R*)-, -N(R)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, -
N(R)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R*)2-N=N- and -C(R*)2-
N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R')2, -C(0)k R'where k is 1, 2, or 3, -C(0)N(R')2, -OR, and -S(0)kR, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00174] In addition, the following amino acids are included:
Figure imgf000050_0001
Such non-natural amino acids may be are optionally amino protected group, carboxyl protected and/or in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00175] In addition, the following amino acids having the structure of Formula (IV) are included:
Figure imgf000051_0001
wherein -NS(0)2-, -OS(0)2-, optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, - CSN(R)-, -CSN(R')-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0-, -S(0)kN(R)-, -N(R*)C(0)N(R*)-, -N(R)C(S)N(R*)-, - N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R)=N-, -C(R')=N-N(R')-, -C(R*)=N-N=, -C(R)2- N=N- and -C(R')2-N(R')-N(R')- where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R')2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR, and -S(0)kR, where each R* is independently H, alkyl, or substituted alkyl; and n is 0 to 8. In certain embodiments, when A is -(CH2)4-, B is not -NHC(0)(CH2CH2)-. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00176] In addition, the following amino acids are included:
Figure imgf000052_0001
wherein such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00177] In addition, the following amino acids having the structure of Formula (VIII) are included:
Figure imgf000053_0001
wherein, A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, - N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00178] In addition, the following amino acids having the structure of Formula (IX) are included:
Figure imgf000054_0001
wherein, B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N-, and -C (R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or
polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; wherein each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R)2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR*, and -S(0)k R, where each R is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00179] In addition, the following amino acids are included:
Figure imgf000055_0001
wherein such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00180] In addition, the following amino acids having the structure of Formula (X) are included:
Figure imgf000055_0002
wherein, B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C(R*)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or
polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R*)2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR*, and - S(0)kR, where each R' is independently H, alkyl, or substituted alkyl; and n is 0 to 8. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00181] In addition, the following amino acids are included:
Figure imgf000057_0001
Figure imgf000057_0002
wherein such compounds are optionally amino protected, optionally carboxyl protected, optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00182] In addition to monocarbonyl structures, the non-natural amino acids described herein may include groups such as dicarbonyl, dicarbonyl like, masked dicarbonyl and protected dicarbonyl groups. For example, the following amino acids having the structure of Formula (V) are included:
Figure imgf000058_0001
wherein, A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, - N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, -S(0)kN(R*)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N- and -C(R)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00183] In addition, the following amino acids having the structure of Formula (VI) are included:
Figure imgf000059_0001
wherein, B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C(R*)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or
polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; wherein each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R)2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR*, and -S(0)kR, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00184] In addition, the following amino acids are included:
Figure imgf000060_0001
wherein such compounds are optionally amino protected and carboxyl protected, or a salt thereof. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00185] In addition, the following amino acids having the structure of Formula (VII) are included:
Figure imgf000060_0002
wherein, B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N- -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C (R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R*)2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR*, and - S(0)kR, where each R' is independently H, alkyl, or substituted alkyl; and n is 0 to 8. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00186] In addition, the following amino acids are included:
Figure imgf000061_0001
wherein such compounds are optionally amino protected and carboxyl protected, or a salt thereof, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00187] In addition, the following amino acids having the structure of Formula (XXX) are included:
Figure imgf000062_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; Xi is C, S, or S(O); and L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00188] In addition, the following amino acids having the structure of Formula (XXX- A) are included:
Figure imgf000062_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00189] In addition, the following amino acids having the structure of Formula (XXX-B) are included:
Figure imgf000063_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00190] In addition, the following amino acids having the structure of Formula (XXXI) are included:
Figure imgf000064_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; Xi is C,
8 9 8 9
S, or S(O); and n is 0, 1, 2, 3, 4, or 5; and each R and R on each CR R group is
independently selected from the group consisting of H, alkoxy, alkylamine, halogen, alkyl, aryl, or any R 8 and R 9 can together form =0 or a cycloalkyl, or any to adjacent R 8 groups can together form a cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00191] In addition, the following amino acids having the structure of Formula (XXXI- A) are included:
Figure imgf000064_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; n is 0, 1, 8 9 8 9
2, 3, 4, or 5; and each R and R on each CR R group is independently selected from the
8 9
group consisting of H, alkoxy, alkylamine, halogen, alkyl, aryl, or any R and R can together form =0 or a cycloalkyl, or any to adjacent R groups can together form a cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00192] In addition, the following amino acids having the structure of Formula (XXXI-B) are included:
Figure imgf000065_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; n is 0, 1 ,
8 9 8 9
2, 3, 4, or 5; and each R and R on each CR R group is independently selected from the
8 9
group consisting of H, alkoxy, alkylamine, halogen, alkyl, aryl, or any R and R can together
Q
form =0 or a cycloalkyl, or any to adjacent R groups can together form a cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00193] In addition, the following amino acids having the structure of Formula (XXXII) are included:
Figure imgf000065_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; Xi is C, S, or S(O); and L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00194] The In addition, the following amino acids having the structure of Formula (XXXII-A) are included:
Figure imgf000066_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified. [00195] In addition, the following amino acids having the structure of Formula (XXXII-B) are included:
Figure imgf000067_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; L is alkylene, substituted alkylene, N(R')(alkylene) or N(R')(substituted alkylene), where R' is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00196] In addition, amino acids having the structure of Formula (XXXX) are included:
Figure imgf000067_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene;
Figure imgf000068_0001
where (a) indicates bonding to the A group and (b) indicates bonding to respective carbonyl groups, R3 and R4 are independently chosen from H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl, or R3 and R4 or two R3 groups or two R4 groups optionally form a cycloalkyl or a heterocycloalkyl; R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; T3 is a bond, C(R)(R), O, or S, and R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00197] In addition, amino acids having the structure of Formula (XXXXI) are included:
Figure imgf000068_0002
wherein:
Figure imgf000069_0001
where (a) indicates bonding to the A group and (b) indicates bonding to respective carbonyl groups, R3 and R4 are independently chosen from H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl, or R3 and R4 or two R3 groups or two R4 groups optionally form a cycloalkyl or a heterocycloalkyl; R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; T3 is a bond, C(R)(R), O, or S, and R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, -N(R')2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR, and -S(0)kR, where each R* is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00198] In addition, amino acids having the structure of Formula (XXXXII) are included:
Figure imgf000069_0002
wherein: R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; and T3 is O, or S. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00199] In addition, amino acids having the structure of Formula (XXXXIII) are included:
Figure imgf000070_0001
wherein: R is H, halogen, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl.
[00200] In addition, the following amino acids having structures of Formula (XXXXIII) are included:
Figure imgf000070_0002
Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00201] Non-natural amino acids containing a hydroxylamine (also called an aminooxy) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers). Like hydrazines, hydrazides and semicarbazides, the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain carbonyl- or dicarbonyl- groups, including but not limited to, ketones, aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tam, J., J. Am. Chem. Soc. 117:3893-3899 (1995); H. Hang and C. Bertozzi, Acc. Chem. Res. 34(9): 727-736 (2001). Whereas the result of reaction with a hydrazine group is the corresponding hydrazone, however, an oxime results generally from the reaction of an aminooxy group with a carbonyl- or dicarbonyl-containing group such as, by way of example, a ketones, aldehydes or other functional groups with similar chemical reactivity.
[00202] Thus, in certain embodiments described herein are non-natural amino acids with sidechains comprising a hydroxylamine group, a hydroxylamine-like group (which has reactivity similar to a hydroxylamine group and is structurally similar to a hydroxylamine group), a masked hydroxylamine group (which can be readily converted into a
hydroxylamine group), or a protected hydroxylamine group (which has reactivity similar to a hydroxylamine group upon deprotection). Such amino acids include amino acids having the structure of Formula (XIV):
Figure imgf000071_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R*)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2- Ν=Ν-, and -C(R')2-N(R')-N(R')- where each R' is independently H, alkyl, or substituted alkyl; K is -NR6R7 or -N=CR6R7; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 groups optionally form a cycloalkyl or a heterocycloalkyl; each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0)2R", -
C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R6 or R7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -
S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -
C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R)-(alkylene or substituted alkylene)-, -CSN(R')-, -
CSN(R')-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-, -
N(R*)C(0)0- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, - N(R)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R*)2-N=N-, and -C(R*)2- N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00203] In certain embodiments of compounds of Formula (XIV), A is phenylene or substituted phenylene. In certain embodiments of compounds of Formula (XIV), B is - (alkylene or substituted alkylene)-, -0-(alkylene or substituted alkylene)-, -S-(alkylene or substituted alkylene)-, or -C(0)-(alkylene or substituted alkylene)-. In certain embodiments of compounds of Formula (XIV), B is -0(CH2)2-, -S(CH2)2- -NH(CH2)2- -CO(CH2)2- or -(CH2)n- where n is 1 to 4. In certain embodiments of compounds of Formula (XIV), Ri is H, tert-butyloxycarbonyl (Boc), 9-Fluorenylmethoxycarbonyl (Fmoc), N-acetyl,
tetrafluoroacetyl (TFA), or benzyloxycarbonyl (Cbz). In certain embodiments of compounds of Formula (XIV), Ri is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (XIV), wherein R2 is OH, O-methyl, O-ethyl, or O-t- butyl. In certain embodiments of compounds of Formula (XIV), R2 is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (XIV), R2 is a polynucleotide. In certain embodiments of compounds of Formula (XIV), R2 is ribonucleic acid (RNA). In certain embodiments of compounds of Formula (XIV), R2 is tRNA. In certain embodiments of compounds of Formula (XIV), the tRNA specifically recognizes a codon selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon. In certain embodiments of compounds of Formula (XIV), R2 is a suppressor tRNA. In certain embodiments of compounds of Formula (XIV), each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl. In certain embodiments of compounds of Formula (XIV), each of R6 and R7 is independently selected from the group consisting of H, methyl, phenyl, and -[(alkylene or substituted alkylene)-0- (hydrogen, alkyl, or substituted alkyl)]x, wherein x is from 1-50. In certain embodiments of compounds of Formula (XIV), K is -NR6R7.
[00204] In certain embodiments of compounds of Formula (XIV), X is a biologically active agent selected from the group consisting of a peptide, protein, enzyme, antibody, drug, dye, lipid, nucleosides, oligonucleotide, cell, virus, liposome, microparticle, and micelle. In certain embodiments of compounds of Formula (XIV), X is a drug selected from the group consisting of an antibiotic, fungicide, anti-viral agent, anti-inflammatory agent, anti-tumor agent, cardiovascular agent, anti-anxiety agent, hormone, growth factor, and steroidal agent. In certain embodiments of compounds of Formula (XIV), X is an enzyme selected from the group consisting of horseradish peroxidase, alkaline phosphatase, β-galactosidase, and glucose oxidase. In certain embodiments of compounds of Formula (XIV), X is a detectable label selected from the group consisting of a fluorescent, phosphorescent, chemiluminescent, chelating, electron dense, magnetic, intercalating, radioactive, chromophoric, and energy transfer moiety.
[00205] In certain embodiments, compounds of Formula (XIV) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (XIV) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (XIV) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
[00206] Such amino acids include amino acids having the structure of Formula (XV):
Figure imgf000074_0001
wherein A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R*)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2- N=N- and -C(R')2-N(R')-N(R')- where each R' is independently H, alkyl, or substituted alkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 groups optionally form a cycloalkyl or a heterocycloalkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00207] A non- limiting, representative amino acid has the following structure:
Figure imgf000075_0001
Such a non-natural amino acid may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00208] Non-natural amino acids containing an oxime group allow for reaction with a variety of reagents that contain certain reactive carbonyl- or dicarbonyl-groups (including but not limited to, ketones, aldehydes, or other groups with similar reactivity) to form new non- natural amino acids comprising a new oxime group. Such an oxime exchange reaction allow for the further functionalization of non-natural amino acid polypeptides. Further, the original non-natural amino acids containing an oxime group may be useful in their own right as long as the oxime linkage is stable under conditions necessary to incorporate the amino acid into a polypeptide (e.g., the in vivo, in vitro and chemical synthetic methods described herein).
[00209] Thus, in certain embodiments described herein are non-natural amino acids with sidechains comprising an oxime group, an oxime-like group (which has reactivity similar to an oxime group and is structurally similar to an oxime group), a masked oxime group (which can be readily converted into an oxime group), or a protected oxime group (which has reactivity similar to an oxime group upon deprotection). Such amino acids include amino acids having the structure of Formula (XI):
Figure imgf000076_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R*)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, -N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2- N=N- and -C(R')2-N(R')-N(R')- where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 optionally form a cycloalkyl or a heterocycloalkyl; R5 is H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, substituted aralkyl, -(alkylene or substituted alkylene)-ON(R")2, -(alkylene or substituted alkylene)- C(0)SR", -(alkylene or substituted alkylene)-S-S-(aryl or substituted aryl), -C(0)R", - C(0)2R", or -C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R5 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, - 0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')-, -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R*)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, -(alkylene or substituted alkylene)-0-N=CR- - (alkylene or substituted alkylene)-C(0)NR'-(alkylene or substituted alkylene)-, -(alkylene or substituted alkylene)-S(0)k-(alkylene or substituted alkylene)-S-, -(alkylene or substituted alkylene)-S-S- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, -N(R*)C(S)N(R*)-, - N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R)=N-, -C(R')=N-N(R')-, -C(R*)=N-N=, -C(R)2- N=N- and -C(R')2-N(R')-N(R')- where each R' is independently H, alkyl, or substituted alkyl; with a proviso that when A and B are absent, R is not methyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00210] In certain embodiments of compounds of Formula (XI), B is -0-(alkylene or substituted alkylene)-. In certain embodiments of compounds of Formula (XI), B is - 0(CH2)-. In certain embodiments of compounds of Formula (XI), R is Ci_4 alkyl. In certain embodiments of compounds of Formula (XI), R is -CH3. In certain embodiments of compounds of Formula (XI), Ri is H, tert-butyloxycarbonyl (Boc), 9- fluorenylmethoxycarbonyl (Fmoc), N-acetyl, tetrafluoroacetyl (TFA), or benzyloxycarbonyl (Cbz). In certain embodiments of compounds of Formula (XI), Ri is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (XI), R2 is OH, O-methyl, O-ethyl, or O-t-butyl. In certain embodiments of compounds of Formula (XI), R2 is a resin, amino acid, polypeptide, or polynucleotide. In certain embodiments of compounds of Formula (XI), R2 is a polynucleotide. In certain embodiments of compounds of Formula (XI), R2 is ribonucleic acid (RNA). In certain embodiments of compounds of Formula (XI), R2 is tRNA. In certain embodiments of compounds of Formula (XI), the tRNA specifically recognizes a selector codon. In certain embodiments of compounds of Formula
(XI) , the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, an unnatural codon, a five-base codon, and a four-base codon. In certain embodiments of compounds of Formula (XI), R2 is a suppressor tRNA. In certain embodiments of compounds of Formula (XI), R5 is alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, or -C(0)2R". In certain embodiments of compounds of Formula (XI), R5 is -[(alkylene or substituted alkyl ene)-0- (hydrogen, alkyl, or substituted alkyl)]x, wherein x is from 1-50. In certain embodiments of compounds of Formula (XI), R5 is -(CH2CH2)-0-CH3 or -COOH.
[00211] In certain embodiments, compounds of Formula (XI) are stable in aqueous solution for at least 1 month under mildly acidic conditions. In certain embodiments, compounds of Formula (XI) are stable for at least 2 weeks under mildly acidic conditions. In certain embodiments, compound of Formula (XI) are stable for at least 5 days under mildly acidic conditions. In certain embodiments, such acidic conditions are pH 2 to 8.
[00212] Amino acids of Formula (XI) include amino acids having the structure of Formula
(XII) :
Figure imgf000078_0001
wherein, B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C(R*)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl; R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or
polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; R5 is H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, substituted aralkyl, -(alkylene or substituted alkylene)-ON(R")2, -(alkylene or substituted alkylene)-C(0)SR", -(alkylene or substituted alkylene)-S-S-(aryl or substituted aryl), -C(0)R", -C(0)2R", or -C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R5 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal- containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, - S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)- (alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, - C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0-, - (alkylene or substituted alkylene)-0-N=CR'-, -(alkylene or substituted alkylene)-C(0)NR- (alkylene or substituted alkylene)-, -(alkylene or substituted alkylene)-S(0)k-(alkylene or substituted alkylene)-S-, -(alkylene or substituted alkylene)-S-S-, -S(0)kN(R')-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N- - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N- and -C(R)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00213] Such amino acids include amino acids having the structure of Formula (XIII):
Figure imgf000080_0001
wherein, R is H, alkyl, substituted alkyl, cycloalkyl, or substituted cycloalkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; R5 is H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkylalkoxy, substituted alkylalkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, substituted aralkyl, -(alkylene or substituted alkylene)-ON(R")2, -(alkylene or substituted alkylene)-C(0)SR", -(alkylene or substituted alkylene)-S-S-(aryl or substituted aryl), -C(0)R", -C(0)2R", or -C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R5 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkyl ene, substituted alkylene, alkenyl ene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R')-, - CON(R)-(alkylene or substituted alkylene)-, -CSN(R)-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R')C(0)0-, -(alkylene or substituted alkylene)-0-N=CR'-, -(alkylene or substituted alkylene)-C(0)NR'-(alkylene or substituted alkylene)-, -(alkylene or substituted alkylene)-S(0)k-(alkylene or substituted alkylene)-S- -(alkylene or substituted alkylene)-S-S- -S(0)kN(R*)-, -N(R)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N- -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C (R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified. [00214] Further non-limiting examples of such amino acids include amino acids having the following structures:
Figure imgf000082_0001
Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00215] In addition, such amino acids include amino acids having the structure of Formula (XIV):
Figure imgf000082_0002
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, -
N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -
N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, -
C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl; K is -NR6R7 or -N=CReR7; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 groups optionally form a cycloalkyl or a heterocycloalkyl; each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0)2R", -C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or
R6 or R7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenyl ene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R')-, - CON(R')-(alkylene or substituted alkylene)-, -CSN(R)-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00216] Such amino acids further include amino acids having the structure of Formula (XVI):
Figure imgf000084_0001
wherein: A is optional, and when present is lower alkylene, substituted lower alkylene, lower cycloalkylene, substituted lower cycloalkylene, lower alkenylene, substituted lower alkenylene, alkynylene, lower heteroalkylene, substituted heteroalkylene, lower
heterocycloalkylene, substituted lower heterocycloalkylene, arylene, substituted arylene, heteroarylene, substituted heteroarylene, alkarylene, substituted alkarylene, aralkylene, or substituted aralkylene; B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(O)- (alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, - N(R')-, -NR*-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R)-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R')-(alkylene or substituted alkylene)-, - N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, - N(R*)C(0)N(R)-, -N(R*)C(S)N(R)-, -N(R*)S(0)kN(R*)-, -N(R*)-N=, -C(R*)=N-, - C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R)2-N=N-, and -C(R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R3 and R4 is independently H, halogen, lower alkyl, or substituted lower alkyl, or R3 and R4 or two R3 optionally form a cycloalkyl or a heterocycloalkyl; each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0)2R", -C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R6 or R7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, - 0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N- -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N- and -C(R*)2-N(R*)-N(R*)-, where each R' is independently H, alkyl, or substituted alkyl. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00217] Further, such amino acids include amino acids having the structure of Formula (XVII):
Figure imgf000086_0001
wherein: B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R)- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, - N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N-, -C(R*)=N-N(R)-, - C(R')=N-N=, -C(R*)2-N=N-, and -C (R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0)2R", - C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R6 or R7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, - CSN(R')-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R)-, -N(R*)C(0)N(R*)-, -N(R)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, - N(R)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R*)2-N=N- and -C(R*)2- N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl.
[00218] Non-limiting examples of such amino acids include amino acids having the following structures:
Figure imgf000088_0001
Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00219] Additionally, such amino acids include amino acids having the structure of Formula (XVIII):
Figure imgf000088_0002
wherein: B is optional, and when present is a linker selected from the group consisting of lower alkylene, substituted lower alkylene, lower alkenylene, substituted lower alkenylene, lower heteroalkylene, substituted lower heteroalkylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, - S(0)k(alkylene or substituted alkylene)-, -C(O)-, -NS(0)2- -OS(0)2- -C(0)-(alkylene or substituted alkylene)-, -C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'- (alkylene or substituted alkylene)-, -C(0)N(R')- -CON(R')-(alkylene or substituted alkylene)-, -CSN(R')-, -CSN(R*)-(alkylene or substituted alkylene)-, -N(R*)CO-(alkylene or substituted alkylene)-, -N(R)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, -
N(R*)C(S)N(R*)-, -N(R*)S(0)kN(R)-, -N(R*)-N=, -C(R*)=N- -C(R*)=N-N(R)-, -
C(R')=N-N=, -C(R*)2-N=N-, and -C (R')2-N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; Ri is H, an amino protecting group, resin, amino acid, polypeptide, or polynucleotide; and R2 is OH, an ester protecting group, resin, amino acid, polypeptide, or polynucleotide; each of R6 and R7 is independently selected from the group consisting of H, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, polyalkylene oxide, substituted polyalkylene oxide, aryl, substituted aryl, heteroaryl, substituted heteroaryl, alkaryl, substituted alkaryl, aralkyl, and substituted aralkyl, -C(0)R", -C(0)2R", -
C(0)N(R")2, wherein each R" is independently hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkoxy, substituted alkoxy, aryl, substituted aryl, heteroaryl, alkaryl, substituted alkaryl, aralkyl, or substituted aralkyl; or R6 or R7 is L-X, where X is a selected from the group consisting of a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a saccharide, a water-soluble dendrimer, a cyclodextrin, a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; and any combination thereof; and L is optional, and when present is a linker selected from the group consisting of alkylene, substituted alkylene, alkenylene, substituted alkenylene, -0-, -0-(alkylene or substituted alkylene)-, -S-, -S-(alkylene or substituted alkylene)-, -S(0)k- where k is 1, 2, or 3, -
S(0)k(alkylene or substituted alkylene)-, -C(O)-, -C(0)-(alkylene or substituted alkylene)-,
-C(S)-, -C(S)-(alkylene or substituted alkylene)-, -N(R')-, -NR'-(alkylene or substituted alkylene)-, -C(0)N(R*)-, -CON(R*)-(alkylene or substituted alkylene)-, -CSN(R')-, -
CSN(R')-(alkylene or substituted alkylene)-, -N(R')CO-(alkylene or substituted alkylene)-, -N(R*)C(0)0- -S(0)kN(R*)-, -N(R*)C(0)N(R*)-, -N(R)C(S)N(R*)-, -N(R*)S(0)kN(R*)-, - N(R)-N=, -C(R*)=N-, -C(R*)=N-N(R*)-, -C(R*)=N-N=, -C(R*)2-N=N-, and -C(R*)2- N(R')-N(R')-, where each R' is independently H, alkyl, or substituted alkyl; and each Ra is independently selected from the group consisting of H, halogen, alkyl, substituted alkyl, - N(R*)2, -C(0)kR where k is 1, 2, or 3, -C(0)N(R*)2, -OR*, and -S(0)kR*; where each R' is independently H, alkyl, or substituted alkyl and n is 0 to 8. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid
polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00220] Non-limiting examples of such amino acids include amino acids having the following structures:
Figure imgf000090_0001
Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non- natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
[00221] In certain embodiments, the non-natural amino acid can be according to formula XIX:
Figure imgf000090_0002
Formula XIX; or a salt thereof, wherein: D is -Ar-W3- or -Wi-Yi-C(0)-Y2-W2-; Ar is
Figure imgf000090_0003
Figure imgf000091_0001
each of Wi, W2, and W3 is independently a single bond or lower alkylene; each Xi is independently -NH-, -0-, or -S-; each Yi is independently a single bond, -NH-, or -0-; each Y2 is independently a single bond, -NH-, -0-, or an N-linked or C-linked
pyrrolidinylene; and one of Z1? Z2, and Z3 is -N- and the others of Z1? Z2, and Z3 are independently -CH-. In certain embodiments, the non-natural amino acid is according to formula XlXa:
Figure imgf000091_0002
Formula XlXa; where D is a defined in the context of formula XIX. In certain embodiments, the non-natural amino acid is according formula XlXb:
Figure imgf000091_0003
NH2
Formula XlXb;
or a salt thereof, wherein W4 is Ci-Cio alkylene. In a further embodiment, W4 is Ci-C5 alkylene. In an embodiment, W4 is C1-C3 alkylene. In an embodiment, W4 is Ci alkylene. In particular embodiments, the non-natural amino acid is selected from the group consisting of:
Figure imgf000091_0004
(1) (2) (3)
Figure imgf000092_0001
Figure imgf000093_0001
and (40);
or a salt thereof. Such non-natural amino acids may be in the form of a salt, or may be incorporated into a non-natural amino acid polypeptide, polymer, polysaccharide, or a polynucleotide and optionally post translationally modified.
Linkers and Payloads
[00222] In certain embodiments, the antibody comprises a non-natural amino acid having a reactive group, as described above. One of skill in the art can use the reactive group to link the antibody to any molecular entity capable of forming a covalent bond to the non-natural amino acid, directly or indirectly via a linker.
[00223] Useful linkers include those described in the section above. In certain
embodiments, the linker is any divalent or multivalent linker known to those of skill in the art. Generally, the linker is capable of forming covalent bonds to the functional moiety R and the alpha carbon of the non-natural amino acid. Useful divalent linkers a bond, alkylene, substituted alkylene, heteroalkylene, substituted heteroalkylene, arylene, substituted arylene, heteroarlyene and substituted heteroarylene. In certain embodiments, the linker is C1-10 alkylene or C1-10 heteroalkylene. [00224] The molecular payload can be any molecular entity that one of skill in the art might desire to conjugate to the antibody. In certain embodiments, the payload is a therapeutic moiety. In such embodiment, the antibody conjugate can be used to target the therapeutic moiety to its molecular target. In certain embodiments, the payload is a labeling moiety. In such embodiments, the antibody conjugate can be used to detect binding of the antibody to its target. In certain embodiments, the payload is a cytotoxic moiety. In such embodiments, the conjugate can be used target the cytotoxic moiety to a diseased cell, for example a cancer cell, to initiate destruction or elimination of the cell. Conjugates comprising other molecular payloads apparent to those of skill in the art are within the scope of the conjugates described herein.
[00225] In certain embodiments, a conjugate can have a payload selected from the group consisting of a label, a dye, a polymer, a water-soluble polymer, polyethylene glycol, a derivative of polyethylene glycol, a photocrosslinker, a cytotoxic compound, a radionuclide, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a peptide, a water-soluble dendrimer, a cyclodextrin, an inhibitory ribonucleic acid, a biomaterial, a nanoparticle, a spin label, a fluorophore, a metal-containing moiety, a radioactive moiety, a novel functional group, a group that covalently or
noncovalently interacts with other molecules, a photocaged moiety, a photoisomerizable moiety, biotin, a derivative of biotin, a biotin analogue, a moiety incorporating a heavy atom, a chemically cleavable group, a photocleavable group, an elongated side chain, a carbon- linked sugar, a redox-active agent, an amino thioacid, a toxic moiety, an isotopically labeled moiety, a biophysical probe, a phosphorescent group, a chemiluminescent group, an electron dense group, a magnetic group, an intercalating group, a chromophore, an energy transfer agent, a biologically active agent, a detectable label, a small molecule, or any combination thereof.
[00226] Useful drug paylods include any cytotoxic, cytostatic or immunomodulatory drug. Useful classes of cytotoxic or immunomodulatory agents include, for example, antitubulin agents, auristatins, DNA minor groove binders, DNA replication inhibitors, alkylating agents (e.g. , platinum complexes such as cis-platin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and carboplatin), anthracyclines, antibiotics, antifolates, antimetabolites, calmodulin inhibitors, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, maytansinoids, nitrosoureas, platinols, pore-forming compounds, purine antimetabolites, puromycins, radiation sensitizers, rapamycins, steroids, taxanes, topoisomerase inhibitors, vinca alkaloids, or the like.
[00227] Individual cytotoxic or immunomodulatory agents include, for example, an androgen, anthramycin (AMC), asparaginase, 5-azacytidine, azathioprine, bleomycin, busulfan, buthionine sulfoximine, calicheamicin, calicheamicin derivatives, camptothecin, carboplatin, carmustine (BSNU), CC-1065, chlorambucil, cisplatin, colchicine,
cyclophosphamide, cytarabine, cytidine arabinoside, cytochalasin B, dacarbazine,
dactinomycin (formerly actinomycin), daunorubicin, decarbazine, DM1 , DM4, docetaxel, doxorubicin, etoposide, an estrogen, 5-fluordeoxyuridine, 5-fluorouracil, gemcitabine, gramicidin D, hydroxyurea, idarubicin, ifosfamide, irinotecan, lomustine (CCNU), maytansine, mechlorethamine, melphalan, 6-mercaptopurine, methotrexate, mithramycin, mitomycin C, mitoxantrone, nitroimidazole, paclitaxel, palytoxin, plicamycin, procarbizine, rhizoxin, streptozotocin, tenoposide, 6-thioguanine, thioTEPA, topotecan, vinblastine, vincristine, vinorelbine, VP- 16 and VM-26.
[00228] In some embodiments, suitable cytotoxic agents include, for example, DNA minor groove binders (e.g., enediynes and lexitropsins, a CBI compound; see also U.S. Pat. No. 6, 130,237), duocarmycins, taxanes (e.g., paclitaxel and docetaxel), puromycins, vinca alkaloids, CC-1065, SN-38, topotecan, morpholino-doxorubicin, rhizoxin, cyanomorpholino- doxorubicin, echinomycin, combretastatin, netropsin, epothilone A and B, estramustine, cryptophycins, cemadotin, maytansinoids, discodermolide, eleutherobin, and mitoxantrone.
[00229] In some embodiments, the payload is an anti-tubulin agent. Examples of anti- tubulin agents include, but are not limited to, taxanes (e.g., Taxol® (paclitaxel), Taxotere® (docetaxel)), T67 (Tularik) and vinca alkyloids (e.g., vincristine, vinblastine, vindesine, and vinorelbine). Other antitubulin agents include, for example, baccatin derivatives, taxane analogs, epothilones (e.g., epothilone A and B), nocodazole, colchicine and colcimid, estramustine, cryptophycins, cemadotin, maytansinoids, combretastatins, discodermolide, and eleutherobin.
[00230] In certain embodiments, the cytotoxic agent is a maytansinoid, another group of anti-tubulin agents. For example, in specific embodiments, the maytansinoid can be maytansine or DM-1 (ImmunoGen, Inc.; see also Chari et al., 1992, Cancer Res. 52: 127-131). [00231] In some embodiments, the payload is an auristatin, such as auristatin E or a derivative thereof. For example, the auristatin E derivative can be an ester formed between auristatin E and a keto acid. For example, auristatin E can be reacted with paraacetyl benzoic acid or benzoylvaleric acid to produce AEB and AEVB, respectively. Other typical auristatin derivatives include AFP, MMAF, and MMAE. The synthesis and structure of auristatin derivatives are described in U.S. Patent Application Publication Nos. 2003-0083263, 2005- 0238649 and 2005-0009751 ; International Patent Publication No. WO 04/010957,
International Patent Publication No. WO 02/088172, and U.S. Pat. Nos. 6,323,315;
6,239,104; 6,034,065; 5,780,588; 5,665,860; 5,663, 149; 5,635,483; 5,599,902; 5,554,725; 5,530,097; 5,521 ,284; 5,504, 191 ; 5,410,024; 5,138,036; 5,076,973; 4,986,988; 4,978,744; 4,879,278; 4,816,444; and 4,486,414.
[00232] In some embodiments, the payload is not a radioisotope. In some embodiments, the payload is not radioactive.
[00233] In some embodiments, the payload is an antimetabolite. The antimetabolite can be, for example, a purine antagonist (e.g., azothioprine or mycophenolate mofetil), a dihydrofolate reductase inhibitor (e.g., methotrexate), acyclovir, ganciclovir, zidovudine, vidarabine, ribavarin, azidothymidine, cytidine arabinoside, amantadine, dideoxyuridine, iododeoxyuridine, poscarnet, or trifluridine.
[00234] In other embodiments, the payload is tacrolimus, cyclosporine, FU506 or rapamycin. In further embodiments, the Drug is aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, anastrozole, arsenic trioxide, bexarotene, bexarotene, calusterone, capecitabine, celecoxib, cladribine, Darbepoetin alfa, Denileukin diftitox, dexrazoxane, dromostanolone propionate, epirubicin, Epoetin alfa, estramustine, exemestane, Filgrastim, floxuridine, fludarabine, fulvestrant, gemcitabine, gemtuzumab ozogamicin (MYLOTARG), goserelin, idarubicin, ifosfamide, imatinib mesylate, Interferon alfa-2a, irinotecan, letrozole, leucovorin, levamisole, meclorethamine or nitrogen mustard, megestrol, mesna, methotrexate, methoxsalen, mitomycin C, mitotane, nandrolone phenpropionate, oprelvekin, oxaliplatin, pamidronate, pegademase, pegaspargase, pegfilgrastim, pentostatin, pipobroman, plicamycin, porfimer sodium, procarbazine, quinacrine, rasburicase, Rituximab, Sargramostim, streptozocin, tamoxifen, temozolomide, teniposide, testolactone, thioguanine, toremifene, Tositumomab, Trastuzumab (HERCEPTIN), tretinoin, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine or zoledronate. [00235] In some embodiments, the payload is an immunomodulatory agent. The immunomodulatory agent can be, for example, ganciclovir, etanercept, tacrolimus, cyclosporine, rapamycin, cyclophosphamide, azathioprine, mycophenolate mofetil or methotrexate. Alternatively, the immunomodulatory agent can be, for example, a
glucocorticoid (e.g., Cortisol or aldosterone) or a glucocorticoid analogue (e.g., prednisone or dexamethasone) .
[00236] In some embodiments, the immunomodulatory agent is an anti-inflammatory agent, such as arylcarboxylic derivatives, pyrazole-containing derivatives, oxicam derivatives and nicotinic acid derivatives. Classes of anti-inflammatory agents include, for example, cyclooxygenase inhibitors, 5 -lipoxygenase inhibitors, and leukotriene receptor antagonists.
[00237] Suitable cyclooxygenase inhibitors include meclofenamic acid, mefenamic acid, carprofen, diclofenac, diflunisal, fenbufen, fenoprofen, indomethacin, ketoprofen,
nabumetone, sulindac, tenoxicam and tolmetin.
[00238] Suitable lipoxygenase inhibitors include redox inhibitors (e.g., catechol butane derivatives, nordihydroguaiaretic acid (NDGA), masoprocol, phenidone, Ianopalen, indazolinones, naphazatrom, benzofuranol, alkylhydroxylamine), and non-redox inhibitors (e.g., hydroxythiazoles, methoxyalkylthiazoles, benzopyrans and derivatives thereof, methoxytetrahydropyran, boswellic acids and acetylated derivatives of boswellic acids, and quinolinemethoxyphenylacetic acids substituted with cycloalkyl radicals), and precursors of redox inhibitors.
[00239] Other suitable lipoxygenase inhibitors include antioxidants (e.g., phenols, propyl gallate, flavonoids and/or naturally occurring substrates containing flavonoids, hydroxylated derivatives of the flavones, flavonol, dihydroquercetin, luteolin, galangin, orobol, derivatives of chalcone, 4,2',4'-trihydroxychalcone, ortho-aminophenols, N-hydroxyureas, benzofuranols, ebselen and species that increase the activity of the reducing selenoenzymes), iron chelating agents (e.g., hydroxamic acids and derivatives thereof, N-hydroxyureas, 2-benzyl-l-naphthol, catechols, hydroxylamines, carnosol trolox C, catechol, naphthol, sulfasalazine, zyleuton, 5- hydroxyanthranilic acid and 4-(omega-arylalkyl)phenylalkanoic acids), imidazole-containing compounds (e.g., ketoconazole and itraconazole), phenothiazines, and benzopyran
derivatives.
[00240] Yet other suitable lipoxygenase inhibitors include inhibitors of eicosanoids (e.g., octadecatetraenoic, eicosatetraenoic, docosapentaenoic, eicosahexaenoic and docosahexaenoic acids and esters thereof, PGE1 (prostaglandin El), PGA2 (prostaglandin A2), viprostol, 15-monohydroxyeicosatetraenoic, 15-monohydroxy-eicosatrienoic and 15- monohydroxyeicosapentaenoic acids, and leukotrienes B5, C5 and D5), compounds interfering with calcium flows, phenothiazines, diphenylbutylamines, verapamil, fuscoside, curcumin, chlorogenic acid, caffeic acid, 5,8,11,14-eicosatetrayenoic acid (ETYA), hydroxyphenylretinamide, Ionapalen, esculin, diethylcarbamazine, phenantroline, baicalein, proxicromil, thioethers, diallyl sulfide and di-(l-propenyl) sulfide.
[00241] Leukotriene receptor antagonists include calcitriol, ontazolast, Bayer Bay-x-1005, Ciba-Geigy CGS-25019C, ebselen, Leo Denmark ETH-615, Lilly LY-293111, Ono ONO- 4057, Terumo TMK-688, Boehringer Ingleheim BI-RM-270, Lilly LY 213024, Lilly LY 264086, Lilly LY 292728, Ono ONO LB457, Pfizer 105696, Perdue Frederick PF 10042, Rhone-Poulenc Rorer RP 66153, SmithKlme Beecham SB-201146, SmithKlme Beecham SB-201993, SmithKlme Beecham SB-209247, Searle SC-53228, Sumitamo SM 15178, American Home Products WAY 121006, Bayer Bay-o-8276, Warner-Lambert CI-987, Warner-Lambert CI-987BPC-15LY 223982, Lilly LY 233569, Lilly LY-255283, MacroNex MNX-160, Merck and Co. MK-591, Merck and Co. MK-886, Ono ONO-LB-448, Purdue Frederick PF-5901, Rhone-Poulenc Rorer RG14893, Rhone-Poulenc Rorer RP 66364, Rhone-Poulenc Rorer RP 69698, Shionoogi S-2474, Searle SC-41930, Searle SC-50505, Searle SC-51146, Searle SC-52798, SmithKlme Beecham SK&F-104493, Leo Denmark SR- 2566, Tanabe T-757 and Teijin TEI-1338.
[00242] Other useful drug payloads include chemical compounds useful in the treatment of cancer. Examples of chemotherapeutic agents include Erlotinib (TARCEVA®,
Genentech/OSI Pharm.), Bortezomib (VELCADE®, Millennium Pharm.), Fulvestrant (FASLODEX®, AstraZeneca), Sutent (SU11248, Pfizer), Letrozole (FEMARA®, Novartis), Imatinib mesylate (GLEEVEC®, Novartis), PTK787/ZK 222584 (Novartis), Oxaliplatin (Eloxatin®, Sanofi), 5-FU (5-fluorouracil), Leucovorin, Rapamycin (Sirolimus,
RAPAMUNE®, Wyeth), Lapatinib (TYKERB®, GSK572016, Glaxo Smith Kline),
Lonafarnib (SCH 66336), Sorafenib (BAY43-9006, Bayer Labs), and Gefitinib (IRESSA®, AstraZeneca), AG1478, AG1571 (SU 5271; Sugen), alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa;
ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analog topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogs, KW-2189 and CB1-TM1);
eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlomaphazine, chlorophosphamide, estramustine, ifosfamide,
mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and
calicheamicin omegall (Angew Chem. Intl. Ed. Engl. (1994) 33 : 183-186); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6- diazo-5-oxo-L-norleucine, ADRIAMYCIN® (doxorubicin), morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin,
methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamniprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside;
aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and
ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin;
sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan;
vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL® (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111.), and TAXOTERE® (doxetaxel; Rhone-Poulenc Rorer, Antony, France); chloranmbucil; GEMZAR® (gemcitabine); 6-thioguanine; mercaptopurine;
methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; NAVELBINE® (vinorelbine); novantrone;
teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA®); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
[00243] Other useful payloads include: (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®;
tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LYl 17018, onapristone, and FARESTON® (toremifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® (megestrol acetate), AROMASIN® (exemestane; Pfizer), formestanie, fadrozole, RIVISOR® (vorozole), FEMARA® (letrozole; Novartis), and ARIMIDEX® (anastrozole; AstraZeneca); (iii) anti- androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors; (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, Ralf and H-Ras; (vii) ribozymes such as VEGF expression inhibitors {e.g., ANGIOZYME®) and HER2 expression inhibitors; (viii) vaccines such as gene therapy vaccines, for example, ALLOVECTIN®, LEUVECTIN®, and VAXID®; PROLEUKIN® rIL-2; a topoisomerase 1 inhibitor such as LURTOTECAN®; ABARELIX® rmRH; (ix) anti-angiogenic agents such as bevacizumab (AVASTIN®, Genentech); and (x) pharmaceutically acceptable salts, acids and derivatives of any of the above. Other anti- angiogenic agents include MMP-2 (matrix -metalloproteinase 2) inhibitors, MMP-9 (matrix - metalloproteinase 9) inhibitors, COX-II (cyclooxygenase II) inhibitors, and VEGF receptor tyrosine kinase inhibitors. Examples of such useful matrix metalloproteinase inhibitors that can be used in combination with the present compounds/compositions are described in WO 96/33172, WO 96/27583, EP 818442, EP 1004578, WO 98/07697, WO 98/03516, WO 98/34918, WO 98/34915, WO 98/33768, WO 98/30566, EP 606,046, EP 931,788, WO 90/05719, WO 99/52910, WO 99/52889, WO 99/29667, WO 99/07675, EP 945864, U.S. Pat. No. 5,863,949, U.S. Pat. No. 5,861,510, and EP 780,386, all of which are incorporated herein in their entireties by reference. Examples of VEGF receptor tyrosine kinase inhibitors include 4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(l-methylpiperidin-4-ylmethoxy)qu- -inazoline (ZD6474; Example 2 within WO 01/32651), 4-(4-fluoro-2-methylindol-5-yloxy)-6-methoxy- 7-(3-pyrrolidin-l-ylpropoxy)- -quinazoline (AZD2171; Example 240 within WO 00/47212), vatalanib (PTK787; WO 98/35985) and SU11248 (sunitinib; WO 01/60814), and compounds such as those disclosed in PCT Publication Nos. WO 97/22596, WO 97/30035, WO
97/32856, and WO 98/13354).
[00244] In certain embodiments, the payload is an antibody or an antibody fragment. In certain embodiments, the payload antibody or fragment can be encoded by any of the immunoglobulin genes recognized by those of skill in the art. The immunoglobulin genes include, but are not limited to, the κ, λ, α, γ (IgGl, IgG2, IgG3, and IgG4), δ, ε and μ constant region genes, as well as the immunoglobulin variable region genes. The term includes full- length antibodies and antibody fragments recognized by those of skill in the art, and variants thereof. Exemplary fragments include but are not limited to Fv, Fc, Fab, and (Fab')2, single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1, CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like.
[00245] In certain embodiments, the payload is one or more water-soluble polymers. A wide variety of macromolecular polymers and other molecules can be linked to antigen- binding polypeptides of the present invention to modulate biological properties of the antibody, and/or provide new biological properties to the antibody. These macromolecular polymers can be linked to the antibody via a naturally encoded amino acid, via a non- naturally encoded amino acid, or any functional substituent of a natural or non-natural amino acid, or any substituent or functional group added to a natural or non-natural amino acid. The molecular weight of the polymer may be of a wide range, including but not limited to, between about 100 Da and about 100,000 Da or more. [00246] The polymer selected may be water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological
environment. The polymer may be branched or unbranched. Preferably, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable.
[00247] The proportion of polyethylene glycol molecules to antibody molecules will vary, as will their concentrations in the reaction mixture. In general, the optimum ratio (in terms of efficiency of reaction in that there is minimal excess unreacted protein or polymer) may be determined by the molecular weight of the polyethylene glycol selected and on the number of available reactive groups available. As relates to molecular weight, typically the higher the molecular weight of the polymer, the fewer number of polymer molecules which may be attached to the protein. Similarly, branching of the polymer should be taken into account when optimizing these parameters. Generally, the higher the molecular weight (or the more branches) the higher the polymer :protein ratio.
[00248] The water soluble polymer may be any structural form including but not limited to linear, forked or branched. Typically, the water soluble polymer is a poly(alkylene glycol), such as poly(ethylene glycol) (PEG), but other water soluble polymers can also be employed. By way of example, PEG is used to describe certain embodiments of this invention.
[00249] PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term "PEG" is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented as linked to the antibody by the formula: XO-(CH2CH20) =n-CH2CH2-Y where n is 2 to 10,000 and X is H or a terminal modification, including but not limited to, a Ci_4 alkyl.
[00250] In some cases, a PEG used in the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CI¾ ("methoxy PEG"). Alternatively, the PEG can terminate with a reactive group, thereby forming a bifunctional polymer. Typical reactive groups can include those reactive groups that are commonly used to react with the functional groups found in the 20 common amino acids (including but not limited to, maleimide groups, activated carbonates (including but not limited to, p-nitrophenyl ester), activated esters (including but not limited to, N-hydroxysuccinimide, p-nitrophenyl ester) and aldehydes) as well as functional groups that are inert to the 20 common amino acids but that react specifically with complementary functional groups present in non-naturally encoded amino acids (including but not limited to, azide groups, alkyne groups). It is noted that the other end of the PEG, which is shown in the above formula by Y, will attach either directly or indirectly to an antigen-binding polypeptide via a naturally-occurring or non-naturally encoded amino acid. For instance, Y may be an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the polypeptide.
Alternatively, Y may be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine). Alternatively, Y may be a linkage to a residue not commonly accessible via the 20 common amino acids. For example, an azide group on the PEG can be reacted with an alkyne group on the antibody to form a Huisgen [3+2] cycloaddition product. Alternatively, an alkyne group on the PEG can be reacted with an azide group present in a non-naturally encoded amino acid to form a similar product. In some embodiments, a strong nucleophile (including but not limited to, hydrazine, hydrazide, hydroxylamine,
semicarbazide) can be reacted with an aldehyde or ketone group present in a non-naturally encoded amino acid to form a hydrazone, oxime or semicarbazone, as applicable, which in some cases can be further reduced by treatment with an appropriate reducing agent.
Alternatively, the strong nucleophile can be incorporated into the antibody via a non- naturally encoded amino acid and used to react preferentially with a ketone or aldehyde group present in the water soluble polymer.
[00251] Any molecular mass for a PEG can be used as practically desired, including but not limited to, from about 100 Daltons (Da) to 100,000 Da or more as desired (including but not limited to, sometimes 0.1-50 kDa or 10-40 kDa). Branched chain PEGs, including but not limited to, PEG molecules with each chain having a MW ranging from 1-100 kDa (including but not limited to, 1-50 kDa or 5-20 kDa) can also be used. A wide range of PEG molecules are described in, including but not limited to, the Shearwater Polymers, Inc. catalog, Nektar Therapeutics catalog, incorporated herein by reference.
[00252] Generally, at least one terminus of the PEG molecule is available for reaction with the non-naturally-encoded amino acid. For example, PEG derivatives bearing alkyne and azide moieties for reaction with amino acid side chains can be used to attach PEG to non- naturally encoded amino acids as described herein. If the non-naturally encoded amino acid comprises an azide, then the PEG will typically contain either an alkyne moiety to effect formation of the [3+2] cycloaddition product or an activated PEG species (i.e., ester, carbonate) containing a phosphine group to effect formation of the amide linkage. Alternatively, if the non-naturally encoded amino acid comprises an alkyne, then the PEG will typically contain an azide moiety to effect formation of the [3+2] Huisgen cycloaddition product. If the non-naturally encoded amino acid comprises a carbonyl group, the PEG will typically comprise a potent nucleophile (including but not limited to, a hydrazide, hydrazine, hydroxylamine, or semicarbazide functionality) in order to effect formation of corresponding hydrazone, oxime, and semicarbazone linkages, respectively. In other alternatives, a reverse of the orientation of the reactive groups described above can be used, i.e., an azide moiety in the non-naturally encoded amino acid can be reacted with a PEG derivative containing an alkyne.
[00253] In some embodiments, the antibody variant with a PEG derivative contains a chemical functionality that is reactive with the chemical functionality present on the side chain of the non-naturally encoded amino acid.
[00254] In certain embodiments, the payload is an azide- or acetylene-containing polymer comprising a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da. The polymer backbone of the water-soluble polymer can be poly(ethylene glycol). However, it should be understood that a wide variety of water soluble polymers including but not limited to poly(ethylene)glycol and other related polymers, including poly(dextran) and poly(propylene glycol), are also suitable for use in the practice of this invention and that the use of the term PEG or poly(ethylene glycol) is intended to encompass and include all such molecules. The term PEG includes, but is not limited to, poly(ethylene glycol) in any of its forms, including bifunctional PEG, multiarmed PEG, derivatized PEG, forked PEG, branched PEG, pendent PEG (i.e. PEG or related polymers having one or more functional groups pendent to the polymer backbone), or PEG with degradable linkages therein.
[00255] The polymer backbone can be linear or branched. Branched polymer backbones are generally known in the art. Typically, a branched polymer has a central branch core moiety and a plurality of linear polymer chains linked to the central branch core. PEG is commonly used in branched forms that can be prepared by addition of ethylene oxide to various polyols, such as glycerol, glycerol oligomers, pentaerythritol and sorbitol. The central branch moiety can also be derived from several amino acids, such as lysine. The branched poly(ethylene glycol) can be represented in general form as R(-PEG-OH)m in which R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol, and m represents the number of arms. Multi-armed PEG molecules, such as those described in U.S. Pat. Nos. 5,932,462 5,643,575; 5,229,490; 4,289,872; U.S. Pat. Appl. 2003/0143596; WO 96/21469; and WO 93/21259, each of which is incorporated by reference herein in its entirety, can also be used as the polymer backbone.
[00256] Branched PEG can also be in the form of a forked PEG represented by PEG(- YCHZ2)n, where Y is a linking group and Z is an activated terminal group linked to CH by a chain of atoms of defined length.
[00257] Yet another branched form, the pendant PEG, has reactive groups, such as carboxyl, along the PEG backbone rather than at the end of PEG chains.
[00258] In addition to these forms of PEG, the polymer can also be prepared with weak or degradable linkages in the backbone. For example, PEG can be prepared with ester linkages in the polymer backbone that are subject to hydrolysis. As shown below, this hydrolysis results in cleavage of the polymer into fragments of lower molecular weight: -PEG-C02- PEG-+H20→PEG-C02H+HO-PEG- It is understood by those skilled in the art that the term poly(ethylene glycol) or PEG represents or includes all the forms known in the art including but not limited to those disclosed herein.
[00259] Many other polymers are also suitable for use in the present invention. In some embodiments, polymer backbones that are water-soluble, with from 2 to about 300 termini, are particularly useful in the invention. Examples of suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) ("PPG"), copolymers thereof (including but not limited to copolymers of ethylene glycol and propylene glycol), terpolymers thereof, mixtures thereof, and the like. Although the molecular weight of each chain of the polymer backbone can vary, it is typically in the range of from about 800 Da to about 100,000 Da, often from about 6,000 Da to about 80,000 Da.
[00260] Those of ordinary skill in the art will recognize that the foregoing list for substantially water soluble backbones is by no means exhaustive and is merely illustrative, and that all polymeric materials having the qualities described above are contemplated as being suitable for use in the present invention.
[00261] In some embodiments of the present invention the polymer derivatives are "multifunctional", meaning that the polymer backbone has at least two termini, and possibly as many as about 300 termini, functionalized or activated with a functional group.
Multifunctional polymer derivatives include, but are not limited to, linear polymers having two termini, each terminus being bonded to a functional group which may be the same or different.
[00262] In one embodiment, the polymer derivative has the structure: X-A-POLY-B - N=N=N wherein: N=N=N is an azide moiety; B is a linking moiety, which may be present or absent; POLY is a water-soluble non-antigenic polymer; A is a linking moiety, which may be present or absent and which may be the same as B or different; and X is a second functional group. Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms. A heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain. The alkyl chain may also be branched at a heteroatom. Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms. The aryl group may be substituted with one more carbon atoms, nitrogen, oxygen or sulfur atoms. Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos. 5,932,462; 5,643,575; and U.S. Pat. Appl. Publication 2003/0143596, each of which is incorporated by reference herein. Those of ordinary skill in the art will recognize that the foregoing list for linking moieties is by no means exhaustive and is merely illustrative, and that all linking moieties having the qualities described above are contemplated to be suitable for use in the present invention.
[00263] Examples of suitable functional groups for use as X include, but are not limited to, hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1-benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1-benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, tresylate, alkene, ketone, and azide. As is understood by those skilled in the art, the selected X moiety should be compatible with the azide group so that reaction with the azide group does not occur. The azide-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an azide moiety, or heterobifunctional, meaning that the second functional group is a different functional group. [00264] The term "protected" refers to the presence of a protecting group or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions. The protecting group will vary depending on the type of chemically reactive group being protected. For example, if the chemically reactive group is an amine or a hydrazide, the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldisulfide. If the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group, the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl. Other protecting groups known in the art may also be used in the present invention.
[00265] Specific examples of terminal functional groups in the literature include, but are not limited to, N-succinimidyl carbonate (see e.g., U.S. Pat. Nos. 5,281,698, 5,468,478), amine (see, e.g., Buckmann et al. Makromol. Chem. 182: 1379 (1981), Zaplipsky et al. Eur. Polym. J. 19: 1177 (1983)), hydrazide (See, e.g., Andresz et al. Makromol. Chem. 179:301 (1978)), succinimidyl propionate and succinimidyl butanoate (see, e.g., Olson et al. in Poly(ethylene glycol) Chemistry & Biological Applications, pp 170-181, Harris & Zaplipsky Eds., ACS, Washington, D.C., 1997; see also U.S. Pat. No. 5,672,662), succinimidyl succinate (See, e.g., Abuchowski et al. Cancer Biochem. Biophys. 7: 175 (1984) and Joppich et al. Macrolol. Chem. 180: 1381 (1979), succinimidyl ester (see, e.g., U.S. Pat. No.
4,670,417), benzotriazole carbonate (see, e.g., U.S. Pat. No. 5,650,234), glycidyl ether (see, e.g., Pitha et al. Eur. J Biochem. 94: 11 (1979), Elling et al, Biotech. Appl. Biochem. 13:354 (1991), oxycarbonylimidazole (see, e.g., Beauchamp, et al, Anal. Biochem. 131 :25 (1983), Tondelli et al. J. Controlled Release 1 :251 (1985)), p-nitrophenyl carbonate (see, e.g., Veronese, et al, Appl. Biochem. Biotech., 11 : 141 (1985); and Sartore et al, Appl. Biochem. Biotech., 27:45 (1991)), aldehyde (see, e.g., Harris et al. J. Polym. Sci. Chem. Ed. 22:341 (1984), U.S. Pat. No. 5,824,784, U.S. Pat. No. 5,252,714), maleimide (see, e.g., Goodson et al. Bio/Technology 8:343 (1990), Romani et al. in Chemistry of Peptides and Proteins 2:29 (1984)), and Kogan, Synthetic Comm. 22:2417 (1992)), orthopyridyl-disulfide (see, e.g., Woghiren, et al. Bioconj. Chem. 4:314(1993)), acrylol (see, e.g., Sawhney et al,
Macromolecules, 26:581 (1993)), vinylsulfone (see, e.g., U.S. Pat. No. 5,900,461). All of the above references and patents are incorporated herein by reference.
[00266] In certain embodiments of the present invention, the polymer derivatives of the invention comprise a polymer backbone having the structure: X-CH2CH20-(CH2CH20)n- CH2CH2-N=N=N wherein: X is a functional group as described above; and n is about 20 to about 4000. In another embodiment, the polymer derivatives of the invention comprise a polymer backbone having the structure: X-CH2CH20-(CH2CH20)n-CH2CH2-0-(CH- 2)m- W-N=N=N wherein: W is an aliphatic or aromatic linker moiety comprising between 1-10 carbon atoms; n is about 20 to about 4000; X is a functional group as described above; and m is between 1 and 10.
[00267] The azide-containing PEG derivatives of the invention can be prepared by a variety of methods known in the art and/or disclosed herein. In one method, shown below, a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, the polymer backbone having a first terminus bonded to a first functional group and a second terminus bonded to a suitable leaving group, is reacted with an azide anion (which may be paired with any of a number of suitable counter-ions, including sodium, potassium, tert-butylammonium and so forth). The leaving group undergoes a nucleophilic displacement and is replaced by the azide moiety, affording the desired azide-containing PEG polymer as shown in the following: X-PEG-L+N3~→X-PEG-N3.
[00268] As shown, a suitable polymer backbone for use in the present invention has the formula X-PEG-L, wherein PEG is poly(ethylene glycol) and X is a functional group which does not react with azide groups and L is a suitable leaving group. Examples of suitable functional groups include, but are not limited to, hydroxyl, protected hydroxyl, acetal, alkenyl, amine, aminooxy, protected amine, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, maleimide, dithiopyridine, and vinylpyridine, and ketone. Examples of suitable leaving groups include, but are not limited to, chloride, bromide, iodide, mesylate, tresylate, and tosylate.
[00269] In another method for preparation of the azide-containing polymer derivatives of the present invention, a linking agent bearing an azide functionality is contacted with a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, wherein the linking agent bears a chemical functionality that will react selectively with a chemical functionality on the PEG polymer, to form an azide-containing polymer derivative product wherein the azide is separated from the polymer backbone by a linking group.
[00270] An exemplary reaction scheme is shown below: X-PEG-M+N-linker- N=N=N→PG-X-PEG-linker-N=N=N wherein: PEG is polyethylene glycol) and X is a capping group such as alkoxy or a functional group as described above; and M is a functional group that is not reactive with the azide functionality but that will react efficiently and selectively with the N functional group.
[00271] Examples of suitable functional groups include, but are not limited to, M being a carboxylic acid, carbonate or active ester if N is an amine; M being a ketone if N is a hydrazide or aminooxy moiety; M being a leaving group if N is a nucleophile.
[00272] Purification of the crude product may be accomplished by known methods including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
[00273] A more specific example is shown below in the case of PEG diamine, in which one of the amines is protected by a protecting group moiety such as tert-butyl-Boc and the resulting mono-protected PEG diamine is reacted with a linking moiety that bears the azide functionality: BocHN-PEG-NH2+H02C-(CH2)3-N=N=N.
[00274] In this instance, the amine group can be coupled to the carboxylic acid group using a variety of activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole to create an amide bond between the monoamine PEG derivative and the azide-bearing linker moiety. After successful formation of the amide bond, the resulting N-tert-butyl-Boc-protected azide-containing derivative can be used directly to modify bioactive molecules or it can be further elaborated to install other useful functional groups. For instance, the N-t-Boc group can be hydrolyzed by treatment with strong acid to generate an omega-amino-PEG-azide. The resulting amine can be used as a synthetic handle to install other useful functionality such as maleimide groups, activated disulfides, activated esters and so forth for the creation of valuable heterobifunctional reagents.
[00275] Heterobifunctional derivatives are particularly useful when it is desired to attach different molecules to each terminus of the polymer. For example, the omega-N-amino-N- azido PEG would allow the attachment of a molecule having an activated electrophilic group, such as an aldehyde, ketone, activated ester, activated carbonate and so forth, to one terminus of the PEG and a molecule having an acetylene group to the other terminus of the PEG.
[00276] In another embodiment of the invention, the polymer derivative has the structure: X-A-POLY-B-C=C-R wherein: R can be either H or an alkyl, alkene, alkyoxy, or aryl or substituted aryl group; B is a linking moiety, which may be present or absent; POLY is a water-soluble non-antigenic polymer; A is a linking moiety, which may be present or absent and which may be the same as B or different; and X is a second functional group.
[00277] Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms. A heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain. The alkyl chain may also be branched at a heteroatom. Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms. The aryl group may be substituted with one more carbon atoms, nitrogen, oxygen, or sulfur atoms. Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos. 5,932,462 and 5,643,575 and U.S. Pat. Appl. Publication 2003/0143596, each of which is incorporated by reference herein. Those of ordinary skill in the art will recognize that the foregoing list for linking moieties is by no means exhaustive and is intended to be merely illustrative, and that a wide variety of linking moieties having the qualities described above are contemplated to be useful in the present invention.
[00278] Examples of suitable functional groups for use as X include hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1-benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1-benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, ketone, and acetylene. As would be understood, the selected X moiety should be compatible with the acetylene group so that reaction with the acetylene group does not occur. The acetylene-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an acetylene moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
[00279] In another embodiment of the present invention, the polymer derivatives comprise a polymer backbone having the structure: X-CH2CH20-(CH2CH20)n-CH2CH2-0-(CH2)m- C=CH wherein: X is a functional group as described above; n is about 20 to about 4000; and m is between 1 and 10. Specific examples of each of the heterobifunctional PEG polymers are shown below. [00280] The acetylene-containing PEG derivatives of the invention can be prepared using methods known to those skilled in the art and/or disclosed herein. In one method, a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, the polymer backbone having a first terminus bonded to a first functional group and a second terminus bonded to a suitable nucleophilic group, is reacted with a compound that bears both an acetylene functionality and a leaving group that is suitable for reaction with the nucleophilic group on the PEG. When the PEG polymer bearing the nucleophilic moiety and the molecule bearing the leaving group are combined, the leaving group undergoes a nucleophilic displacement and is replaced by the nucleophilic moiety, affording the desired acetylene-containing polymer: X-PEG-Nu+L-A-C→X-PEG-Nu-A-C=CR' .
[00281] As shown, a preferred polymer backbone for use in the reaction has the formula X-PEG-Nu, wherein PEG is poly(ethylene glycol), Nu is a nucleophilic moiety and X is a functional group that does not react with Nu, L or the acetylene functionality.
[00282] Examples of Nu include, but are not limited to, amine, alkoxy, aryloxy, sulfhydryl, imino, carboxylate, hydrazide, aminoxy groups that would react primarily via a SN2-type mechanism. Additional examples of Nu groups include those functional groups that would react primarily via an nucleophilic addition reaction. Examples of L groups include chloride, bromide, iodide, mesylate, tresylate, and tosylate and other groups expected to undergo nucleophilic displacement as well as ketones, aldehydes, thioesters, olefins, alpha- beta unsaturated carbonyl groups, carbonates and other electrophilic groups expected to undergo addition by nucleophiles.
[00283] In another embodiment of the present invention, A is an aliphatic linker of between 1-10 carbon atoms or a substituted aryl ring of between 6-14 carbon atoms. X is a functional group which does not react with azide groups and L is a suitable leaving group.
[00284] In another method for preparation of the acetylene-containing polymer derivatives of the invention, a PEG polymer having an average molecular weight from about 800 Da to about 100,000 Da, bearing either a protected functional group or a capping agent at one terminus and a suitable leaving group at the other terminus is contacted by an acetylene anion.
[00285] Water soluble polymers can be linked to the antibodies of the invention. The water soluble polymers may be linked via a non-naturally encoded amino acid incorporated in the antibodies or any functional group or substituent of a non-naturally encoded or naturally encoded amino acid, or any functional group or substituent added to a non-naturally encoded or naturally encoded amino acid. Alternatively, the water soluble polymers are linked to an antigen-binding polypeptide incorporating a non-naturally encoded amino acid via a naturally-occurring amino acid (including but not limited to, cysteine, lysine or the amine group of the N-terminal residue). In some cases, the antibodies of the invention comprise 1,
2, 3, 4, 5, 6, 7, 8, 9, 10 non-natural amino acids, wherein one or more non-naturally-encoded amino acid(s) are linked to water soluble polymer(s) (including but not limited to, PEG and/or oligosaccharides). In some cases, the antibodies of the invention further comprise 1, 2,
3, 4, 5, 6, 7, 8, 9, 10, or more naturally-encoded amino acid(s) linked to water soluble polymers. In some cases, the antibody of the invention comprise one or more non-naturally encoded amino acid(s) linked to water soluble polymers and one or more naturally-occurring amino acids linked to water soluble polymers. In some embodiments, the water soluble polymers used in the present invention enhance the serum half-life of the antibodies relative to the unconjugated form.
[00286] The number of water soluble polymers linked to an antigen-binding polypeptide (i.e., the extent of PEGylation or glycosylation) of the present invention can be adjusted to provide an altered (including but not limited to, increased or decreased) pharmacologic, pharmacokinetic or pharmacodynamic characteristic such as in vivo half-life. In some embodiments, the half-life of antibody is increased at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 percent, 2-fold, 5-fold, 10-fold, 50-fold, or at least about 100-fold over an unmodified polypeptide.
[00287] In one embodiment of the present invention, an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety that is linked directly to the PEG backbone.
[00288] In some embodiments, the hydroxylamine-terminal PEG derivative will have the structure: RO-(CH2CH20)n-0-(CH2)m-0-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00289] In some embodiments, the hydrazine- or hydrazide-containing PEG derivative will have the structure: RO-(CH2CH20)n-0-(CH2)m-X-NH-NH2 where R is a simple alkyl
- I l l - (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 and X is optionally a carbonyl group (C=0) that can be present or absent.
[00290] In some embodiments, the semicarbazide-containing PEG derivative will have the structure: RO-(CH2CH20)n-0-(CH2)m-NH-C(0)-NH-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
[00291] In another embodiment of the invention, an antigen-binding polypeptide comprising a carbonyl-containing amino acid is modified with a PEG derivative that contains a terminal hydroxylamine, hydrazide, hydrazine, or semicarbazide moiety that is linked to the PEG backbone by means of an amide linkage.
[00292] In some embodiments, the hydroxylamine-terminal PEG derivatives have the structure: RO-(CH2CH20)„-0-(CH2)2-NH-C(0)(CH2)m-0-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00293] In some embodiments, the hydrazine- or hydrazide-containing PEG derivatives have the structure: RO-(CH2CH20)„-0-(CH2)2-NH-C(0)(CH2)m-X-NH-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, n is 100-1,000 and X is optionally a carbonyl group (C=0) that can be present or absent.
[00294] In some embodiments, the semicarbazide-containing PEG derivatives have the structure: RO-(CH2CH20)„-0-(CH2)2-NH-C(0)(CH2)m-NH-C(0)-NH-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
[00295] In another embodiment of the invention, an antibody comprising a carbonyl- containing amino acid is modified with a branched PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
[00296] In another embodiment of the invention, an antibody comprising a non-naturally encoded amino acid is modified with a PEG derivative having a branched structure. For instance, in some embodiments, the hydrazine- or hydrazide-terminal PEG derivative will have the following structure: [RO-(CH2CH20)„-0-(CH2)2-NH-C(0)]2CH(CH- 2)m-X-NH- NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000, and X is optionally a carbonyl group (C=0) that can be present or absent. [00297] In some embodiments, the PEG derivatives containing a semicarbazide group will have the structure: [RO-(CH2CH20)n-0-(CH2)2-C(0)-NH-CH2- CH2]2CH-X-(CH2)m- NH-C(0)-NH-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1,000.
[00298] In some embodiments, the PEG derivatives containing a hydroxylamine group will have the structure: [RO-(CH2CH20)n-0-(CH2)2-C(0)-NH-CH2- CH2]2CH-X- (CH2)m-0-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1,000.
[00299] The degree and sites at which the water soluble polymer(s) are linked to the antibodies can modulate the binding of the antibodies to an antigen or receptor.
[00300] Methods and chemistry for activation of polymers as well as for conjugation of peptides are described in the literature and are known in the art. Commonly used methods for activation of polymers include, but are not limited to, activation of functional groups with cyanogen bromide, periodate, glutaraldehyde, biepoxides, epichlorohydrin, divinylsulfone, carbodiimide, sulfonyl halides, trichlorotriazine, etc. (see, R. F. Taylor, (1991), PROTEIN IMMOBILISATION. FUNDAMENTAL AND APPLICATIONS, Marcel Dekker, N.Y.; S. S. Wong, (1992), CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING, CRC Press, Boca Raton; G. T. Hermanson et al, (1993), IMMOBILIZED AFFINITY LIGAND TECHNIQUES, Academic Press, N.Y.; Dunn, R. L., et al, Eds. POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991).
[00301] Several reviews and monographs on the functionalization and conjugation of PEG are available. See, for example, Harris, Macronol. Chem. Phys. C25: 325-373 (1985);
Scouten, Methods in Enzymology 135: 30-65 (1987); Wong et al, Enzyme Microb. Technol. 14: 866-874 (1992); Delgado et al, Critical Reviews in Therapeutic Drug Carrier Systems 9: 249-304 (1992); Zalipsky, Bioconjugate Chem. 6: 150-165 (1995).
[00302] Methods for activation of polymers can also be found in WO 94/17039, U.S. Pat. No. 5,324,844, WO 94/18247, WO 94/04193, U.S. Pat. No. 5,219,564, U.S. Pat. No.
5,122,614, WO 90/13540, U.S. Pat. No. 5,281,698, and WO 93/15189, and for conjugation between activated polymers and enzymes including but not limited to Coagulation Factor VIII (WO 94/15625), hemoglobin (WO 94/09027), oxygen carrying molecule (U.S. Pat. No. 4,412,989), ribonuclease and superoxide dismutase (Veronese at al, App. Biochem. Biotech. 11 : 141-45 (1985)). All references and patents cited are incorporated by reference herein.
[00303] PEGylation (i.e., addition of any water soluble polymer) of antigen-binding polypeptides containing a non-naturally encoded amino acid, such as p-azido-L- phenylalanine, is carried out by any convenient method. For example, antibody is PEGylated with an alkyne-terminated mPEG derivative. Briefly, an excess of solid mPEG(5000)-O- CH2-C=CH is added, with stirring, to an aqueous solution of p-azido-L-Phe-containing antibody at room temperature. Typically, the aqueous solution is buffered with a buffer having a pKa near the pH at which the reaction is to be carried out (generally about pH 4-10). Examples of suitable buffers for PEGylation at pH 7.5, for instance, include, but are not limited to, HEPES, phosphate, borate, TRIS-HCl, EPPS, and TES. The pH is continuously monitored and adjusted if necessary. The reaction is typically allowed to continue for between about 1-48 hours.
[00304] The reaction products are subsequently subjected to hydrophobic interaction chromatography to separate the PEGylated antibody variants from free mPEG(5000)-O- CH2-C=CH and any high-molecular weight complexes of the pegylated antibody which may form when unblocked PEG is activated at both ends of the molecule, thereby crosslinking antibody variant molecules. The conditions during hydrophobic interaction chromatography are such that free mPEG(5000)-O-CH2-C=CH flows through the column, while any crosslinked PEGylated antibody variant complexes elute after the desired forms, which contain one antibody variant molecule conjugated to one or more PEG groups. Suitable conditions vary depending on the relative sizes of the cross-linked complexes versus the desired conjugates and are readily determined by those skilled in the art. The eluent containing the desired conjugates is concentrated by ultrafiltration and desalted by diafiltration.
[00305] If necessary, the PEGylated antibodies obtained from the hydrophobic
chromatography can be purified further by one or more procedures known to those skilled in the art including, but are not limited to, affinity chromatography; anion- or cation-exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal- chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility
(including but not limited to ammonium sulfate precipitation), or extraction. Apparent molecular weight may be estimated by GPC by comparison to globular protein standards (PROTEIN PURIFICATION METHODS, A PRACTICAL APPROACH (Harris & Angal, Eds.) IRL Press 1989, 293-306). The purity of the antibody-PEG conjugate can be assessed by proteolytic degradation (including but not limited to, trypsin cleavage) followed by mass spectrometry analysis. Pepinsky B., et al., J. Pharmcol. & Exp. Ther. 297(3): 1059-66 (2001).
[00306] A water soluble polymer linked to an amino acid of an antibody of the invention can be further derivatized or substituted without limitation.
[00307] In another embodiment of the invention, an antigen-binding polypeptide is modified with a PEG derivative that contains an azide moiety that will react with an alkyne moiety present on the side chain of the non-naturally encoded amino acid. In general, the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
[00308] In some embodiments, the azide-terminal PEG derivative will have the structure: RO-(CH2CH20)n-0-(CH2)m-N3 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00309] In another embodiment, the azide-terminal PEG derivative will have the structure: RO-(CH2CH20)n-0-(CH2)m-NH-C(0)-(CH2)p-N3 , where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00310] In another embodiment of the invention, an antibody comprising a alkyne- containing amino acid is modified with a branched PEG derivative that contains a terminal azide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa. For instance, in some embodiments, the azide-terminal PEG derivative will have the following structure: [RO-(CH2CH20)n-0-(CH2)2-NH- C(0)]2CH(CH- 2)m- -(CH2)p-N3 where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10, and n is 100-1,000, and X is optionally an O, N, S or carbonyl group (C=0), in each case that can be present or absent.
[00311] In another embodiment of the invention, an antigen-binding polypeptide is modified with a PEG derivative that contains an alkyne moiety that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid. [00312] In some embodiments, the alkyne-terminal PEG derivative will have the following structure: RO-(CH2CH20)n-0-(CH2)m-C=CH where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00313] In another embodiment of the invention, an antibody comprising an alkyne- containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal azide or terminal alkyne moiety that is linked to the PEG backbone by means of an amide linkage.
[00314] In some embodiments, the alkyne-terminal PEG derivative will have the following structure: RO-(CH2CH20)n-0-(CH2)m-NH-C(0)-(CH2)p-C=CH where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1,000.
[00315] In another embodiment of the invention, an antigen-binding polypeptide comprising an azide-containing amino acid is modified with a branched PEG derivative that contains a terminal alkyne moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa. For instance, in some embodiments, the alkyne-terminal PEG derivative will have the following structure: [RO- (CH2CH20)n-0-(CH2)2-NH-C(0)]2CH(CH- 2)m-X-(CH2)pC=CH where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10, and n is 100-1,000, and X is optionally an O, N, S or carbonyl group (C=0), or not present.
[00316] In another embodiment of the invention, an antibody is modified with a PEG derivative that contains an activated functional group (including but not limited to, ester, carbonate) further comprising an aryl phosphine group that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid. In general, the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
[00317] Other exemplary PEG molecules that may be linked to antibodies, as well as PEGylation methods include those described in, e.g., U.S. Patent Publication Nos.
2004/0001838; 2002/0052009; 2003/0162949; 2004/0013637; 2003/0228274; 2003/0220447; 2003/0158333; 2003/0143596; 2003/0114647; 2003/0105275; 2003/0105224; 2003/0023023; 2002/0156047; 2002/0099133; 2002/0086939; 2002/0082345; 2002/0072573; 2002/0052430; 2002/0040076; 2002/0037949; 2002/0002250; 2001/0056171; 2001/0044526; 2001/0027217; 2001/0021763; U.S. Pat. Nos. 6,646,110; 5,824,778; 5,476,653; 5,219,564; 5,629,384; 5,736,625; 4,902,502; 5,281,698; 5,122,614; 5,473,034; 5,516,673; 5,382,657; 6,552,167; 6,610,281; 6,515,100; 6,461,603; 6,436,386; 6,214,966; 5,990,237; 5,900,461; 5,739,208; 5,672,662; 5,446,090; 5,808,096; 5,612,460; 5,324,844; 5,252,714; 6,420,339; 6,201,072; 6,451,346; 6,306,821; 5,559,213; 5,612,460; 5,747,646; 5,834,594; 5,849,860; 5,980,948; 6,004,573; 6,129,912; WO 97/32607, EP 229,108, EP 402,378, WO 92/16555, WO
94/04193, WO 94/14758, WO 94/17039, WO 94/18247, WO 94/28024, WO 95/00162, WO 95/11924, W095/13090, WO 95/33490, WO 96/00080, WO 97/18832, WO 98/41562, WO 98/48837, WO 99/32134, WO 99/32139, WO 99/32140, WO 96/40791, WO 98/32466, WO 95/06058, EP 439 508, WO 97/03106, WO 96/21469, WO 95/13312, EP 921 131, , WO 98/05363, EP 809 996, WO 96/41813, WO 96/07670, EP 605 963, EP 510 356, EP 400 472, EP 183 503 and EP 154 316, which are incorporated by reference herein. Any of the PEG molecules described herein may be used in any form, including but not limited to, single chain, branched chain, multiarm chain, single functional, bi-functional, multi-functional, or any combination thereof.
[00318] In certain embodiments, the antibodies can be linked to the payloads with one or more linkers capable of reacting with the non-natural amino acid. The one or more linkers can be any linkers apparent to those of skill in the art. The term "linker" is used herein to refer to groups or bonds that normally are formed as the result of a chemical reaction and typically are covalent linkages. Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time, perhaps even indefinitely. Hydrolytically unstable or degradable linkages mean that the linkages are degradable in water or in aqueous solutions, including for example, blood. Enzymatically unstable or degradable linkages mean that the linkage can be degraded by one or more enzymes. As understood in the art, PEG and related polymers may include degradable linkages in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule. For example, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent generally hydrolyze under physiological conditions to release the agent. Other hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
Branched linkers may be used in antibodies of the invention. A number of different cleavable linkers are known to those of skill in the art. See U.S. Pat. Nos. 4,618,492; 4,542,225, and 4,625,014. The mechanisms for release of an agent from these linker groups include, for example, irradiation of a photolabile bond and acid-catalyzed hydrolysis. U.S. Pat. No.
4,671,958, for example, includes a description of immunoconjugates comprising linkers which are cleaved at the target site in vivo by the proteolytic enzymes of the patient's complement system. The length of the linker may be predetermined or selected depending upon a desired spatial relationship between the antibody and the molecule linked to it. In view of the large number of methods that have been reported for attaching a variety of radiodiagnostic compounds, radiotherapeutic compounds, drugs, toxins, and other agents to antibodies one skilled in the art will be able to determine a suitable method for attaching a given agent to an antibody.
[00319] Any hetero- or homo-bifunctional linker can be used to link the conjugates. The linker may have a wide range of molecular weight or molecular length. Larger or smaller molecular weight linkers may be used to provide a desired spatial relationship or
conformation between the antibody and the linked entity. Linkers having longer or shorter molecular length may also be used to provide a desired space or flexibility between the antibody and the linked entity. Similarly, a linker having a particular shape or conformation may be utilized to impart a particular shape or conformation to the antibody or the linked entity, either before or after the antibody reaches its target. The functional groups present on each end of the linker may be selected to modulate the release of an antibody or a payload under desired conditions. This optimization of the spatial relationship between the antibody and the linked entity may provide new, modulated, or desired properties to the molecule.
[00320] In some embodiments, the invention provides water-soluble bifunctional linkers that have a dumbbell structure that includes: a) an azide, an alkyne, a hydrazine, a hydrazide, a hydroxylamine, or a carbonyl-containing moiety on at least a first end of a polymer backbone; and b) at least a second functional group on a second end of the polymer backbone. The second functional group can be the same or different as the first functional group. The second functional group, in some embodiments, is not reactive with the first functional group. The invention provides, in some embodiments, water-soluble compounds that comprise at least one arm of a branched molecular structure. For example, the branched molecular structure can be dendritic.
Parent Antibodies
[00321] The parent antibody can be any antibody known to those of skill in the art, or later discovered, without limitation. The parent antibody may be substantially encoded by an antibody gene or antibody genes from any organism, including but not limited to humans, mice, rats, rabbits, camels, llamas, dromedaries, monkeys, particularly mammals and particularly human and particularly mice and rats. In one embodiment, the parent antibody may be fully human, obtained for example from a patient or subject, by using transgenic mice or other animals (Bruggemann & Taussig, 1997, Curr. Opin. Biotechnol. 8:455-458) or human antibody libraries coupled with selection methods (Griffiths & Duncan, 1998, Curr. Opin. Biotechnol. 9: 102-108). The parent antibody may be from any source, including artificial or naturally occurring. For example parent antibody can be an engineered antibody, including but not limited to chimeric antibodies and humanized antibodies (Clark, 2000, Immunol. Today 21 :397-402) or derived from a combinatorial library. In addition, the parent antibody may be an engineered variant of an antibody that is substantially encoded by one or more natural antibody genes. For example, in one embodiment the parent antibody is an antibody that has been identified by affinity maturation.
[00322] The parent antibody can have affinity to any antigen known to those of skill in the art, or later discovered. Virtually any substance may be an antigen for a parent antibody, or an antibody of the present description. Examples of useful antigens include, but are not limited to, Alpha- 1 antitrypsin, Angiostatin, Antihemo lytic factor, antibodies,
Apolipoprotein, Apoprotein, Atrial natriuretic factor, Atrial natriuretic polypeptide, Atrial peptides, C-X-C chemokines (e.g., T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF-1, PF4, MIG), calcitonin, CC chemokines (e.g., monocyte
chemoattractant protein- 1, monocyte chemoattractant protein-2, monocyte chemoattractant protein-3, monocyte inflammatory protein- 1 alpha, monocyte inflammatory protein- 1 beta, RANTES, 1309, R83915, R91733, HCC1, T58847, D31065, T64262), CD40 ligand, C-kit ligand, collagen, colony stimulating factor (CSF), complement factor 5a, complement inhibitor, complement receptor 1, cytokines, (e.g., epithelial neutrophil activating peptide-78, GRO/MGSA, GRO, GRO, MIP-1, MIP-1, MCP-1), epidermal growth factor (EGF), erythropoietin ("EPO"), exfoliating toxins A and B, factor IX, factor VII, factor VIII, factor X, fibroblast growth factor (FGF), fibrinogen, fibronectin, G-CSF, GM-CSF,
glucocerebrosidase, gonadotropin, growth factors, hedgehog proteins (e.g., Sonic, Indian, Desert), hemoglobin, hepatocyte growth factor (HGF), hirudin, human serum albumin, insulin, insulin-like growth factor (IGF), interferons (e.g., IFN-a, IFN-, IFN-γ), interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, etc.), keratinocyte growth factor (KGF), lactoferrin, leukemia inhibitory factor, luciferase, neurturin, neutrophil inhibitory factor (NIF), oncostatin M, osteogenic protein, parathyroid hormone, PD-ECSF, PDGF, peptide hormones (e.g., human growth hormone), pleiotropin, protein A, protein G, pyrogenic exotoxins A, B, and C, relaxin, renin, SCF, soluble complement receptor I, soluble I-CAM 1, soluble interleukin receptors (IL-1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15), soluble TNF receptor, somatomedin, somatostatin, somatotropin, streptokinase, superantigens, i.e., staphylococcal enterotoxins (SEA, SEB, SEC1, SEC2, SEC3, SED, SEE), superoxide dismutase, toxic shock syndrome toxin (TSST-1), thymosin alpha 1, tissue plasminogen activator, tumor necrosis factor (TNF beta), tumor necrosis factor receptor (TNFR), tumor necrosis factor-alpha (TNF alpha), vascular endothelial growth factor (VEGF), urokinase and others. These antigens can be obtained by methods known to those of skill in the art, for example, from commercial sources or from published polypeptide or polynucleotide sequences (e.g. Genbank).
[00323] Additional antigens include, but are not limited to, transcriptional and expression activators. Exemplary transcriptional and expression activators include genes and proteins that modulate cell growth, differentiation, regulation, or the like. Expression and
transcriptional activators are found in prokaryotes, viruses, and eukaryotes, including fungi, plants, and animals, including mammals, providing a wide range of therapeutic targets. It will be appreciated that expression and transcriptional activators regulate transcription by many mechanisms, e.g., by binding to receptors, stimulating a signal transduction cascade, regulating expression of transcription factors, binding to promoters and enhancers, binding to proteins that bind to promoters and enhancers, unwinding DNA, splicing pre-mRNA, polyadenylating RNA, and degrading RNA. Antigens include, but are not limited to, expression activators such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL-1, IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-a, TGF-β, EGF, KGF, SCF/c-Kit,
CD40L/CD40, VLA-4VCAM-1, ICAM-l/LFA-1 , and hyalurin/CD44; signal transduction molecules and corresponding oncogene products, e.g. , Mos, Ras, Raf, and Met; and transcriptional activators and suppressors, e.g., p53, Tat, Fos, Myc, Jun, Myb, Rel, and steroid hormone receptors such as those for estrogen, progesterone, testosterone, aldosterone, the LDL receptor ligand and corticosterone.
[00324] Vaccine proteins may be antigens including, but not limited to, proteins from infectious fungi, e.g., Aspergillus, Candida species; bacteria, particularly E. coli, which serves a model for pathogenic bacteria, as well as medically important bacteria such as Staphylococci {e.g., aureus), or Streptococci {e.g., pneumoniae); protozoa such as sporozoa {e.g., Plasmodia), rhizopods {e.g., Entamoeba) and flagellates {Trypanosoma, Leishmania, Trichomonas, Giardia, etc.); viruses such as (+) RNA viruses (examples include Poxviruses e.g., vaccinia; Picornaviruses, e.g. polio; Togaviruses, e.g., rubella; Flaviviruses, e.g., HCV; and Coronaviruses), (-) RNA viruses {e.g., Rhabdoviruses, e.g., VSV; Paramyxovimses, e.g., RSV; Orthomyxovimses, e.g., influenza; Bunyaviruses; and Arenaviruses), dsDNA viruses (Reoviruses, for example), RNA to DNA viruses, i.e., Retroviruses, e.g., HIV and HTLV, and certain DNA to RNA viruses such as Hepatitis B.
[00325] Antigens may be enzymes including, but not limited to, amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases, glycosidases, glycosyl transferases, haloperoxidases, monooxygenases {e.g., p450s), lipases, lignin peroxidases, nitrile hydratases, nitrilases, proteases, phosphatases, subtilisins, transaminase, and nucleases.
[00326] Agriculturally related proteins such as insect resistance proteins {e.g., the Cry proteins), starch and lipid production enzymes, plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins, plant growth enzymes {e.g., Ribulose 1,5- Bisphosphate Carboxylase/Oxygenase, "RUBISCO"), lipoxygenase (LOX), and
Phosphoenolpyruvate (PEP) carboxylase may also be antigens.
[00327] For example, the antigen may be a disease-associated molecule, such as tumor surface antigen such as B-cell idiotypes, CD20 on malignant B cells, CD33 on leukemic blasts, and HER2/neu on breast cancer. Alternatively, the antigen may be a growth factor receptor. Examples of the growth factors include, but are not limited to, epidermal growth factors (EGFs), transferrin, insulin-like growth factor, transforming growth factors (TGFs), interleukin-1, and interleukin-2. For example, a high expression of EGF receptors has been found in a wide variety of human epithelial primary tumors. TGF-a has been found to mediate an autocrine stimulation pathway in cancer cells. Several murine monoclonal antibodies have been demonstrated to be able to bind EGF receptors, block the binding of ligand to EGF receptors, and inhibit proliferation of a variety of human cancer cell lines in culture and in xenograft medels. Mendelsohn and Baselga (1995) Antibodies to growth factors and receptors, in Biologic Therapy of Cancer, 2nd Ed., J B Lippincott, Philadelphia, pp 607-623. Thus, Antibodies of the invention may be used to treat a variety of cancers.
[00328] The antigen may also be cell surface protein or receptor associated with coronary artery disease such as platelet glycoprotein Ilb/IIIa receptor, autoimmune diseases such as CD4, CAMPATH-1 and lipid A region of the gram-negative bacterial lipopolysaccharide. Humanized antibodies against CD4 have been tested in clinical trials in the treatment of patients with mycosis fungoides, generalized postular psoriasis, severe psoriasis, and rheumatoid arthritis. Antibodies against lipid A region of the gram-negative bacterial lipopolysaccharide have been tested clinically in the treatment of septic shock. Antibodies against CAMPATH-1 have also been tested clinically in the treatment of against refractory rheumatoid arthritis. Thus, antibodies provided herein may be used to treat a variety of autoimmune diseases.
[00329] Useful antigens also include proteins or peptides associated with human allergic diseases, such as inflammatory mediator proteins, e.g. interleukin-1 (IL-1), tumor necrosis factor (TNF), leukotriene receptor and 5 -lipoxygenase, and adhesion molecules such as V- CAM/VLA-4. In addition, IgE may also serve as the antigen because IgE plays pivotal role in type I immediate hypersensitive allergic reactions such as asthma. Studies have shown that the level of total serum IgE tends to correlate with severity of diseases, especially in asthma. Burrows et al. (1989) "Association of asthma with serum IgE levels and skin-test reactivity to allergens" New Engl. L. Med. 320:271-277. Thus, Antibodies selected against IgE may be used to reduce the level of IgE or block the binding of IgE to mast cells and basophils in the treatment of allergic diseases without having substantial impact on normal immune functions.
[00330] The antigen may also be a viral surface or core protein which may serve as an antigen to trigger immune response of the host. Examples of these viral proteins include, but are not limited to, glycoproteins (or surface antigens, e.g., GP120 and GP41) and capsid proteins (or structural proteins, e.g., P24 protein); surface antigens or core proteins of hepatitis A, B, C, D or E virus (e.g. small hepatitis B surface antigen (SHBsAg) of hepatitis B virus and the core proteins of hepatitis C virus, NS3, NS4 and NS5 antigens); glycoprotein (G-protein) or the fusion protein (F-protein) of respiratory syncytial virus (RSV); surface and core proteins of herpes simplex virus HSV-1 and HSV-2 (e.g., glycoprotein D from HSV-2).
[00331] The antigen may also be a mutated tumor suppressor gene product that has lost its tumor-suppressing function and may render the cells more susceptible to cancer. Tumor suppressor genes are genes that function to inhibit the cell growth and division cycles, thus preventing the development of neoplasia. Mutations in tumor suppressor genes cause the cell to ignore one or more of the components of the network of inhibitory signals, overcoming the cell cycle check points and resulting in a higher rate of controlled cell growth-cancer.
Examples of the tumor suppressor genes include, but are not limited to, DPC-4, NF-1 , NF-2, RB, p53, WTl , BRCAl and BRCA2. DPC-4 is involved in pancreatic cancer and participates in a cytoplasmic pathway that inhibits cell division. NF-1 codes for a protein that inhibits Ras, a cytoplasmic inhibitory protein. NF-1 is involved in neurofibroma and
pheochromocytomas of the nervous system and myeloid leukemia. NF-2 encodes a nuclear protein that is involved in meningioma, schwanoma, and ependymoma of the nervous system. RB codes for the pRB protein, a nuclear protein that is a major inhibitor of cell cycle. RB is involved in retinoblastoma as well as bone, bladder, small cell lung and breast cancer. p53 codes for p53 protein that regulates cell division and can induce apoptosis. Mutation and/or inaction of p53 is found in a wide ranges of cancers. WTl is involved in Wilms tumor of the kidneys. BRCAl is involved in breast and ovarian cancer, and BRCA2 is involved in breast cancer. Thus, Antibodies may be used to block the interactions of the gene product with other proteins or biochemicals in the pathways of tumor onset and development.
[00332] The antigen may be a CD molecule including but not limited to, CD la, CD lb, CDlc, CDld, CD2, CD3y, CD35, CD3s, CD4, CD5, CD6, CD7, CD8a, CD8p, CD9, CD10, CDl la, CDl lb, CDl lc, CDwl2, CD13, CD14, CD15, CD15s, CD16a, CD16b, CD18, CD19, CD20, CD21 , CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31 , CD32, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45R, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD51 , CD52, CD53, CD54, CD55, CD56, CD57, CD58, CD59, CDw60, CD61 , CD62E, CD62L, CD62P, CD63, CD64, CD65, CD66a, CD66b, CD66c, CD66d, CD66e, CD66f, CD67, CD68, CD69, CDw70, CD71 , CD72, CD73, CD74, CDw75, CDw76, CD77, CD79a, CD79P, CD80, CD81 , CD82, CD83, CD84, CD85, CD86, CD87, CD88, CD89, CD90, CD91 , CDw92, CD93, CD94, CD95, CD96, CD97, CD98, CD99, CD100, CD101 , CD102, CD103, CD104, CD105, CD106, CD107a, CD107b, CDwl08, CDwl09, CD110-113, CD114, CD115, CD116, CD117, CD118, CD119, CD120a, CD120b, CD121a, CD121b, CD122, CD123, CDwl24, CD125, CD126, CDwl27,
CDwl28a, CDwl28b, CD129, CDwl30, CD131, CD132, CD133, CD134, CD135, CD136, CDwl37, CD138, CD139, CD140a, CD140b, CD141, CD142, CD143, CD144, CDwl45, CD146, CD147, CD148, CDwl49, CD150, CD151, CD152, CD153, CD154, CD155, CD156, CD157, CD158a, CD158b, CD161, CD162, CD163, CD164, CD165, CD166, and TCR The antigen may be VEGF, VEGF receptor, EGFR, Her2, TNFa, TNFRI receptor, GPIIb/IIIa, IL-2R alpha chain, IL-2R beta chain, RSV F protein, alpha4 integrin, IgE, IgE receptor, digoxin, carpet viper venom, complement C5, OPGL, CA-125 tumor antigen, Staphylococci proteins, Staphylococcus epidermidis proteins, Staphylococcus aureus proteins, proteins involved Staphylococcal infection (including but not limited to,
Staphylococcus aureus and Staphylococcus epidermidis), IL-6 receptor, CTLA-4, RSV, Tac subunit of IL-2 receptor, IL-5, and EpCam. In certain embodiments, the antigen is CD74. The antigen may be a fragment of a molecule.
[00333] Parent antibodies can be any antibody known in the art or any antibody developed by those of skill in the art without limitation. Examples include, but are not limited to anti- TNF antibody (U.S. Pat. No. 6,258,562), anti-IL-12 and/or anti-IL-12p40 antibody (U.S. Pat. No. 6,914,128); anti-IL-18 antibody (U.S. Patent Publication No. 2005/0147610), anti-05, anti-CBL, anti-CD147, anti-gpl20, anti-VLA-4, anti-CDl la, anti-CD18, anti-VEGF, anti- CD40L, anti CD-40 (e.g., see PCT Publication No. WO 2007/124299) anti-Id, anti-ICAM-1, anti-CXCL13, anti-CD2, anti-EGFR, anti-TGF-beta 2, anti-HGF, anti-cMet, anti DLL-4, anti-NPRl, anti-PLGF, anti-ErbB3, anti-E-selectin, anti-Fact VII, anti-Her2/neu, anti-F gp, anti-CDl l/18, anti-CD14, anti-ICAM-3, anti-RON, anti-SOST, anti CD-19, anti-CD80 (e.g., see PCT Publication No. WO 2003/039486, anti-CD4, anti-CD3, anti-CD23, anti-beta2- integrin, anti-alpha4beta7, anti-CD52, anti-HLA DR, anti-CD22 (e.g., see U.S. Pat. No. 5,789,554), anti-CD20, anti-MIF, anti-CD64 (FcR), anti-TCR alpha beta, anti-CD2, anti-Hep B, anti-CA 125, anti-EpCAM, anti-gpl20, anti-CMV, anti-gpllbllla, anti-IgE, anti-CD25, anti-CD33, anti-HLA, anti-IGFl,2, anti IGFR, anti-VNRintegrin, anti-IL-1 alpha, anti-IL- lbeta, anti-IL-1 receptor, anti-IL-2 receptor, anti-IL-4, anti-IL-4 receptor, anti-IL5, anti-IL-5 receptor, anti-IL-6, anti-IL-8, anti-IL-9, anti-IL-13, anti-IL-13 receptor, anti-IL-17, anti-IL- 6R, anti-RANKL, anti-NGF, anti-DK , anti-alphaVbeta3, anti-IL-17 A, anti-IL23pl9 and anti-IL-23 (see Presta, L. G. (2005) J. Allergy Clin. Immunol. 116: 731-6 and www<dot>path<dot>cam<dot>ac<dot>uk</><dot>about<dot>mrc<7></>humanisation</>a ntibodies<dot>html) .
[00334] Parent antibodies may also be selected from various therapeutic antibodies approved for use, in clinical trials, or in development for clinical use. Such therapeutic antibodies include, but are not limited to, rituximab (Rituxan®, IDEC/Genentech/Roche) (see, for example, U.S. Pat. No. 5,736,137), a chimeric anti-CD20 antibody approved to treat Non-Hodgkin's lymphoma; HuMax-CD20, an anti-CD20 currently being developed by Genmab, an anti-CD20 antibody described in U.S. Pat. No. 5,500,362, AME-133 (Applied Molecular Evolution), hA20 (Immunomedics, Inc.), HumaLYM (Intracel), and PRO70769 (PCT Application No. PCT/US2003/040426), trastuzumab (Herceptin®, Genentech) (see, for example, U.S. Pat. No. 5,677,171), a humanized anti-Her2/neu antibody approved to treat breast cancer; pertuzumab (rhuMab-2C4, Omnitarg®), currently being developed by
Genentech; an anti-Her2 antibody (U.S. Pat. No. 4,753,894; cetuximab (Erbitux®, Imclone) (U.S. Pat. No. 4,943,533; PCT Publication No. WO 96/40210), a chimeric anti-EGFR antibody in clinical trials for a variety of cancers; ABX-EGF (U.S. Pat. No. 6,235,883), currently being developed by Abgenix-Immunex-Amgen; HuMax-EGFr (U.S. Pat. No.
7,247,301), currently being developed by Genmab; 425, EMD55900, EMD62000, and EMD72000 (Merck KGaA) (U.S. Pat. No. 5,558,864; Murthy, et al. (1987) Arch. Biochem. Biophys. 252(2): 549-60; Rodeck, et al. (1987) J. Cell. Biochem. 35(4): 315-20;
Kettleborough, et al. (1991) Protein Eng. 4(7): 773-83); ICR62 (Institute of Cancer Research) (PCT Publication No. WO 95/20045; Modjtahedi, et al. (1993) J. Cell. Biophys. 22(1-3): 129- 46; Modjtahedi, et al. (1993) Br. J. Cancer 67(2): 247-53; Modjtahedi, et al. (1996) Br. J. Cancer 73(2): 228-35; Modjtahedi, et al. (2003) Int. J. Cancer 105(2): 273-80); TheraCIM hR3 (YM Biosciences, Canada and Centro de Immunologia Molecular, Cuba (U.S. Pat. No. 5,891,996; U.S. Pat. No. 6,506,883; Mateo, et al. (1997) Immunotechnol. 3(1): 71-81); mAb- 806 (Ludwig Institue for Cancer Research, Memorial Sloan-Kettering) (Jungbluth, et al. (2003) Proc. Natl. Acad. Sci. USA. 100(2): 639-44); KSB-102 (KS Biomedix); MRl-1 (IVAX, National Cancer Institute) (PCT Publication No. WO 01/62931A2); and SCI 00 (Scancell) (PCT Publication No. WO 01/88138); alemtuzumab (Campath®, Millenium), a humanized mAb currently approved for treatment of B-cell chronic lymphocytic leukemia; muromonab-CD3 (Orthoclone OKT3®), an anti-CD3 antibody developed by Ortho
Biotech/Johnson & Johnson, ibritumomab tiuxetan (Zevalin®), an anti-CD20 antibody developed by IDEC/Schering AG, gemtuzumab ozogamicin (Mylotarg®), an anti-CD33 (p67 protein) antibody developed by Celltech/Wyeth, alefacept (Amevive®), an anti-LFA-3 Fc fusion developed by Biogen), abciximab (ReoPro®), developed by Centocor/Lilly, basiliximab (Simulect®), developed by Novartis, palivizumab (Synagis®), developed by
Medimmune, infliximab (Remicade®), an anti-TNF alpha antibody developed by Centocor, adalimumab (Humira®), an anti-TNF alpha antibody developed by Abbott, Humicade®, an anti-TNF alpha antibody developed by Celltech, golimumab (CNTO-148), a fully human TNF antibody developed by Centocor, etanercept (Enbrel®), an p75 TNF receptor Fc fusion developed by Immunex/Amgen, Ienercept, an p55TNF receptor Fc fusion previously developed by Roche, ABX-CBL, an anti-CD 147 antibody being developed by Abgenix,
ABX-IL8, an anti-IL8 antibody being developed by Abgenix, ABX-MA1, an anti-MUC18 antibody being developed by Abgenix, Pemtumomab (R1549, 90Y-muHMFGl), an anti-
MUC1 in development by Antisoma, Therex (R1550), an anti-MUCl antibody being developed by Antisoma, AngioMab (AS 1405), being developed by Antisoma, HuBC-1, being developed by Antisoma, Thioplatin (AS 1407) being developed by Antisoma, Antegren®
(natalizumab), an anti-alpha-4-beta-l (VLA-4) and alpha-4-beta-7 antibody being developed by Biogen, VLA-1 mAb, an anti-VLA-1 integrin antibody being developed by Biogen, LTBR mAb, an anti-lymphotoxin beta receptor (LTBR) antibody being developed by Biogen, CAT-
152, an anti-TGF-β antibody being developed by Cambridge Antibody Technology, ABT 874
(J695), an anti-IL-12 p40 antibody being developed by Abbott, CAT- 192, an anti-TGFpi antibody being developed by Cambridge Antibody Technology and Genzyme, CAT-213, an anti-Eotaxinl antibody being developed by Cambridge Antibody Technology, LymphoStat-
B® an anti-Blys antibody being developed by Cambridge Antibody Technology and Human
Genome Sciences Inc., TRAIL-Rl mAb, an anti-TRAIL-Rl antibody being developed by
Cambridge Antibody Technology and Human Genome Sciences, Inc., Avastin®
bevacizumab, rhuMAb-VEGF), an anti-VEGF antibody being developed by Genentech, an anti-HER receptor family antibody being developed by Genentech, Anti-Tissue Factor
(ATF), an anti-Tissue Factor antibody being developed by Genentech, Xolair®
(Omalizumab), an anti-IgE antibody being developed by Genentech, Raptiva® (Efalizumab), an anti-CD 1 la antibody being developed by Genentech and Xoma, MLN-02 Antibody
(formerly LDP-02), being developed by Genentech and Millenium Pharmaceuticals, HuMax
CD4, an anti-CD4 antibody being developed by Genmab, HuMax-IL15, an anti-IL15 antibody being developed by Genmab and Amgen, HuMax-Inflam, being developed by
Genmab and Medarex, HuMax-Cancer, an anti-Heparanase I antibody being developed by
Genmab and Medarex and Oxford GcoSciences, HuMax-Lymphoma, being developed by Genmab and Amgen, HuMax-TAC, being developed by Genmab, IDEC-131, and anti-
CD40L antibody being developed by IDEC Pharmaceuticals, IDEC-151 (Clenoliximab), an anti-CD4 antibody being developed by IDEC Pharmaceuticals, IDEC- 114, an anti-CD80 antibody being developed by IDEC Pharmaceuticals, IDEC- 152, an anti-CD 23 being developed by IDEC Pharmaceuticals, anti-macrophage migration factor (MIF) antibodies being developed by IDEC Pharmaceuticals, BEC2, an anti-idiotypic antibody being developed by Imclone, IMC-1C11, an anti-KDR antibody being developed by Imclone,
DC101, an anti-flk-1 antibody being developed by Imclone, anti-VE cadherin antibodies being developed by Imclone, CEA-Cide® (Iabetuzumab), an anti-carcinoembryonic antigen
(CEA) antibody being developed by Immunomedics, LymphoCide® (Epratuzumab), an anti-
CD22 antibody being developed by Immunomedics, AFP-Cide, being developed by
Immunomedics, MyelomaCide, being developed by Immunomedics, LkoCide, being developed by Immunomedics, ProstaCide, being developed by Immunomedics, MDX-010, an anti-CTLA4 antibody being developed by Medarex, MDX-060, an anti-CD30 antibody being developed by Medarex, MDX-070 being developed by Medarex, MDX-018 being developed by Medarex, Osidem® (IDM-1), and anti-Her2 antibody being developed by
Medarex and Immuno-Designed Molecules, HuMax®-CD4, an anti-CD4 antibody being developed by Medarex and Genmab, HuMax-IL15, an anti-IL15 antibody being developed by Medarex and Genmab, CNTO 148, an anti-TNFa antibody being developed by Medarex and Centocor/J&J, CNTO 1275, an anti-cytokine antibody being developed by Centocor/J&J,
MOR101 and MOR102, anti-intercellular adhesion molecule-1 (ICAM-1) (CD54) antibodies being developed by MorphoSys, MOR201, an anti-fibroblast growth factor receptor 3
(FGFR-3) antibody being developed by MorphoSys, Nuvion® (visilizumab), an anti-CD3 antibody being developed by Protein Design Labs, HuZAF®, an anti-gamma interferon antibody being developed by Protein Design Labs, Αηίί-α5β1 Integrin, being developed by
Protein Design Labs, anti-IL-12, being developed by Protein Design Labs, ING-1, an anti-Ep-
CAM antibody being developed by Xoma, Xolair® (Omalizumab) a humanized anti-IgE antibody developed by Genentech and Novartis, and MLNOl, an anti-Beta2 integrin antibody being developed by Xoma. In another embodiment, the therapeutics include KRN330 (Kirin); huA33 antibody (A33, Ludwig Institute for Cancer Research); CNTO 95 (alpha V integrins,
Centocor); MEDI-522 (alpha Vp3integrin, Medimmune); volociximab (alpha νβΐ integrin,
Biogen/PDL); Human mAb 216 (B cell glycosolated epitope, NCI); BiTE MT103 (bispecific
CD19xCD3, Medimmune); 4G7xH22 (Bispecific BcellxFcgammaRl, Medarex/Merck
KGa); rM28 (Bispecific CD28xMAPG, EP Patent No. EP1444268); MDX447 (EMD 82633) (Bispecific CD64xEGFR, Medarex); Catumaxomab (removab) (Bispecific EpCAMx anti-
CD3, Trion/Fres); Ertumaxomab (bispecific HER2/CD3, Fresenius Biotech); oregovomab
(OvaRex) (CA-125, ViRexx); Rencarex® (WX G250) (carbonic anhydrase IX, Wilex);
CNTO 888 (CCL2, Centocor); TRC105 (CD 105 (endoglin), Tracon); BMS-663513 (CD 137 agonist, Brystol Myers Squibb); MDX-1342 (CD19, Medarex); Siplizumab (MEDI-507)
(CD2, Medimmune); Ofatumumab (Humax-CD20) (CD20, Genmab); Rituximab (Rituxan)
(CD20, Genentech); veltuzumab (hA20) (CD20, Immunomedics); Epratuzumab (CD22,
Amgen); lumiliximab (IDEC 152) (CD23, Biogen); muromonab-CD3 (CD3, Ortho);
HuM291 (CD3 fc receptor, PDL Biopharma); HeFi-1, CD30, NCI); MDX-060 (CD30,
Medarex); MDX-1401 (CD30, Medarex); SGN-30 (CD30, Seattle Genentics); SGN-33
(Lintuzumab) (CD33, Seattle Genentics); Zanolimumab (HuMax-CD4) (CD4, Genmab);
HCD122 (CD40, Novartis); SGN-40 (CD40, Seattle Genentics); Campathlh (Alemtuzumab)
(CD52, Genzyme); MDX-1411 (CD70, Medarex); hLLl (EPB-1) (CD74.38,
Immunomedics); Galiximab (IDEC- 144) (CD80, Biogen); MT293 (TRC093/D93) (cleaved collagen, Tracon); HuLuc63 (CS1, PDL Pharma); ipilimumab (MDX-010) (CTLA4, Brystol
Myers Squibb); Tremelimumab (Ticilimumab, CP-675,2) (CTLA4, Pfizer); HGS-ETR1
(Mapatumumab) (DR4TRAIL-R1 agonist, Human Genome Science/Glaxo Smith Kline);
AMG-655 (DR5, Amgen); Apomab (DR5, Genentech); CS-1008 (DR5, Daiichi Sankyo);
HGS-ETR2 (lexatumumab) (DR5TRAIL-R2 agonist, HGS); Cetuximab (Erbitux) (EGFR,
Imclone); IMC-11F8, (EGFR, Imclone); Nimotuzumab (EGFR, YM Bio); Panitumumab
(Vectabix) (EGFR, Amgen); Zalutumumab (HuMaxEGFr) (EGFR, Genmab); CDX-110
(EGFRvIII, AVANT Immunotherapeutics); adecatumumab (MT201) (Epcam, Merck);
edrecolomab (Panorex, 17-1A) (Epcam, Glaxo/Centocor); MORAb-003 (folate receptor a,
Morphotech); KW-2871 (ganglioside GD3, Kyowa); MORAb-009 (GP-9, Morphotech);
CDX-1307 (MDX-1307) (hCGb, Celldex); Trastuzumab (Herceptin) (HER2, Celldex);
Pertuzumab (rhuMAb 2C4) (HER2 (DI), Genentech); apolizumab (HLA-DR beta chain, PDL
Pharma); AMG-479 (IGF-1R, Amgen); anti-IGF-lR R1507 (IGF1-R, Roche); CP 751871
(IGF1-R, Pfizer); IMC-A12 (IGF1-R, Imclone); BIIB022 (IGF-1R, Biogen); Mik-beta-1 (IL-
2Rb (CD 122), Hoffman LaRoche); CNTO 328 (IL6, Centocor); Anti-KIR (1-7F9) (Killer cell
Ig-like Receptor (KIR), Novo); Hu3S193 (Lewis (y), Wyeth, Ludwig Institute of Cancer
Research); hCBE-11 (LTpR, Biogen); HuHMFGl (MUC1, Antisoma/NCl); RAVI 2 (N- linked carbohydrate epitope, Raven); CAL (parathyroid hormone-related protein (PTH-rP),
University of California); CT-011 (PD1, CureTech); MDX-1106 (ono-4538) (PD1,
Medarex/Ono); MAb CT-011 (PD1, Curetech); IMC-3G3 (PDGFRa, Imclone); bavituximab (phosphatidylserine, Peregrine); huJ591 (PSMA, Cornell Research Foundation); muJ591 (PSMA, Cornell Research Foundation); GC1008 (TGFb (pan) inhibitor (IgG4), Genzyme); Infliximab (Remicade) (TNFa, Centocor); A27.15 (transferrin receptor, Salk Institute, INSERN WO 2005/111082); E2.3 (transferrin receptor, Salk Institute); Bevacizumab (Avastin) (VEGF, Genentech); HuMV833 (VEGF, Tsukuba Research Lab, PCT Publication No. WO/2000/034337, University of Texas); IMC-18F1 (VEGFR1, Imclone); IMC-1121 (VEGFR2, Imclone).
[00335] Examples of useful bispecific parent antibodies include, but are not limited to, those with one antibody directed against a tumor cell antigen and the other antibody directed against a cytotoxic trigger molecule such as anti-FcyRI/anti-CD 15, anti-pl85HER2/FcYRIII (CD 16), anti-CD3/anti-malignant B-cell (ID 10), anti-CD3/anti-pl85HER2, anti-CD3/anti-p97, anti-CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-Dl (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti- CD3, anti-CD3/anti-CAMAl, anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/anti-CD3; bispecific antibodies with one antibody which binds specifically to a tumor antigen and another antibody which binds to a toxin such as anti-saporin/anti-Id-1, anti-CD22/anti-saporin, anti-CD7/anti-saporin, anti-CD38/anti- saporin, anti-CEA/anti-ricin A chain, anti-interferon-a (IFN-a)/anti-hybridoma idiotype, anti- CEA/anti-vinca alkaloid; bispecific antibodies for converting enzyme activated prodrugs such as anti-CD30/anti-alkaline phosphatase (which catalyzes conversion of mitomycin phosphate prodrug to mitomycin alcohol); bispecific antibodies which can be used as fibrinolytic agents such as anti-fibrin/anti-tissue plasminogen activator (tPA), anti-fibrin/anti-urokinase-type plasminogen activator (uPA); bispecific antibodies for targeting immune complexes to cell surface receptors such as anti-low density lipoprotein (LDL)/anti-Fc receptor (e.g. FcyRI, FcyRII or FcyRIII); bispecific antibodies for use in therapy of infectious diseases such as anti-CD3/anti-herpes simplex virus (HSV), anti-T-cell receptor: CD3 complex/anti-influenza, anti-FcyR/anti-HIV; bispecific antibodies for tumor detection in vitro or in vivo such as anti- CEA/anti-EOTUBE, anti-CEA/anti-DPTA, anti- anti-pl85HER2/anti-hapten; bispecific antibodies as vaccine adjuvants (see Fanger, M W et al, Crit Rev Immunol. 1992;
12(34): 101-24, which is incorporated by reference herein); and bispecific antibodies as diagnostic tools such as anti-rabbit IgG/anti-ferritin, anti-horse radish peroxidase (HRP)/anti- hormone, anti-somatostatin/anti-substance P, anti-HRP/anti-FITC, anti-CEA/anti-β- galactosidase (see Nolan, O et R. O'Kennedy, Biochim Biophys Acta. 1990 Aug. 1;
1040(1): 1-11, which is incorporated by reference herein). Examples of trispecific antibodies include anti-CD3/anti-CD4/anti-CD37, anti-CD3/anti-CD5/anti-CD37 and anti-CD3/anti-
CD8/anti-CD37.
[00336] In certain embodiments, the antibody comprising one or more non-natural amino acid residues at site-specific positions has high sequence identity to any parent antibody described herein. In certain embodiments, the antibody is substantially identical to a parent antibody described herein. In certain embodiments, the antibody has about 60% identity, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% identity to a parent antibody described herein. In certain embodiments, the antibody has greater than about 65%o, greater than about 70%>, greater than about 75%, greater than about 80%>, greater than about 85%, greater than about 90%, or greater than about 95% identity to a parent antibody described herein. Antibodies are substantially identical if at least one polypeptide chain of one antibody has sequence identity to a corresponding polypeptide chain of another antibody. In certain embodiments, the antibody comprising one or more non-natural amino acid residues at site-specific positions has at least one polypeptide chain having greater than about 65%o, greater than about 70%>, greater than about 75%, greater than about 80%>, greater than about 85%, greater than about 90%, or greater than about 95% identity to any of SEQ ID NOS: l-6 over at least one domain, at least two domains or at least three domains.
Antibody Compositions
[00337] Antibodies described herein can be formulated into compositions using methods available in the art and those disclosed herein. Any of the compounds disclosed herein can be provided in the appropriate pharmaceutical composition and be administered by a suitable route of administration.
[00338] In certain embodiments, the antibody compositions provided herein further comprise a pharmaceutically acceptable carrier. The carrier can be a diluent, excipient, or vehicle with which the pharmaceutical composition is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained- release formulations and the like. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in E.W. Martin, 1990, Remington's Pharmaceutical Sciences, Mack Publishing Co.
[00339] In some embodiments, the pharmaceutical composition is provided in a form suitable for administration to a human subject. In some embodiments, the pharmaceutical composition will contain a prophylactically or therapeutically effective amount of the antibody together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
[00340] In some embodiments, the pharmaceutical composition is provided in a form suitable for intravenous administration. Typically, compositions suitable for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Such compositions, however, may be administered by a route other than intravenous administration.
[00341] In particular embodiments, the pharmaceutical composition is suitable for subcutaneous administration. In particular embodiments, the pharmaceutical composition is suitable for intramuscular administration.
[00342] Components of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[00343] In some embodiments, the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject. In some embodiments, antibodies are supplied as a water free concentrate. In some embodiments, the antibody is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
[00344] In another embodiment, the pharmaceutical composition is supplied in liquid form. In some embodiments, the pharmaceutical composition is provided in liquid form and is substantially free of surfactants and/or inorganic salts. In some embodiments, the antibody is supplied as in liquid form at a unit dosage of at least 0.1 mg/ml, at least 0.5 mg/ml, at least 1 mg/ml, at least 2.5 mg/ml, at least 3 mg/ml, at least 5 mg/ml, at least 8 mg/ml, at least 10 mg/ml, at least 15 mg/ml, at least 25 mg/ml, at least 30 mg/ml, or at least 60 mg/ml.
[00345] In some embodiments, the pharmaceutical composition is formulated as a salt form. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
[00346] In therapeutic use, the practitioner will determine the posology most appropriate according to a preventive or curative treatment and according to the age, weight, stage of the infection and other factors specific to the subject to be treated. In certain embodiments, doses are from about 1 to about 1000 mg per day for an adult, or from about 5 to about 250 mg per day or from about 10 to 50 mg per day for an adult. In certain embodiments, doses are from about 5 to about 400 mg per day or 25 to 200 mg per day per adult. In certain embodiments, dose rates of from about 50 to about 500 mg per day are also contemplated.
Methods of Use for Therapy or Prophylaxis
[00347] Certain antibodies provided herein can be used for the treatment or prevention of any disease or condition deemed suitable to the practitioner of skill in the art. Generally, a method of treatment or prevention encompasses the administration of a therapeutically or prophylactically effective amount of the antibody or antibody composition to a subject in need thereof to treat or prevent the disease or condition.
[00348] A therapeutically effective amount of the antibody or composition is an amount that is effective to reduce the severity, the duration and/or the symptoms of a particular disease or condition. The amount of the antibody or composition that will be therapeutically effective in the prevention, management, treatment and/or amelioration of a particular disease can be determined by standard clinical techniques. The precise amount of the antibody or composition to be administered with depend, in part, on the route of administration, the seriousness of the particular disease or condition, and should be decided according to the judgment of the practitioner and each subject's circumstances.
[00349] In some embodiments, the effective amount of the antibody provided herein is between about 0.025 mg/kg and about 1000 mg/kg body weight of a human subject. In certain embodiments, the antibody is administered to a human subject at an amount of about 1000 mg/kg body weight or less, about 950 mg/kg body weight or less, about 900 mg/kg body weight or less, about 850 mg/kg body weight or less, about 800 mg/kg body weight or less, about 750 mg/kg body weight or less, about 700 mg/kg body weight or less, about 650 mg/kg body weight or less, about 600 mg/kg body weight or less, about 550 mg/kg body weight or less, about 500 mg/kg body weight or less, about 450 mg/kg body weight or less, about 400 mg/kg body weight or less, about 350 mg/kg body weight or less, about 300 mg/kg body weight or less, about 250 mg/kg body weight or less, about 200 mg/kg body weight or less, about 150 mg/kg body weight or less, about 100 mg/kg body weight or less, about 95 mg/kg body weight or less, about 90 mg/kg body weight or less, about 85 mg/kg body weight or less, about 80 mg/kg body weight or less, about 75 mg/kg body weight or less, about 70 mg/kg body weight or less, or about 65 mg/kg body weight or less.
[00350] In some embodiments, the effective amount of antibody provided herein is between about 0.025 mg/kg and about 60 mg/kg body weight of a human subject. In some embodiments, the effective amount of an antibody of the pharmaceutical composition provided herein is about 0.025 mg/kg or less, about 0.05 mg/kg or less, about 0.10 mg/kg or less, about 0.20 mg/kg or less, about 0.40 mg/kg or less, about 0.80 mg/kg or less, about 1.0 mg/kg or less, about 1.5 mg/kg or less, about 3 mg/kg or less, about 5 mg/kg or less, about 10 mg/kg or less, about 15 mg/kg or less, about 20 mg/kg or less, about 25 mg/kg or less, about 30 mg/kg or less, about 35 mg/kg or less, about 40 mg/kg or less, about 45 mg/kg or less, about 50 mg/kg or about 60 mg/kg or less.
[00351] The pharmaceutical composition of the method can be administered using any method known to those skilled in the art. For example, the pharmaceutical composition can be administered intramuscularly, intradermally, intraperitoneally, intravenously,
subcutaneously administration, or any combination thereof. In some embodiments, the pharmaceutical composition is administered subcutaneously. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intramuscularly. Methods of Use for Detection or Diagnosis
[00352] The antibodies provided herein can be used for the detection of any target or for the diagnosis of any disease or condition deemed suitable to the practitioner of skill in the art. The methods encompass detecting the binding of an antibody to a target antigen in the appropriate location, e.g., the appropriate body, tissue, or cell. In the methods, the formation of a complex between the antibody and antigen can be detected by any method known to those of skill in the art. Examples include assays that use secondary reagents for detection, ELISA's and immunoprecipitation and agglutination assays. A detailed description of these assays is, for example, given in Harlow and Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory, New York 1988 555-612, WO96/13590 to Maertens and Stuyver, Zrein et al. (1998) and WO96/29605.
[00353] For in situ diagnosis, the antibody may be administered to a subject by methods known in the art such as, for example, intravenous, intranasal, intraperitoneal, intracerebral, intraarterial injection such that a specific binding between an antibody according to the invention with an eptitopic region on the amyloid protein may occur. The antibody/antigen complex may conveniently be detected through a label attached to the antibody or any other art-known method of detection.
[00354] Further provided herein are kits for detection or diagnosis. Exemplary kits comprise one or more antibodies provided herein along with one or more reagents useful for detecting a complex between the one or more antibodies and their target antigens.
Preparation of Antibodies
[00355] The antibodies described herein can be prepared by any technique apparent to those of skill in the art without limitation. Useful techniques for preparation include in vivo synthesis, for example with modified tRNA and tRNA synthetase, cell-free synthesis, for example with modified tRNA and tRNA synthetase, solid phase polypeptide synthesis and liquid phase polypeptide synthesis. Exemplary techniques are described in this section and in the examples below.
[00356] In certain methods, the antibody is translated and/or transcribed from one or more polynucleotides encoding the polypeptide chains of the antibody. Accordingly, provided herein are polynucleotides capable of encoding the antibodies having one or more non-natural amino acids at site-specific positions in one or more polypeptide chains. In certain embodiments, the polynucleotides comprise a codon not normally associated with an amino acid at the polynucleotide position corresponding to the site-specific polypeptide position for the non-natural amino acid. Examples of such codons include stop codons, 4 bp codons, 5 bp codons, and the like. The reaction mixture typically comprises a tRNA synthetase capable of making tRNAs that complement (suppress) said codon. These suppressor tRNAs are linked to the non-natural amino acids to facilitate their incorporation into the polypeptide at the site of the suppressor codon.
[00357] The antibodies can be prepared by techniques known to those of skill in the art for expressing such polynucleotides to incorporate non-natural amino acids into site specific positions of a polypeptide chain. Such techniques are described, for example, in U.S. Patent No. 7,045,337 and 7,083,970, in U.S. Published Patent Application Nos. US 2008/0317670, US 2009/0093405, US 2010/0093082, US 2010/0098630, US 2008/0085277 and in international patent publication nos. WO 2004/016778 Al and WO 2008/066583 A2, the contents of which are hereby incorporated by reference in their entireties.
[00358] In certain embodiments, an antibody can be prepared in a cell-free reaction mixture comprising at least one orthogonal tRNA aminoacylated with an unnatural amino acid, where the orthogonal tRNA base pairs with a codon that is not normally associated with an amino acid, e.g. a stop codon; a 4 bp codon, etc. The reaction mixture also comprises a tRNA synthetase capable of aminoacylating the orthogonal tRNA with an unnatural amino acid. Usually the orthogonal tRNA synthetase, which is susceptible to degradation by proteases present in bacterial cell extracts, is exogenously synthesized and added to the reaction mix prior to initiation of polypeptide synthesis. The orthogonal tRNA may be synthesized in the bacterial cells from which the cell extract is obtained, may be synthesized de novo during the polypeptide synthesis reaction, or may be exogenously added to the reaction mix.
[00359] In certain embodiments, components that affect unnatural amino acid insertion and protein insertion or folding are optionally added to the reaction mixture. Such
components include elevated concentrations of translation factors to minimize the effect of release factor 1 and 2 and to further optimize orthogonal component concentrations. Protein chaperones (Dsb System of oxidoreductases and isomerases, GroES, GroEL, DNAJ, DNAK, Skp, etc.) may be exogenously added to the reaction mixture or may be overexpressed in the source cells used to prepare the cell extract The reactions may utilize a large scale reactor, small scale, or may be multiplexed to perform a plurality of simultaneous syntheses.
Continuous reactions will use a feed mechanism to introduce a flow of reagents, and may isolate the end-product as part of the process. Batch systems are also of interest, where additional reagents may be introduced to prolong the period of time for active synthesis. A reactor may be run in any mode such as batch, extended batch, semi-batch, semi-continuous, fed-batch and continuous, and which will be selected in accordance with the application purpose. The reactions may be of any volume, either in a small scale, usually at least about 1 μΐ and not more than about 15 μΐ, or in a scaled up reaction, where the reaction volume is at least about 15 μΐ, usually at least about 50 μΐ, more usually at least about 100 μΐ, and may be 500 μΐ, 1000 μΐ, or greater. In principle, reactions may be conducted at any scale as long as sufficient oxygen (or other electron acceptor) is supplied when needed.
[00360] Useful methods for synthesis where at least one unnatural amino acid is introduced into the polypeptide strand during elongation include but are not limited to: (I) addition of exogenous purified orthogonal synthetase, unnatural amino acid, and orthogonal tRNA to the cell-free reaction, (II) addition of exogenous purified orthogonal synthetase and unnatural amino acid to the reaction mixture, but with orthogonal tRNA transcribed during the cell-free reaction, (III) addition of exogenous purified orthogonal synthetase and unnatural amino acid to the reaction mixture, but with orthogonal tRNA synthesized by the cell extract source organism. In certain embodiments, the orthogonal components are driven by regulatable promoters, so that synthesis levels can be controlled although other measures may be used such as controlling the level of the relevant DNA templates by addition or specific digestion.
[00361] In some embodiments, a bacterial cell-free expression system is used to produce protein or peptide variants with non-native amino acids (nnAA). The use of bacterial cell- free extracts for in vitro protein synthesis offers several advantages over conventional in vivo protein expression methods. Cell-free systems can direct most, if not all, of the metabolic resources of the cell towards the exclusive production of one protein. Moreover, the lack of a cell wall and membrane components in vitro is advantageous since it allows for control of the synthesis environment. However, the efficiency of cell-free extracts can be decreased by bacterial proteins that inhibit protein synthesis, either directly or indirectly. Thus, inactivation of undesirable proteins that decrease the efficiency of protein synthesis should increase the yield of desirable proteins in cell-free extracts. For example, the inactivation of proteins that decrease the efficiency of protein synthesis should increase the yield of polypeptides having non-native amino acids incorporated at a defined amino acid residue. The introduction of nnAA into polypeptides is useful for increasing the biological diversity and function of proteins. One approach for producing polypeptides having a nnAA incoroporated at a defined amino acid residue is to use an nnAA, aminoacylated orthogonal CUA containing tRNA for introduction of the nnAA into the nascent polypeptide at an amber (stop) codon during protein translation. However, the incorporation of nnAA at an amber codon can be inhibited by the native bacterial termination complex, which normally recognizes the stop codon and terminates translation. Release Factor 1 (RFl) is a termination complex protein that facilitates the termination of translation by recognizing the amber codon in an mRNA sequence. RFl recognition of the amber stop codon can promote pre-mature truncation products at the site of non-native amino acid incorporation, and thus decreased protein yield. Therefore, attenuating the activity of RFl may increase nnAA incorporation into recombinant proteins.
[00362] It has previously been shown that nnAA incorporation can be increased by attenuating RFl activity in 3 ways: 1) neutralizing antibody inactivation of RFl, 2) genomic knockout of RFl (in an RF2 bolstered strain), and 3) site specific removal of RFl using a strain engineered to express RFl containing a protein tag for removal by affinity
chromatography (Chitin Binding Domain and His Tag). Another method for inactivating RFl comprises introducing proteolytic cleavage sites into the RFl amino acid sequence. The cleavage sites are not accessible to the protease during bacterial cell growth, but are cleaved by the protease when the bacterial cells are lysed to produce cell-free extract. Thus, the yield of full length polypeptides having a nnAA incorporated at an amber codon is increased in bacterial cell extracts expressing such modified RFl variants.
[00363] In some embodiments, in order to produce antibodies comprising a non-natural amino acid, one needs a nucleic acid template. The templates for cell-free protein synthesis can be either mRNA or DNA. The template can comprise sequences for any particular antibody of interest, and may encode a full-length antibody or a fragment of any length thereof. Nucleic acids that serve as protein synthesis templates are optionally derived from a natural source or they can be synthetic or recombinant. For example, DNAs can be recombinant DNAs, e.g., plasmids, viruses or the like.
[00364] In some embodiments, once a nucleic acid template of an antibody is produced, the template is used to synthesize the antibody in a cell-free translation system. For example, the template can be added to a cell lysate under conditions sufficient to translate the template into protein. The cell lysate can be from bacterial cells or eukaryotic cells. The expressed protein can then be purified using methods known in the art, as described below. [00365] In some embodiments, a translation system (e.g., an in vitro protein synthesis system) is used to produce the antibody with one or more nnAAs incorporated therein. An exemplary translation system comprises a cell free extract, cell lysate, or reconstituted translation system, along with the nucleic acid template for synthesis of the desired polypeptide or protein having non-native amino acids at preselected (defined) positions. The reaction mixture will further comprise monomers for the macromolecule to be synthesized, e.g. amino acids, nucleotides, etc., and such co-factors, enzymes and other reagents that are necessary for the synthesis, e.g. ribosomes, tRNA, polymerases, transcriptional factors, etc. In addition to the above components such as a cell-free extract, nucleic acid template, and amino acids, materials specifically required for protein synthesis may be added to the reaction. The materials include salts, folinic acid, cyclic AMP, inhibitors for protein or nucleic acid degrading enzymes, inhibitors or regulators of protein synthesis, adjusters of oxidation/reduction potentials, non-denaturing surfactants, buffer components, spermine, spermidine, putrescine, etc. Various cell-free synthesis reaction systems are well known in the art. See, e.g., Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng. 66: 180-8 (1999); Kim, D.M. and Swartz, J.R. Biotechnol. Prog. 16:385-90 (2000); Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng. 74:309-16 (2001); Swartz et al, Methods MoL Biol. 267: 169-82 (2004); Kim, D.M. and Swartz, J.R. Biotechnol. Bioeng. 85: 122-29 (2004); Jewett, M.C. and Swartz, J.R., Biotechnol. Bioeng. 86: 19-26 (2004); Yin, G. and Swartz, J.R., Biotechnol. Bioeng. 86: 188-95 (2004); Jewett, M.C. and Swartz, J.R., Biotechnol. Bioeng. 87:465-72 (2004); Voloshin, A.M. and Swartz, J.R., Biotechnol. Bioeng. 91 :516-21 (2005). Additional conditions for the cell-free synthesis of desired polypeptides are described in
WO2010/081110, the contents of which are incorporated by reference herein in its entirety.
[00366] In some embodiments, a DNA template is used to drive in vitro protein synthesis, and RNA polymerase is added to the reaction mixture to provide enhanced transcription of the DNA template. RNA polymerases suitable for use herein include any RNA polymerase that functions in the bacteria from which the bacterial extract is derived. In other
embodiments, an RNA template is used to drive in vitro protein synthesis, and the components of the reaction mixture can be admixed together in any convenient order, but are preferably admixed in an order wherein the RNA template is added last, thereby minimizing potential degradation of the RNA template by nucleases.
[00367] In some embodiments, a cell-free translation system is used to produce the antibody with one or more nnAAs incorporated therein. Cell-free protein synthesis exploits the catalytic power of the cellular machinery. Obtaining maximum protein yields in vitro requires adequate substrate supply, e.g. nucleoside triphosphates and amino acids, a homeostatic environment, catalyst stability, and the removal or avoidance of inhibitory byproducts. The optimization of in vitro synthetic reactions benefits from recreating the in vivo state of a rapidly growing organism. In some embodiments of the invention, cell-free synthesis is therefore performed in a reaction where oxidative phosphorylation is activated. Additional details are described in United States Patent No. 7,338,789, the contents of which are incorporated by reference herein in its entirety.
[00368] In vitro, or cell-free, protein synthesis offers several advantages over conventional in vivo protein expression methods. Cell-free systems can direct most, if not all, of the metabolic resources of the cell towards the exclusive production of one protein. Moreover, the lack of a cell wall and membrane components in vitro is advantageous since it allows for control of the synthesis environment. For example, tRNA levels can be changed to reflect the codon usage of genes being expressed. The redox potential, pH, or ionic strength can also be altered with greater flexibility than with in vivo protein synthesis because concerns of cell growth or viability do not exist. Furthermore, direct recovery of purified, properly folded protein products can be easily achieved. In some embodiments, the productivity of cell-free systems has improved over 2-orders of magnitude in recent years, from about 5 μg/ml-hr to about 500
[00369] In certain embodiments, tRNA synthetase is exogenously synthesized and added to the cell-free reaction mix. In certain embodiments, the reaction mix is prepared from bacterial cells in which ompT has been inactivated or is naturally inactive. OmpT is believed to degrade components of the reaction mixture including tRNA synthetase.
[00370] In addition to the above components such as cell-free extract, genetic template, and amino acids, materials specifically required for protein synthesis may be added to the reaction. These materials include salts, folinic acid, cyclic AMP, inhibitors for protein or nucleic acid degrading enzymes, inhibitors or regulators of protein synthesis, adjusters of oxidation/reduction potential(s), non-denaturing surfactants, buffer components, spermine, spermidine, putrescine, etc.
[00371] The salts preferably include potassium, magnesium, and ammonium salts {e.g. of acetic acid or glutamic acid). One or more of such salts may have an alternative amino acid as a counter anion. There is an interdependence among ionic species for optimal concentration. These ionic species are typically optimized with regard to protein production. When changing the concentration of a particular component of the reaction medium, that of another component may be changed accordingly. For example, the concentrations of several components such as nucleotides and energy source compounds may be simultaneously adjusted in accordance with the change in those of other components. Also, the concentration levels of components in the reactor may be varied over time. The adjuster of
oxidation/reduction potential may be dithiothreitol, ascorbic acid, glutathione and/or their oxidized forms.
[00372] In certain embodiments, the reaction can proceed in a dialysis mode, in a diafiltration batch mode, in a fed-batch mode of in a semi-continuous operation mode. In certain embodiments, a feed solution can be supplied to the reactor through a membrane or through an injection unit. Synthesized antibody can accumulate in the reactor followed by isolation or purification after completion of the system operation. Vesicles containing the antibody may also be continuously isolated, for example by affinity adsorption from the reaction mixture either in situ or in a circulation loop as the reaction fluid is pumped past the adsorption matrix.
[00373] During protein synthesis in the reactor, the protein isolating means for selectively isolating the desired protein may include a unit packed with particles coated with antibody molecules or other molecules for adsorbing the synthesized, desired protein. Preferably, the protein isolating means comprises two columns for alternating use.
[00374] The resulting antibody can be purified or isolated by standard techniques.
Exemplary techniques are provided in the examples below.
Assay Methods
[00375] Antibodies can be assayed for their expected activity, or for a new activity, according to any assay apparent to those of skill in the art. The resulting antibody can be assayed activity in a functional assay or by quantitating the amount of protein present in a non-functional assay, e.g. immunostaining, ELISA, quantitation on Coomasie or silver stained gel, etc., and determining the ratio of biologically active protein to total protein.
[00376] The amount of protein produced in a translation reaction can be measured in various fashions. One method relies on the availability of an assay which measures the activity of the particular protein being translated. An example of an assay for measuring protein activity is a luciferase assay system, or chloramphenical acetyl transferase assay system. These assays measure the amount of functionally active protein produced from the translation reaction. Activity assays will not measure full length protein that is inactive due to improper protein folding or lack of other post translational modifications necessary for protein activity.
[00377] Another method of measuring the amount of protein produced in coupled in vitro transcription and translation reactions is to perform the reactions using a known quantity of radiolabeled amino acid such as 35S-methionine, 3H-leucine or 14C-leucine and subsequently measuring the amount of radiolabeled amino acid incorporated into the newly translated protein. Incorporation assays will measure the amount of radiolabeled amino acids in all proteins produced in an in vitro translation reaction including truncated protein products. The radiolabeled protein may be further separated on a protein gel, and by autoradiography confirmed that the product is the proper size and that secondary protein products have not been produced.
EXAMPLES
[00378] As used herein, the symbols and conventions used in these processes, schemes and examples, regardless of whether a particular abbreviation is specifically defined, are consistent with those used in the contemporary scientific literature, for example, the Journal of Biological Chemistry.
[00379] For all of the following examples, standard work-up and purification methods known to those skilled in the art can be utilized. Unless otherwise indicated, all temperatures are expressed in °C (degrees Centigrade). All methods are conducted at room temperature unless otherwise noted.
Example 1
Synthesis of Exemplary Antibodies Containing Non-Natural Amino Acids
and Conjugation to an Exemplary Cytotoxic Agent
[00380] The following example describes exemplary antibodies containing non-natural amino acids at defined positions along with methods of their construction and expression. The antibodies were assessed for expression, suppression efficiency, efficiency of conjugation with a cell-killing agent, cell binding, and cell killing, as set forth below. In this example, the exemplary antibodies are based on parent antibody trastuzumab (U.S. Patent Nos. 6,165,464 and 2006/0018899 Al; Carter et al, 1992, Proc. Natl. Acad. Sci. USA
10:4285-4289).
[00381] First, constructs were made incorporating a TAG amber codon at a defined position in the heavy chain of trastuzumab. Site directed mutagenesis was performed using a pYD plasmid containing the coding region of trastuzumab with a C-terminal-(His)6 tag (SD02005) as DNA template and synthetic oligonucleotides (Eurofms MWS Operon;
Huntsville, AL) containing mutations of interest in both sense and antisense directions.
Oligonucleotides of each mutation were added to the DNA template and PHUSION® polymerase (New England Biolabs; Ipswich, MA) to a final volume of 20 μ The final concentration of each component was 0.16 μΜ of each oligonucleotide, 0.5 ng/μΕ template DNA, 0.02 υ/μΐ. PHUSION® polymerase in HF buffer containing 1.5 mM MgCl2 and 200 μΜ dNTP. Mixture was incubated at 98°C 5m, 18 PCR cycles ( 98°C 30s, 55 °C 1 min, 72°C 4 min), 10 min at 72°C and stored at 4°C. Dpnl (New England Biolabs; Ipswich, MA) was added to the mixture to final concentration of 0.6 υ/μί and incubated for 37°C lh to digest parent DNA.
[00382] 5 μΐ^ of each mixture was then transformed into 50 μΐ^ οΐ chemically competent E. coli cells with a MultiShot™ 96- Well Plate TOP 10 according to the manufacturer's procedure (Invitrogen; Carlsbad, CA). Transformed cells were recovered in 200 μΐ, SOC (Invitrogen; Carlsbad, CA) at 37°C for 1 hr and plated onto Luria-Bertani (LB) agar supplemented with 50 μg/mL kanamycin (Teknova; Hollister, CA). After 24 hrs at 37°C, colonies were picked into 200 μΐ, LB with 7.5% glycerol and 50 μg/mL kanamycin, and grown at 37°C for 24 hrs. 20 μί of culture was used for rolling circle amplification (RCA) and sequenced by primer extension using T7 (5'TAATACGACTCACTATAGG 3') and T7 term (5 'GCTAGTTATTGCTCAGCG3 ') primers. Sequence was analyzed using
SEQUENCHER® software (Gene Codes Corp; Ann Arbor, MI), and clones containing mutations were picked and arrayed into 96 well plates. Overnight cultures of selected variants were grown and used for preparing plasmid DNA using the standard 96 well mini-prep protocol according to the manufacturer (Qiagen; Germantown, MD). Concentration of mini- prepped DNA was measured using absorbance at 260 nm (and 280 nm).
[00383] The variants were then expressed in a cell-free protein synthesis reaction as follows as described in Zawada et al., 2011, Biotechnol. Bioeng.108(7)1570-1578 with the modifications described below. Unsubstituted trastuzumab was also made as a control. Cell- free extracts were treated with 50 μΜ iodoacetamide for 30 min at RT (20°C) and added to a premix containing all other components except for heavy chain DNA from variants of interest. Cell free reactions were initiated by addition of plasmid DNA of heavy chain DNA variants and incubated at 30°C for 12h on a shaker at 450 rpm in 96 deep well plates. The reaction was incubated further at 4°C for 5h. The final concentration in the protein synthesis reaction was 30% cell extract, 1 mM para-azido phenylalanine (pAzF) (RSP Amino Acids), 0.125 mg/mL Mjannaschii amber suppressor tRNA, 0.37 mg/mL Mjannaschii pAzF- specific amino-acyl tRNA synthetase (FRS), 2 mM GSSG, 0.29 mg/mL PDI (Mclab), 100 μg/mL E. coli DsbC, 8 mM magnesium glutamate, 10 mM ammonium glutamate, 130 mM potassium glutamate, 35 mM sodium pyruvate, 1.2 mM AMP, 0.86 mM each of GMP, UMP, and CMP, 2 mM amino acids (except 0.5 mM for Tyrosine and Phenylalanine), 4 mM sodium oxalate, 1 mM putrescine, 1.5 mM spermidine, 15 mM potassium phosphate, 100 nM T7 RNAP, 2 μg/mL trastuzumab light chain DNA, 8 μg/mL trastuzumab-(His)6 heavy chain DNA. Each trastuzamab variant was produced in 1 mL scale in 96 deep well plates in duplicates. A total of three plates were used to express the variants, each compared to expression of an unsubstituted trastuzumab to normalize for expression across the plates. It should be noted that all trastuzumab variants thus produced were aglycosylated.
[00384] To monitor protein synthesis, a portion of each cell-free protein synthesis reaction was removed and spiked with 3.33% (v/v) l-[U-14C]-leucine (300 mCi/mmole; GE Life Sciences, Piscataway, NJ). The suppression of amber codon at different sites of the heavy chain was determined by [14C]-autoradiograhy of reducing SDS-PAGE gels. Full length trastuzumab heavy chain and suppressed tastuzumab heavy chain variants run at 50 kD on SDS-PAGE. Non suppressed (truncated) trastuzumab variants run at a lower molecular weight. Amber suppression in the heavy chain is determined by:
band intensity of suppressed heavy chain TAG variant suppression = ; ; — ; ;
band intensity of wild type heavy chain
[00385] Band intensity was determined by ImageQuant (Amersham Biosciences Corp.; Piscataway, NJ). It should be noted that this 14C gel assay cannot be used to assess suppressions for TAG variants of heavy chain from the position of 425 (EU index
numbering) to C terminus since the truncated variants cannot be distinguished from the full length product.
[00386] Following synthesis, each 1 mL reaction was diluted with 1 mL PBS at pH7.4.
The mixture was centrifuged at 5000x g 4°C for 15 min. Supernatant was captured with IMAC Phytip containing 40μί resin (PhyNexus, Inc.; San Jose, CA) by pipetting up and down 4 times slowly at a flow rate of 4.2 μΐ/min. Resin was washed with 925 IMAC binding buffer (50 mM Tris pH 8.0, 300mM NaCl, 10 mM imidazole) by pipetting up and down twice at a flow rate of 8.3 μί/ηιίη. This process was repeated once with an additional 925 μΐ, IMAC binding buffer. Bound protein was eluted with 250 μΐ, IMAC elution buffer (50 mM Tris pH 8.0, 300mM NaCl, 500 mM Imidazole) by pipetting up and down 4 times at a flow rate of 4.2 μΕ/ηώι. As the (his)6 tag of the construct is C-terminal, this procedure allows isolation of full length protein. To quantitate the variants following purification, IMAC purified samples were mixed with 2x gel loading buffer (Bio-Rad# 161-0737) resolved by of 4-15% Stain-Free™ gel (Bio-Rad Criterion™ TGX #567-8085). Samples were not heated before loading into wells of the gel. Protein bands were visualized and quantitated by Bio-Rad Gel Doc EZ System using Image Lab software (v3). Band intensities of samples were determined based on mass standards of HERCEPTIN® loaded on the same gel.
[00387] Next, the trastuzumab variants were conjugated to an exemplary cytotoxic agent, MMAF, using a constrained cyclooctyne reagent. In brief, DBCO-MMAF (structure shown as Figure 1; ACME Bioscience; Palo Alto, CA) was dissolved in DMSO to a final concentration of 5 mM. The compound was diluted into with PBS to 1 mM and then added to trastuzumab-(His)6 variants in IMAC elution buffer to final drug concentration of 100 μΜ. Mixture was incubated at RT (20°C) for 17 hours. Reaction was stopped by adding Sodium Azide to final concentration of 100 mM and buffer exchanged using Zeba plates (Thermo Scientific; Waltham, MA) equilibrated in IX PBS. Filtrate was then passed through a MUSTANG® Q plate (Pall Corp.; Port Washington, NY) to remove endotoxin.
Example 2
Characterization of Exemplary Antibody-Drug Conjugates
[00388] Hydrophobic Interaction Chromatography (HIC) was performed to quantitate the samples and to determine the drug-antibody ratios of the trastuzumab variant drug conjugates as follows. Samples and standards were diluted 1 :2 in 3M Ammonium Sulfate (EMD Chemical), 50mM Sodium Phosphate pH 7.0 (Mallinckrodt) prepared in MilliQ water. An Agilent 1100 binary pump HPLC system was equipped with a Tosoh Bioscience LLC TSK- gel Butyl-NPR® (4.6mm x 3.5cm) column with a column compartment temperature of 30°C. The mobile phase A was 1.5M Ammonium Sulfate, 50mM Sodium Phosphate, pH 7.0. The mobile phase B was 50mM Sodium Phosphate, pH 7.0 in 80:20 water :Isopropyl Alcohol (Honeywell). The mobile phase was delivered at a flow rate of 1.0 mL/minute. The separation was performed with a linear gradient of 15% mobile phase B to 100% mobile phase B in 10 minutes. The UV data was acquired at both 210 and 280nm. The peak areas were quantitated using Chemstation software (Agilent) and the Drug Antibody Ratio (DAR) was calculated from the percent of the total peak area.
[00389] To assess binding of the conjugated trastuzumab variants, a binding assay to cells expressing HER2 was performed as follows. The binding of the purified conjugated variants to HER2 on SKBR3 cells, which overexpress the HER2/c-erb-2 gene product, with over 1.5 million receptor copies per cell (ATCC # HTB-30, Manassas, VA) was compared to clinical grade Herceptin®, unglycosylated trastuzumab produced by cell-free protein synthesis, or human serum IgGl as a negative control (Sigma-Aldrich; St. Louis, MO). SKBR3 cells were cultured in DMEM:Ham's F-12 (50:50), high glucose (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum (Hyclone; Thermo Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASE™ (Hyclone; Thermo Scientific; Waltham, MA). A total of 200,000 cells per sample in total volume of 10 were incubated with serial dilutions of either conjugated trastuzumab variant, clinical grade HERCEPTIN®, or aglycosylated trastuzumab made in Ι ΟμΙ^ FACS buffer (DPBS buffer supplemented with 1%> bovine serum albumin). Cells plus antibody or ADC were incubated for 60 minutes on ice. Unstained cells, human IgGl (Isotype control) and Secondary antibody (goat anti-human IgG) were used as controls. Cells were washed twice with ice-cold FACS buffer and incubated with either 5 μg/ml Alexa 647 labeled goat anti-human IgG secondary antibody (Invitrogen; Carlsbad, CA) on ice for 1 hour. All samples were washed using FACS buffer and analyzed using a BD FACS Calibur system (BD Biosciences; San Jose, CA).
[00390] Mean fluorescence intensities were fitted using non-linear regression analysis with one site specific binding equation using GraphPad Prism (GraphPad v 5.00, Software; San Diego, CA). Data was expressed as Relative MFI vs. concentration of antibody or antibody variant in μg/ml. [00391] Next, the effects of the conjugated trastuzumab on cell killing were measured with a cell proliferation assay as follows. SKBR3 and MDA-MB-468 were obtained from ATCC and maintained in DMEM:Ham's F-12 (50:50), high glucose (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum (Hyclone; Thermo
Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx
Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASE™ (Hyclone; Thermo Scientific; Waltham, MA). A total of 103 cells were seeded in a volume of 40 μΐ in a 96-well half area flat bottom white Polystyrene plate. The cells were allowed to adhere overnight at 37°C in a C02 incubator. ADC variants were formulated at 2x concentration in DMEM/F12 medium and filtered through MultiScreen HTS 96- Well Filter Plates (Millipore; Billerica, MA). Filter sterilized conjugated trastuzumab variants, HERCEPTIN, or aglycoslyated trastuzumab were added into treatment wells and plates were cultured at 37°C in a C02 incubator for 120hrs. For cell viability measurement, 80μ1 of Cell Titer-Glo reagent (Promega Corp.; Madison, WI) was added into each well, and plates processed as per product instructions. Relative luminescence was measured on an ENVISION® plate reader (Perkin-Elmer; Waltham, MA). Relative luminescence readings were converted to % viability using untreated cells as controls. Data was fitted with nonlinear regression analysis, using log(inhibitor) vs. response -Variable slope, 4 parameter fit equation using GraphPad Prism (GraphPad v 5.00, Software; San Diego, CA). Data was expressed as relative cell viability, ATP content % vs. dose of ADC in μg/ml.
[00392] Positive results of these characterization experiments are presented in Tables 1, 2, and 3 (plates 1, 2, and 3, respectively). In the Tables, the following properties of the variants are shown: the rank order and concentration of protein made, the efficiency of expression of full length product compared to wild-type (suppression efficiency), ability to bind HER2- expressing cells, drug-antibody ratio (expressed as the number of cytotoxic agents per antibody), a comment regarding the HIC profile, and the observed IC50 from the cell-killing assay described above. In the comments regarding the HIC assay, Single Peak corresponds to a profile that resolved well as a single peak (an example of such a profile is shown as Figure 2), NWR corresponds to a poorly resolved profile (an example of such a profile is shown as Figure 3), and WR corresponds to a well-resolved HIC profile (an example of such a profile is shown as Figure 4). Several of the variants that exhibited a single peak profile also exhibited potent killing, which indicates that the variant was indeed conjugated with drug, but failed to resolve on the HIC column.
[00393] In general, preferred variants exhibit an IC50 of about 20 ng/ml or below, even more preferably below about 10 ng/ml, and even more preferably below about 5 ng/ml.
Preferably, the variants are in the top 50% of expression, and even more preferably, are in the top 25% of expression. Variants that have a DAR of at least about 1.0 are also preferred. Preferred variants include those with a non-natural amino acid replacing positions V005, A023, G042, G065, S074, A084, Al 18, SI 19, S132, S134, T135, S136, G137, G138, T139, T155, S160, A162, S165, A172, L174, S176, S177, S191, G194, S219, P238, S239, F241, F243, K246, E356, M358, K360, V262, V264, D265, S267, H268, E269, D270, P271, E272, K274, F275, Y278,D280, G281, V282, E283, N286, T289, R292, E293, E294, Q295, Y296, N297, S298, T299,Y300, R301, V303, V305, K317, K320, S324, K326, A327, P329, A330, 1332, E333, K334, T335, S337, A339, R344, R355, T359, L398, S375, S383, N384, Q386, N389, K392, G420, K340, Q342, F404, Q438, N421, and Y436. Even more preferred were variants including those with a non-natural amino acid replacing positions V005, A023, S074, A084, A118, S119, S132, S134, T135, S136, G137, T139, S160, A162, S165, A172, S191, G194, S239, F241, K246, S267, H268, E269, D270, P271, E272, K274, F275, D280, G281, V282, E283, N286, T289, R292, E293, E294, Q295, Y296, N297, S298, T299,Y300, R301, V303, V305, K317, K320, S324, K326, A327, P329, A330, 1332, E333, K334, T335, S337, A339, R344, R355, T359, L398, S375, Q386, N389, K392, G420, K340, Q342, Q438, and N421. Still more preferred were variants including those with a non-natural amino acid replacing positions V005, A023, A084, Al 18, SI 19, S132, S134, S136, G137, S160, A162, A172, S239, F241, S267, E269, D270, P271, E272, V282, N286, R292, E293, Y296, S298, P329, A330, K334, T335, K340, R355, T359, Q386, N389, F404, G420, N421, Q438, and Q342. Variants with a non-natural amino acid replacing positions V005, A084, Al 18, S132, S136, S239, E293, K334, R355, Q342, T359, and N389 were identified as particularly preferred.
[00394] It was also noted that the expression, suppression efficiency, conjugation efficiency, cell-binding, and cell killing were not predictable based on the published crystal structure of Fc. For example, E293 and K334 would not be predicted to accept substitution with an aromatic phenylalanine derivative based on their positions within the Fc structure, yet both express well and are potent killers, with IC50 values of 2.7 and 3.0 ng/ml, respectively. Conversely, S131 was predicted to be an excellent position for conjugation based on its availability on the surface of the heavy chain, yet derivatives with substitutions in this position were poor conjugators (DAR of 0.65) and poor killers (IC50 of 27.1 ng/mL). Thus, it was concluded that experimentation was required to identify optimal sites for expression, suppression, conjugation, and cell killing.
[00395] It should also be noted that sites near the N-linked glycosylation site of trastuzumab, N297, were found to be well-suited for conjugation. In particular, sites from R292 through R301, V303 and V305 were found to exhibit desirable cell-killing and/or conjugation properties. It was possible to assess these sites because of the aglycosylated form of the trastuzumab variants produced in the cell-free protein synthesis reaction as described above.
Table 1
14C ic5„
IMAC CFPS SKBR3 expression 14C Suppression Cell HIC
Variant gel DAR cell rank efficiency Binding Profile
μg/mL μg/mL killing order
(ng/ml)
S136 151 77 35% + 1.54 W 7.9
Single
S239 161 2 126 57% + ND 5.2
Peak
A118 156 7 105 48% + 1.51 WR 6.5
+ Single
K246 162 18 75 34% ND 6.6
Peak
S119 191 6 109 50% + 1.41 7.4
S132 307 1 158 72% + 1.58 WR 8
A162 145 17 77 35% + 1.38 NWR 8
V005 186 3 124 56% + 0.99 NWR 11.5
S191 183 4 114 52% + 0.68 WR 13.9
S074 177 9 96 44% + 0.78 NWR 9.9
T135 151 8 96 44% + 1.03 NWR 10.1
A084 150 5 114 52% + 1.28 WR 9
G194 145 11 89 40% + 1.1 WR 10.8
T139 138 24 55 25% + 1 WR 9.6
A172 130 21 64 29% + 1.3 NWR 12.5
S134 124 16 80 36% + 1.37 WR 8.9
G137 112 15 83 38% + 1.23 WR 9.3
A023 110 19 70 32% + 1.33 NWR 9.8
S165 103 20 68 31% + 1.04 NWR 9.5
ngle
F241 99 13 87 39% + Si
ND 8.4
Peak
S160 96 14 86 39% + 1.34 WR 10
P238 93 22 60 27% + 0.47 NWR 12.9 14C ic5„
IMAC CFPS SKBR3 expression ppression Cell HIC
Variant 14C Su
gel DAR cell rank efficiency Binding Profile
μg/mL μg/mL killing order
(ng/ml)
T155 89 10 95 43% + 1.19 W 10.5
Single
V264 88 32 29 13% + ND 10.5
Peak
S176 74 31 38 17% + 0.82 NWR 12.4
G138 72 29 43 20% + 1.16 WR 11.2
G065 68 30 40 18% + ND NWR 9.6
G042 68 26 49 22% + 1.12 NWR 13.8
F243 67 22 60 27% + 0.12 NWR 10.4
V262 47 36 18 8% shifted rt ND NWR 8.2
Single
D265 56 38 13 6% + ND 9
Peak
L174 52 28 43 20% + 1.07 NWR 12.8
S219 26 27 45 20% + 1.18 NWR 13.6
S131 76 25 49 22% 0.65 27.1
G161 43 33 26 12% 0.97 NWR 87.7
T164 17 35 22 10% 0.68 NWR 17.5
T195 26 39 14 6% 1.1 NWR
S177 23 34 24 11% + 0.68 NWR 13.6
Table 2
14C
ic5„
IMAC CFPS
expression Suppression HIC Cell
Variant 14C
Gel Binding DAR
rank Efficiency Profile Killing (ug/ml) μg/mL
order (ng/ml)
E293 147.6 9 50.7 19% + 1.5 WR 2.7
Single
K334 135.7 3 72.5 28% + 0.12 3
Peak
E269 91.2 24 25.3 10% + 1.21 WR 1.4
S298 76.9 34 10.6 4% + 1.17 NWR 1.9
Single
R292 160.9 7 54.8 21% + ND Peak with 2.4 sh
E272 111.2 19 32.2 12% + 1.05 WR 3
V282 117.4 15 39.7 15% + 0.62 NWR 3.1
Single
Y296 142.7 14 39.9 15% + ND 3.5
Peak ngle
D270 122.6 12 43.8 17% + Si
ND 3.9
Peak
N286 89.8 20 31.1 12% + 0.71 NWR 4
E333 96.1 8 52.6 20% + 0.55 NWR 5
S324 88.5 5 59.7 23% + 0.3 NWR 5.8
H268 140.2 4 67.6 26% + 0.46 NWR 7.9 14C
IMAC CFPS ic5„ expression 14C Suppression HIC Cell
Variant Gel Binding DAR
rank Efficiency Profile Killing (ug/ml) μg/mL
order (ng/ml)
T289 128.2 11 44 17% + 0.26 NWR 8.2
F275 97.3 13 42.4 16% + 0.24 NWR 9
1332 98.1 6 54.9 21% + 0.88 NWR 10
T335 123.7 2 82.4 32% + 0.33 NWR 11.2
P329 61.4 16 36.9 14% + 1.05 NWR 3.6
P271 78.2 18 32.3 12% + 1.05 WR 4.4
A330 63.6 10 44.7 17% + 1.51 NWR 4.5
Y300 124.0 27 17.4 7% + 0.13 NWR 4.8
S267 22.1 29 12.4 5% + 1.57 NWR 5.1
A327 38.0 22 26.3 10% + 0.69 NWR 5.2
G281 31.0 32 11.5 4% + 0.27 NWR 5.2
V305 42.8 35 10.2 4% + 0.06 NWR 5.5
N297 34.0 37 7.8 3% + 0.09 NWR 6.5
Single
Q295 35.6 28 14.2 5% + ND 6.8
Peak
Single
R301 41.8 39 6 2% + ND 7.8
Peak
E294 27.9 30 12 5% + 0.65 NWR 8.3
E283 32.1 31 11.7 4% + 0.24 NWR 8.7 ingle
D280 18.0 36 10.1 4% + S
ND 8.8
NWR
K326 35.0 25 24.1 9% + 0.54 NWR 9
K317 38.0 33 11.4 4% + 0.22 NWR 9.5
K274 36.3 26 19.3 7% + 0.45 WR 10.2
T299 20.4 40 4.5 2% + ND NWR 10.3
V303 93.6 21 29 11% + 0.01 NWR 11.1
K320 13.5 38 7.1 3% + 0.93 NWR 11.9
Y278 181.6 1 94 36% + ND WR 22.5
Table 3
14C
IMAC CFPS Suppressi ic5„
HIC cell
Variant C
gel expression 14 on Binding DAR
Profile killing μg/mL rank order μg/mL Efficiency
(ng/ml)
R355 86 7 36 21% + 1.14 WR 13.8
T359 84 4 39 23% + 1.13 WR 7.5
N389 63 6 37 22% + 1.54 WR 9.7
Unresolv
S337 56 5 39 23% + ND 6.9 ed
Unresolv
A339 94 2 45 26% + ND 7.7 ed 14C ic5„
IMAC CFPS Suppressi
n 14C HIC cell
Variant gel expressio on Binding DAR
Profile killing μg/mL rank order μg/mL Efficiency
(ng/ml)
Single
L398 49 11 24 14% + ND 9.4
Peak
Q438 56 36 ND ND + 1.46 WR 10
N421 27 15 18 11% + 1.35 WR 10.5
Single
S375 68 8 27 16% + ND 12.3
Peak
344 52 14 20 12% + 1.13 WR 16.7
G420 19 18 15 9% + 1.34 WR 9.4
Low
K340 20 20 12 7% + 1.49 12.9
Signal
Q386 9 19 13 8% + 1.49 NWR 16.9
K392 11 34 2 1% + 1 NWR 18
S383 39 13 23 13% + 0.72 WR 21.3
M358 25 16 16 10% + 0.93 21.6
E356 44 10 25 14% + 0.66 WR 27
K360 55 12 23 14% + 0.42 WR 31.2
Low
Y436 22 35 ND ND + 0.6 32.6
Signal
N384 127 1 69 40% + 0.25 WR 34.9
Low
Q342 6.5 30 4.5 3% + 1.59 35.1
Signal
Example 3
Fidelity of Incorporation of a Non-Natural Amino Acid in an
Exemplary Antibody-Drug Conjugate
[00396] This Example describes an evaluation of the fidelity of incorporation of a non- natural amino acid in an exemplary antibody-drug conjugate. Trastuzumab substituted with p-azido-phenylalanine substituted at SI 36 conjugated with DBCO-MMAF was digested with trypsin and analyzed on an Agilent 6520 Accurate Mass Q-TOF LC-MS system equipped with a nano-electrospray ChipCube source. Peptides containing potential misincorporated amino acids and their wild-type counter parts were searched using extracted ion
chromatograms from the LC-MS data within ±10 ppm of the theoretical m/z for the z=l-4 charge states of the peptide. If the m/z of the found peak were within ±10 ppm of the theoretical m/z and the correct charge state they were considered to be potential matches until MS/MS verification. In the absence of signal from misincorporation, the signal was assumed to be equal or less than the noise in the mass spectrum. The minimum fidelity rate was calculated as a noise to signal ratio. The signal was measured as the average of all monoisotopic ions across the peptide's elution profile for the most abundant charge state and the noise was estimated in the same spectrum in a region adjacent to the exhibiting a minimum amount of signal. Where an observed peptide contained a misincorporation event was found, its averaged signal was used in place of the noise measurement.
[00397] In the peptide map of the tested antibody-drug conjugate, peptide with nnAA + conjugated drug was detected at charge states 2 and 3 with an error of less than 4 ppm. At position 136, no tyrosine incorporation was present and the incorporation efficacy for pAzPhe was determined to be 98.3 %. No tyrosine misincorporation was detected at the Phe positions across the detected IgG sequence. The overall, incorporation efficiency for Phe was measured to be at minimum 99.7 %.
Example 4
Assessment of the Thermal Stability of Exemplary Antibody-Drug Conjugates
[00398] This example describes experiments designed to measure the thermal stability (Tm) of aglycosylated trastuzumab and trastuzumab variants. The thermal shift assay was carried out by mixing the protein to be assayed (Sutroceptin and variants) with an
environmentally sensitive dye (SYPRO Orange, Life Technologies Cat #S-6650) in a buffered solution (PBS), and monitoring the fluorescence of the mixture in real time as it undergoes controlled thermal denaturation. The final concentration of the protein in the assay mixture was between 100-250 μg/mL, and the dye was 1 : 1000 diluted from the original stock (Stock dye is 5000x in DMSO). After dispensing 5 μΙ_, aliquots of the protein-dye mixture in a 384-well microplate (Bio-Rad Cat #MSP-3852), the plate was sealed with an optically clear sealing film (Bio-Rad Cat #MSB-1001), and placed in a 384-well plate real-time
thermocycler (Bio-Rad CFX384 Real Time System). The protein-dye mixture was heated from 25°C to 95°C, at increments of 0.1°C per cycle (~1.5°C per minute), allowing 3 seconds of equilibration at each temperature before taking a fluorescence measurement. At the end of the experiment, the melting temperature (Tm) was determined using the Bio-Rad CFX manager software. For protein samples with complex thermal transition profiles, the melting temperature (Tm) is calculated from the negative first-order derivative plot of fluorescence intensity (Y-axis) against temperature (X-axis), or by fitting the data to the Boltzmann sigmoidal model. The difference in melting temperature of IgG variants compared to the wild-type protein is a measure of the thermal shift for the protein being assayed. [00399] The results of this assay for certain variants are shown in Table 4. In general, deflections in Tm significantly below unsubstituted trastuzumab, particularly in Tml, indicate an undesirable loss of stability and/or a propensity to aggregate. As such, trastuzumab variants that exhibit a Tml and/or Tm2 within about 5°C of unsubstituted trastuzumab are preferred. More preferred are those variants that exhibit a Tml and/or Tm2 within about 3°C of unsubstituted trastuzumab. Still more preferred are those variants that exhibit a Tml and/or Tm2 within about 2°C of unsubstituted trastuzumab. Still more preferred are those variants that exhibit a Tml and/or Tm2 within about 1°C of unsubstituted trastuzumab. The Tml and Tm2 can be measured in the unconjugated or conjugated forms.
Table 4
Antibody or
Trastuzumab
Antibody-Drug Tml (°C) Tm2 (°C)
Variant
Conjugate
Aglycosylated
Antibody 63.5 +/- 0.6 76.5 +/- 0.1
trastuzumab
Antibody T359 64.0 +/- 0.4 76.8 +/- 0.0
Antibody E293 59.7 +/- 0.7 76.1 +/- 0.1
Antibody K334 49.5 +/- 0.8 76.5 +/- 0.1
Antibody 355 63.6 +/- 0.4 76.8 +/- 0.1
Antibody N389 62.8 +/- 0.1 76.8 +/- 0.0
Antibody-Drug
T359 63.9 +/- 0.6 76.7 +/- 0.1
conjugate
Antibody-Drug
E293 59.2 +/- 0.0 76.0 +/- 0.3
conjugate
Antibody-Drug
K334 59.0 +/- 0.2 76.3 +/- 0.2
conjugate
Antibody-Drug
R355 63.7 +/- 0.4 76.6 +/- 0.1
conjugate
Antibody-Drug
N389 61.9 +/- 0.5 76.4 +/- 0.0
conjugate
Example 5
Characterization of Exemplary Antibody-Drug Conjugates: Light Chain Substitution
[00400] Methods as described in Example 9 were used to create and analyze variants with light chain substitutions. Results of these characterization experiments are presented in
Table 5. Table 5: Selected LC variants
Final Purified SKBR3 Cell Killing
Variant Chain DAR HIC profile
ADC (ug/mL) IC5„ (ng/mL)
A43 LC 67.60 1.44 W 3.73
Y49 LC 123.46 1.86 WR 2.00
S56 LC 97.40 1.78 WR 2.58
G57 LC 89.78 1.66 NWR 3.43
S60 LC 146.77 1.56 NWR 2.63
S67 LC 121.38 1.53 NWR 3.73
G68 LC 55.30 1.35 NWR 2.37
T109 LC 95.58 1.62 WR 2.25
A112 LC 80.50 1.10 WR 1.87
S114 LC 92.86 0.96 WR 2.21
A144 LC 61.74 1.39 WR 2.56
A153 LC 104.07 1.53 WR 3.59
S156 LC 77.65 1.36 WR 1.98
G157 LC 65.25 0.98 WR 3.45
S168 LC 86.99 1.10 WR 4.01
A184 LC 66.15 1.20 WR 4.24
S202 LC 88.17 1.71 NWR 2.56
S203 LC 92.60 1.75 WR 2.46
T206 LC 95.40 0.77 WR 4.93
[00401] Preferred variants include those with a non-natural amino acid replacing these positions of the light chain (LC): A043, Y049, S056, G057, S060, S067, G068, T109, A112, SI 14, A144, A153, S156, G157, S168, A184, S202, S203, and T206.
[00402] Variants that have a DAR of at least about 1.0 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: A043, Y049, S056, G057, S060, S067, G068, T109, A112, A144, A153, S156, S168, A184, S202, and S203.
[00403] Variants that have a DAR of at least about 1.2 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: A043, Y049, S056, G057, S060, S067, G068, T109, A144, A153, S156, A184, S202, and S203.
[00404] Variants that have a DAR of at least about 1.5 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: Y049, S056, G057, S060, S067, T109, A153, S202, and S203. Example 6
Assessment of Expression of HC-F404 in an RF-1 Attenuated Extract
[00405] To initially assess the effects of using an RF-1 attenuated E. coli strain on incorporation of a non-natural amino acid, 12 variants which poorly expressed in the RF-1 positive strain were expressed and scaled up in the RF-1 attenuated strain. One such variant, HC-F404, exhibited exceptionally desirable properties, as discussed below.
[00406] The cell free extract used for this cell free protein synthesis reaction was prepared from an OmpT sensitive RF-1 attenuated E. coli strain which has also been engineered to produce an orthogonal CUA-encoding tRNA for insertion of a non-natural amino acid at an Amber Stop Codon. After addition of DNA template that encodes for HC-F404 and WT LC, the cell free reaction was incubated at 30°C for 12h on a shaker at 650 rpm at a 1ml scale X 6 (for a total of 9 ml) in a Flower plate (m2p-labs # MTP-48-B). The protein was then purified over Protein A and Capto Adhere resin using a Protein Maker (Emerald Bio).
[00407] Conjugation with drug (DBCO-MMAF) and preparation of Antibody Drug Conjugates (ADC's) for further analysis was done as described previously.
[00408] Thermofluor analysis of the variants was carried out as described previously
[00409] HC variant F404 generated both in during TAG scan as well as in the intermediate scale showed good cell-killing capability (TAG Scan I: IC50 = 0.018 nM; Intermediate Scale up: IC50 = 0.023 nM), but DAR estimation on the basis of its HIC profile proved
problematic, due to low resolution of the peaks, possibly due to inaccessibility of the drug to the analytical column during HIC analysis. However, MS analysis showed that it had a DAR of 1.74. Also, thermofluor analysis showed that the ADC version of HC-F404 had an improved (higher thermal stability) Tml (increase of 2.2 °C) compared to the antibody only.
Table 6A: Properties of HC-F404 variant
Figure imgf000156_0001
* - This DAR result is based on LC-MS analysis. The conjugated variant produced a Not- Well-Resolved (NWR) peak on the HIC assay, and DAR was determined using LC-MS
Table 6B: Thermofluor results for HC-F404 variant Antibody Only Antibody-Drug Conjugate
Trastuzumab
Tml (°C) Tm2 (°C) Tml (°C) Tm2 (°C)
Chain Variant
61.2 +/- 76.6 +/-
F404 63.5 +/- 0.4 76.5 +/- 0.1
HC 0.2 0.1
Example 7
Characterization of Exemplary Antibody-Drug Conjugates: Release Factor Analysis
TAG Scan I Methods and List of Selected Variants
[00410] The cell free extract used for cell free protein synthesis reactions were prepared from an OmpT sensitive RF-1 attenuated E. coli strain which has also been engineered to express an orthogonal CUA-encoding tRNA for insertion of a non-natural amino acid at an Amber Stop Codon. After addition of DNA template, cell free reactions were incubated at 30°C for 12h on a shaker at 650 rpm in Flower plates (m2p-labs # MTP-48-B). For synthesis of light chain variants (variants which had nnAA incorporation on the light chain), a DNA ratio of 4 ug/mL of light chain DNA to 8 μg/mL of heavy chain DNA was used. Each trastuzumab variant was produced in 1 mL scale in 48-well flower plates in singlicate. A total of 6 plates were used to express the variants.
[00411] Supernatant was captured with IMAC Phytip containing 40 resin by pipetting up and down 10 times slowly at a flow rate of 4.2 uL/min. Bound protein was eluted with 125 \iL IMAC elution buffer (50 mM Tris pH 8.0, 300 mM NaCl, 500 mM Imidazole). Following purification, IMAC purified variants were quantified on a Caliper GXII system by comparing with by mass standards of HERCEPTIN® run on the same Protein Express LabChip (Caliper LifeSciences # 760499). Samples were prepared for analysis as specified in the Protein Express Reagent Kit (Caliper Life Sciences # 760328) with the exception that the samples (mixed in sample buffer) were heated at 65 °C for 10 minutes prior to analysis on the Caliper system.
[00412] Conjugation with drug (DBCO-MMAF) and preparation of Antibody Drug Conjugates (ADC's) for further analysis was done as described previously.
[00413] Positive results of these characterization experiments are presented in Table 7. In the Table, the following properties of the variants are shown: final concentration of antibody- drug conjugate made, ability to bind HER2-expressing cells, drug-antibody ratio (DAR, expressed as the number of cytotoxic agents per antibody), a comment regarding the HIC profile, and the observed IC5o from the cell-killing assay described previously. In the comments regarding the HIC assay, SP corresponds to a profile that resolved well as a single peak, NWR corresponds to a poorly resolved profile and WR corresponds to a well-resolved HIC profile. Several of the variants that exhibited a single peak profile also exhibited potent killing, which indicates that the variant was indeed conjugated with drug, but failed to resolve on the HIC column.
Table 7: Selected Variants for Tag Scan I
Figure imgf000158_0001
Figure imgf000159_0001
[00414] Preferred variants include those with a non-natural amino acid replacing these positions of the heavy chain (HC): A023, A084, Al l 8, S 1 19, T135, S 136, G137, S 160, G161 , A162, T164, T195, T197, S219, V282, T289, Y296, A330, T335, N361 , S400, F404, V422, S440, T260, S267, H268, E272, K274, R292, E293, N297, S298, V303, V305, 1332, E333, K334, K340, G341 , Q342, P343, R355, Q362, Q386, K392, F404, S424, Q438, S442 and L443.
[00415] Variants that have a DAR of at least about 0.7 are also preferred. Preferred variants include those with a non-natural amino acid replacing these positions of the heavy chain (HC): A023, A084, A1 18, S I 19, T135, S 136, G137, S 160, G161 , A162, T164, T195, T197, S219, V282, Y296, T335, N361 , V422, S440, S267, E272, K274, E293, N297, S298, V303, V305, K334, K340, G341 , Q342, P343, R355, Q362, K392, F404, S424, Q438, S442 and L443.
[00416] Variants that have a DAR of at least about 1.0 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: A023, A084, A1 18, S I 19, T135, S 136, G137, S 160, G161 , A162, T164, T195, T197, S219, V282, Y296, N361 , V422, S440, S267, E272, E293, N297, S298, V303, V305, K334, K340, G341 , Q342, R355, Q362, K392, F404, S424, Q438, S442 and L443.
[00417] Variants that have a DAR of at least about 1.2 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: A023, A084, A1 18, S I 19, T135, S 136, G137, S 160, G161 , A162, T195, T197, S219, V282, Y296, V422, S440, S267, E272, E293, N297, S298, V303, V305, K334, K340, G341 , Q342, R355, K392, F404, S424, Q438, S442 and L443.
[00418] Variants that have a DAR of at least about 1.5 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: A023, A084, A1 18, S I 19, T135, S 136, S 160, A162, T195, S219, V282, Y296, S267, E293, N297, S298, V303, V305, K334, K340, G341 , K392, F404, and Q438.
Example 8
Characterization of Exemplary Antibody-Drug Conjugates: Additional Release Factor
Analysis
TAG Scan II Methods and List of Selected Variants
[00419] The cell free extract used for cell free protein synthesis reactions were prepared from an OmpT sensitive RF-1 attenuated E. coli strain which has also been engineered to produce an orthogonal CUA-encoding tRNA for insertion of a non-natural amino acid (p- azido-phenylalanine) at an Amber Stop Codon. After addition of DNA template, cell free reactions were incubated at 30°C for 12h on a shaker at 650 rpm in Flower plates (m2p-labs # MTP-48-B). For synthesis of light chain variants (variants which had nnAA incorporation on the light chain), a DNA ratio of 4 μg/mL of light chain DNA to 8 μg/mL of heavy chain DNA was used. Each trastuzumab variant was produced in 1 mL scale in 48-well flower plates in singlicate. A total of 6 plates were used to express the variants.
[00420] Supernatant was captured with IMAC Phytip containing 40 resin by pipetting up and down 10 times slowly at a flow rate of 4.2 μΕ/ηιίη. Bound protein was eluted with 125 \iL IMAC elution buffer (50 mM Tris pH 8.0, 300 mM NaCl, 500 mM Imidazole). Following purification, IMAC purified variants were quantified on a Caliper GXII system by comparing with by mass standards of HERCEPTIN® run on the same Protein Express LabChip (Caliper LifeSciences # 760499). Samples were prepared for analysis as specified in the Protein Express Reagent Kit (Caliper Life Sciences # 760328) with the exception that the samples (mixed in sample buffer) were heated at 65 °C for 10 minutes prior to analysis on the Caliper system.
[00421] Conjugation with drug (DBCO-MMAF) and preparation of Antibody Drug Conjugates (ADCs) for further analysis was done as described previously.
[00422] Positive results of these characterization experiments are presented in Table 8. In the Table, the following properties of the variants are shown: final concentration of antibody- drug-conjugate made, the efficiency of expression of full length product compared to wild- type (suppression efficiency), ability to bind HER2-expressing cells, drug-antibody ratio (DAR, expressed as the number of cytotoxic agents per antibody), a comment regarding the HIC profile, and the observed IC50 from the cell-killing assay described previously. In the comments regarding the HIC assay, SP corresponds to a profile that resolved well as a single peak, NWR corresponds to a poorly resolved profile and WR corresponds to a well-resolved HIC profile. Several of the variants that exhibited a single peak profile also exhibited potent killing, which indicates that the variant was indeed conjugated with drug, but failed to resolve on the HIC column.
[00423] In total, trastuzumab variants having a non-natural amino acid at 269 sites that were screened for the activities as described. Table 8 presents the 71 variants that had desirable DAR, expression profiles, suppression efficiencies, and/or IC50 values. None of these properties could be predicted prior to testing, and many times the values for each individual property varied unpredictably within a sample. For example, one would generally expect that variants with high DAR would exhibit lower IC50 values than those with low DAR. Nonetheless, the 151 variant, for example, exhibited a relatively low DAR of 0.6 yet exhibited an IC50 of 1 ng/ml.
Table 8. Tag Scan II Variants
Figure imgf000161_0001
Figure imgf000162_0001
Figure imgf000163_0001
[00424] Preferred variants include those with a non-natural amino acid replacing these positions of the heavy chain (HC): G042, Q003, S007, P014, GO 16, R019, S025, A040, K043, 1051, Y052, T053, Y056, S070, N082A, D098, FlOO, T110, SI 12, K121, Y180, S184, S190, S192, K214, E216, D221, K222, T225, P227, P230, A231, P232, and G236.
[00425] Variants that have a DAR of at least about 0.7 are also preferred. Preferred variants include those with a non-natural amino acid replacing these positions of the heavy chain (HC): G042, Q003, S007, P014, G016, R019, S025, A040, K043, Y052, T053, Y056, S070, N082A, FlOO, T110, SI 12, K121, Y180, S190, S192, K214, E216, D221, K222, T225, P227, P230, A231, P232, and G236.
[00426] Variants that have a DAR of at least about 1.0 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: G042, Q003, S007, P014, GO 16, R019, S025, A040, K043, Y052, T053, Y056, S070, N082A, FlOO, T110, SI 12, K121, Y180, S190, S192, K214, E216, D221, K222, T225, P227, P230, A231, P232, and G236.
[00427] Variants that have a DAR of at least about 1.2 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: G042, Q003, S007, P014, GO 16, R019, S025, A040, K043, Y052, S070, N082A, FlOO, T110, SI 12, K121, Y180, S190, S192, K214, E216, D221, K222, T225, P227, P230, A231, P232, and G236. [00428] Variants that have a DAR of at least about 1.5 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the heavy chain: S007, P014, R019, S025, A040, K043, Y052, S070, F100, Tl 10, SI 12, K121, Y180, K214, E216, K222, P227, P230, A231, P232, and G236.
[00429] Preferred variants include those with a non-natural amino acid replacing these positions of the light chain (LC): minus 1, Q003, T005, S007, P008, S009, S010, G016, D017, R018, T020, T022, S026, Q027, K045, V058, S063, S065, R066, D070, S077, Q079, K107, N138, R142, E143, N152, S171, S182, K188, Q199, and L201.
[00430] Variants that have a DAR of at least about 0.7 are also preferred. Preferred variants include those with a non-natural amino acid replacing these positions of the light chain: minus 1, Q003, T005, S007, P008, S009, G016, D017, R018, T020, T022, S026, Q027, K045, V058, S063, S065, R066, D070, S077, Q079, K107, R142, E143, N152, S171, SI 82, K188, Q199, and L201.
[00431] Variants that have a DAR of at least about 1.0 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: minus 1, Q003, T005, S007, P008, S009, G016, D017, R018, T020, T022, S026, Q027, K045, V058, S063, S065, R066, D070, S077, Q079, K107, R142, N152, S171, S182, K188, and Q199.
[00432] Variants that have a DAR of at least about 1.2 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: minus 1, T005, S007, P008, G016, D017, R018, T020, T022, Q027, K045, V058, S063, S077, Q079, K107, R142, N152, S182, K188, and Q199.
[00433] Variants that have a DAR of at least about 1.5 are also preferred. Still more preferred were variants including those with a non-natural amino acid replacing these positions of the light chain: minus 1, G016, S063, and Q199.
Example 9
Characterization of Exemplary Antibody-Drug Conjugates: Scale up Analysis Scale up of select variants from TAG II Scan
[00434] Based on DAR and cell-killing data, a subset of trastuzumab variants with desirable characteristics were picked for small scale cell free expression in order to generate material for further characterization. The heavy chain variants selected for small scale production were: R019, S025, 1051, S070, D098, T110, SI 12, K121, S136, Y180, S187, S190, K214, E216, D221, and K222. The light chain variants selected for small scale production were: (-)l, S007, P008, G016, T022, S063, R014, D070, N138, R142, E143 and N152.
[00435] The cell free reaction mix in which the variants were synthesized comprised of a 80%:20% blend of cell free extracts made from an OmpT sensitive RF-1 attenuated E. coli strain, and an OmpT sensitive RF-1 attenuated E. coli strain that was engineered to express an orthogonal CUA encoding tRNA , respectively. All variants were scaled up to 9 ml in flower plates (1.5 mL X 6 replicates) and purified using Protein Maker (Emerald Bio).
[00436] Conjugation with drug (DBCO-MMAF) and preparation of Antibody Drug Conjugates (ADC's) for further analysis was done as described previously.
[00437] Positive results of these characterization experiments are presented in Table 9. In the Table, the following properties of the variants are shown: final concentration of antibody- drug-conjugate made, the efficiency of expression of full length product compared to wild- type (suppression efficiency), ability to bind HER2-expressing cells, drug-antibody ratio (DAR, expressed as the number of cytotoxic agents per antibody), a comment regarding the HIC profile, and the observed IC50 from the cell-killing assay described previously. In the comments regarding the HIC assay, SP corresponds to a profile that resolved well as a single peak, NWR corresponds to a poorly resolved profile and WR corresponds to a well-resolved HIC profile.
Table 9: A Subset of Preferred variants
Figure imgf000165_0001
Figure imgf000166_0001
Example 10
Characterization of Exemplary Antibody-Drug Conjugates: Thermofluor Analysis
[00438] Thermofluor analysis of the variants was carried out as described previously. Thermofluor results are in Table 10.
Table 10: Thermofluor data for small Scale production variants
Antibody Only Antibody-Drug Conjugate
Trastuzumab
Tml (°C) Tm2 (°C) Tml (°C) Tm2
Chain Variant co
Aglycosylated
61.4+/- 0.6 76.2+/- 0.1 N/A N/A Trastuzumab
LC minus 1 61.7+/- 0.4 75.6+/- 0.1 61.3 +/-0 74.4+/- 0.1
LC S7 62+/- 0.1 76.9 +/- 0 60.7+/- 0.1 76.2 +/- 0
LC P8 61.8+/- 0.1 71 +/- 0 61.2+/- 0.7 70.3 +/- 0
LC G16 61.9+/- 0.1 74.1 +/- 0.1 61.1 +/- 0.5 73.4+/- 0.1
LC T22 61.7 +/-0 76.8 +/- 0 61.6+/- 0.2 76.4+/- 0.1
LC S63 61.7+/- 0.1 75.5 +/- 0 61.4 +/-0 74.3 +/- 0
LC D70 61.9+/- 0.1 76.6+/- 0.1 61.8 +/-0 76+/- 0.1
LC N138 61.9+/- 0.1 75.6 +/- 0.2 61.6+/- 0.4 74.4 +/- 0
LC R142 61.8+/- 0.1 73.9+/- 0.1 61.7+/- 0.1 72.3 +/- 0.2
LC E143 62+/- 0.1 76.2 +/- 0 61.4+/- 0.1 75 +/- 0
LC N152 59.3 +/- 0 76.3 +/- 0 59.3 +/- 0 76.5 +/- 0
LC L201 62+/- 0.1 75.6+/- 0.1 61.2+/- 0.1 74.4 +/- 0
HC R19 61.5+/- 0.4 77.1 +/- 0.3 61.6+/- 0.4 73.7 +/- 0
HC S25 61.4 +/-0 75 +/- 0 61.6+/- 0.3 72.4 +/- 0
HC 151 61.6+/- 0.6 72.7+/- 0.1 61 +/- 0 71.8+/- 0.2
HC S70 61.6+/- 0.2 77.8+/- 0.1 61.5+/- 0.6 76.2 +/- 0 Antibody Only Antibody-Drug Conjugate
Trastuzumab
Tml (°C) Tm2 (°C) Tml (°C) Tm2 (°C)
Chain Variant
HC T77 61.8 +/- 0.5 75 +/- 0.1 61.5 +/- 0.1 73.3 +/- 0
HC Y79 61.6 +/- 0.2 76.1 +/- 0.1 61.7 +/- 0.1 76 +/- 0.1
HC D98 62.1 +/- 0.1 75.3 +/- 0.2 61.5 +/- 0.3 74.4 +/- 0.1
HC T110 61.6 +/- 0.2 73.6 +/- 0 61.4 +/- 0 71.5 +/- 0.1
HC S112 61.5 +/- 0.1 72.6 +/- 0.1 61.8 +/- 0.3 73.9 +/- 0
HC K121 61.4 +/- 0.1 75.1 +/- 0 61.4 +/- 0.1 74.7 +/- 0.1
HC S136 61.4 +/- 0.1 76.7 +/- 0.2 61.1 +/- 0.2 76.3 +/- 0
HC Y180 61.4 +/- 0.1 76.2 +/- 0 61.6 +/- 0.3 75.4 +/- 0.6
HC S187 62.2 +/- 0.1 68.5 +/- 0.3 61.7 +/- 0.4 68.3 +/- 0
HC S190 61.5 +/- 0.2 77.2 +/- 0.1 59.2 +/- 0 77 +/- 0.1
HC K214 59.1 +/- 0.1 76.9 +/- 0.1 59.1 +/- 0 76.3 +/- 0.1
HC E216 59.1 +/- 0 76.5 +/- 0 59.1 +/- 0.1 76.2 +/- 0.1
HC D221 59.1 +/- 0 76.7 +/- 0.1 59 +/- 0.1 76.7 +/- 0.1
HC K222 59.1 +/- 0.1 76.7 +/- 0.1 59 +/- 0.1 76.5 +/- 0.1
[00439] Variants subject to thermofiuor analysis included those with a non-natural amino acid replacing these positions of the heavy chain: R019, S025, 1051, S070, T077, Y079, D098, T110, S112, K121, S136, Y180, S187, S190, K214, E216, D221, and K222.
[00440] Variants subject to thermofiuor analysis also included those with a non-natural amino acid replacing these positions of the light chain: minus 1, S007, P008, GO 16, T022, S063, D070, N138, R142, E143, N152, and L201.
Example 11
Characterization of Exemplary Antibody-Drug Conjugates: Kinectics Analysis Conjugation Kinetics of Selected Variants
[00441] Rates of conjugation were determined for five variants that showed wide range of drug to antibody conjugate ratio. Reactions were initiated by mixture of variants with drug (DBCO-MMAF) in PBS (pH7.4) at 20°C in duplicates for 15 min, 30 min, lhr, 2hr, 4hr, 8hr and 16hr. Final concentrations of antibody in mixture range from 0.2 to 2 uM. Final drug concentration for all reaction is 100 uM. At the end of incubation period, NaAzide was added to the mixture to a final concentration of 10 mM. Final mixture was purified by Zeba and MustangQ plates as previously described. Concentration of IgG was determined by Caliper using Herceptin as mass standard. Fraction of fully conjugated variants was determined by HIC as previously described. Table 11. Half-lives and DAR of variants
Figure imgf000168_0001
[00442] Figures 5 A and 5B provides the HIC traces of two variants (HC Tl 10 and HC SI 12). The traces showed three peaks (P0, PI and P2) corresponding to peaks with unconjugated IgG, singly conjugated IgG and fully conjugate IgG, respectively.
[00443] Figures 6A through 6E show that conjugation of para-azido phenylalanine (pAzF) variants is site specific. Percentages of total of single and fully conjugated antibodies were separated by HIC.
Example 12
Characterization of Exemplary Antibody-Drug Conjugates: Suppression Comparison
Analysis
Comparison of suppression by para-azido phenylalanine (pAzF) and par-azido methyl phenylalanine (pAzMeF)
[00444] Eleven variants with a range of suppression efficiencies were expressed in a cell- free protein synthesis reaction as follows as described in Zawada et ah, 2011, Biotechnol. BioengA0%(7): 1570-1578 with the modifications described below. Unsubstituted trastuzumab was also made as a control. Cell-free extracts containing tRNA and OmpT sensitive RFl(80/20 blend of strains 16/23) were treated with 50 μΜ iodoacetamide for 30 min at RT (20°C) and added to a premix containing all other components except for GSSG, non-natural amino acids, tRNA synthetases, T7 RNAP, DsbC, PDI, and template DNA. All remaining reagents except DNA were then added to the mixture. Cell free reactions were initiated by addition of plasmid DNA of selected variants and incubated at 30°C for 12h on a shaker at 450 rpm in 96-well plates. The reaction was incubated further at 4°C for 5h. The final concentration in the protein synthesis reaction was 30% cell extract, 1 mM para-azido phenylalanine (pAzF) (RSP Amino Acids) with 0.37 mg/mL Mjannaschii pAzF-specific amino-acyl tRNA synthetase (FRS), or ImM para-azido methyl phenylalanine (pAzMeF) with 0.37mg/mL p-cyanophenylalanine specific aminoacyl-tRNA synthetase (Young et al, 2011, Biochem. 50: 1894-1900), 2 mM GSSG, 0.29 mg/mL PDI (Mclab), 100 μg/mL E. coli DsbC, 8 mM magnesium glutamate, 10 mM ammonium glutamate, 130 mM potassium glutamate, 35 mM sodium pyruvate, 1.2 mM AMP, 0.86 mM each of GMP, UMP, and CMP, 2 mM amino acids (except 0.5 mM for Tyrosine and Phenylalanine), 4 mM sodium oxalate, 1 mM putrescine, 1.5 mM spermidine, 15 mM potassium phosphate, 100 nM T7 R AP, 2 μ§/ι Ι. trastuzumab light chain DNA, 8 μ§/ι Ι. trastuzumab-(His)6 heavy chain DNA. Each trastuzamab variant was produced in lOOuL scale in 96-well plates in duplicates with 14C for each variant. It should be noted that all trastuzumab variants thus produced were
aglycosylated.
[00445] To monitor protein synthesis reactions were spiked with 3% (v/v) 1-[U-14C]- leucine (300 mCi/mmole; GE Life Sciences, Piscataway, NJ). The suppression of amber codon at different sites of the heavy chain and light chain was determined by [14C]- autoradiograhy of reducing SDS-PAGE gels. Full length trastuzumab heavy chain and suppressed tastuzumab heavy chain variants run at 50 kD on SDS-PAGE. Full length trastuzumab light chain and suppressed tastuzumab light chain variants run at 30 kD on SDS- PAGE. Non suppressed (truncated) trastuzumab variants run at a lower molecular weight. Amber suppression in the heavy or light chain is determined by:
band intensity of suppressed heavy or light chain TAG variant suppression =
band intensity of wild type heavy or light chain
[00446] Band intensity was determined by ImageQuant (Amersham Biosciences Corp.; Piscataway, NJ). In Figure 7A, the suppression efficiency of pAzF and pAzMeF variants are compared. Suppression efficiency is calculated as variant HC band intensity over wild type HC band intensity or variant LC band intensity over wild type LC band intensity. In Figure 7B, the soluble IgG yield of pAzF and pAzMeF variants are compared. The amount of IgG is computed according to the formula: soluble counts/full counts * IgG band intensity / total lane intensity * 2* 74008.02Da/47 Leucines.
Example 13
Transfer of Sites of Non-Natural Amino Acid Incorporation to Another Antibody
[00447] To test whether sites for incorporation of non-natural amino acids can be transferred between two distinct IgG sequences with predictable DARs, a second antibody containing a non-natural amino acid at representative sites was assessed. For this experiment, brentuximab was chosen as the second antibody (See SEQ ID NO.: 3 and SEQ ID NO.:4). Several sites were chosen from the trastuzumab mutagenesis study exhibiting varying DARs. In the heavy chain, sites corresponded to K121, Y180, K133, S157, F126, and P127 (EU Numbering). In the light chain, sites corresponded to R142, N152, Q147, E161, K149, and Q155 (EU Numbering). The TAG stop codon was inserted into the brentuximab sequence using standard quick change based site directed mutagenesis, and the identity of each variant was confirmed by DNA sequencing. Mini Prep DNA was prepared using a Qiagen Kit, for use as a template to drive the cell free protein synthesis reaction.
[00448] The variants were synthesized in a reaction mix that contained an OmpT sensitive RF-1 protein and an in vivo expressed orthogonal CUA encoding tRNA. All variants were scaled up to 9 ml in flower plates (1.5 mL X 6 replicates) and purified using a Protein Maker (Emerald Bio).
[00449] Conjugation with drug (DBCO-MMAF) and preparation of Antibody Drug Conjugates (ADC's) for further analysis was done as described previously. DARs were identified by the HIC profiling method previously described.
[00450] The results from the experiment suggest that sites can generally be predictably transferred between two distinct IgGs.
Table 12A: A Subset of Preferred HC variants
Figure imgf000170_0001
Table 12B: A Subset of Preferred LC variants
Figure imgf000170_0002
LC-Q155 TAG
[00451] To further characterize brentuximab conjugates, variants containing amber mutations at heavy chain positions K121 or F404 or light chain position N152 were selected for scale up and additional characterization. As a control, trastuzumab containing an amber mutation at F404 was also expressed expressed TAG codon was inserted by overlapping PCR mutagenesis at the nucleotides corresponding to positions K121 and F404 on heavy chain and N152 on light chain and separately cloned into expression vector pYD317.
[00452] The cell free reaction mix in which the brentuximab and trastuzumab variants were synthesized comprised a blend of cell free extracts made from an OmpT sensitive RF-1 attenuated E. coli strain, and an OmpT sensitive RF-1 attenuated E. coli strain which was engineered to produce an orthogonal CUA-encoding tRNA for insertion of a non-natural amino acid at an Amber Stop Codon. The variants were expressed in a cell-free protein synthesis reaction as described in Zawada et ah, 2011, Biotechnol. Bioeng. 108(7)1570-1578 with the modifications described below. Cell-free extracts were treated with 50 μΜ iodoacetamide for 30 min at RT (20°C) and added to a premix containing all other components except for DNA encoding the variants of interest. The final concentration in the protein synthesis reaction was 30% cell extract, 1 mM para-azido methyl phenylalanine (pAzMeF) (RSP Amino Acids), 0.37 mg/mL Mjannaschii pAzMeF-specific amino-acyl tRNA synthetase (FRS), 2 mM GSSG, 0.29 mg/mL PDI (Mclab), 30 μg/mL E. coli DsbC, 8 mM magnesium glutamate, 10 mM ammonium glutamate, 130 mM potassium glutamate, 35 mM sodium pyruvate, 1.2 mM AMP, 0.86 mM each of GMP, UMP, and CMP, 2 mM amino acids (except 0.5 mM for Tyrosine and Phenylalanine), 4 mM sodium oxalate, 1 mM putrescine, 1.5 mM spermidine, 15 mM potassium phosphate, 100 iiM T7 RNAP. Plasmid ratios of HC to LC were tested to find the optimal condition: 3: 1, 2: 1, 1 : 1 and 1 :2. Total plasmid concentration kept constant at 10 ug/mL. After addition of DNA template, cell free reactions were incubated at 30°C for 12h on petri dishes and followed by 14C assay analysis. Maximum yield was achieved at 1 : 1 ratio. 10 mL cell-free reactions were carried under this condition.
[00453] To purify the variants, 10ml of crude cell-free for each variant was first diluted 1 :0.5 with equilibration buffer (50mM sodium phosphate, pH 7) and spun at 1 l,000x g for 30 minutes. The supernatant was then passed through a 0.45 micron syringe filter prior to being loaded with a 2 minute residence time onto a pre-equilibrated lmL MabSelect Sure HiTrap (GE Lifesciences) to capture the IgG variants. The column was then washed with 7.5 CV (column volume) of wash buffer 1 (lOOmM sodium phosphate and 800mM Arginine, pH 7) and followed by 7.5CV of wash buffer 2 (50mM sodium phosphate and 0.5% (v/v) Triton X- 100, pH 7.3). After washing with 7.5CV of equilibration buffer, each variant was eluted with 4CV elution buffer (lOOmM sodium citrate and 300mM Arginine, pH 3). The elution pool was adjusted to pH 7 by addition of 30%> (v/v) of 1M Tris, pH9.
[00454] The collected elution pool was buffer exchanged into PBS via overnight dialysis in lOkD Slide-A-Lyzer (Pierce) units. The dialyzed material was then concentrated using an Amicon Ultra- 15 (Millipore) centrifugal filter unit to a concentration of 5-10 mg/mL.
[00455] The purified variants were conjugated as follows. DBCO-MMAF 2 (ACME Bioscience; Palo Alto, CA) was dissolved in DMSO to a final concentration of 5 mM. The compound was diluted with PBS to a concentration of 1 mM and then added to purified trastuzumab variants in IMAC elution buffer to achieve a final drug concentration of 100 μΜ. Mixture was incubated at RT (20°C) for 17 hours. Reaction was stopped by adding Sodium Azide to final concentration of 100 mM and buffer exchanged using Zeba plates (Thermo Scientific; Waltham, MA) equilibrated in IX PBS.
DAR for the aglycosylated variants was determined by LC-MS as follows. ADCs by LCMS Samples were run on a Waters Aquity UPLC system attached a Xevo QTOF. Proteins were separated on an Agilent PLRP-S column (2.3x50mm, 5 μιη, 4000A) at 80 °C. Mobile phases: A: 0.1% formic acid water; b: 20:80 isopropanohacetonitrile, 0.1% formic acid.
Samples were desalted on column for 0.4 minutes at 10%B followed by a step gradient from 30%)B to 40%)B over 7 minutes, 40%>B to 60%>B over 3 minutes. Data was acquired over the whole LC elution using a cone voltage of 35V. Spectra were analyzed using MassLynx software. DAR values were calculated as a weighted average and are shown in Table 13
Table 13: DAR values for Adcetris ADCs
Figure imgf000172_0001
glycosylated Brentuximab IgG
LC-N152 BCO-MMAF 2 .74
Aglycosylated Trastuzumab
IgG HC-F404 DBCO-MMAF 2 1.97
Next, cell binding and cell killing activities of the variants were measured as follows. Karpas 299 and L540 cell lines were obtained from German Collection of Microorganisms and Ceil Cultures (DSMZ) and SKBR3 and Raji cell lines were obtained from American Type Culture Collection (ATCC). Cells were grown in RPMI 1650 medium (Cellgro-Mediatech; Manassas, VA) containing 20% heat-inactivated fetal bovine serum (Hyclone; Thermo Scientific;
Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx penicillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent SKBR3 cells were grown in DMEM/Nutrient F-12 Ham (50:50) high glucose medium (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum, 2 mM glutamax and lx
penicillin/streptomycin. All cells were grown and maintained at 37°C in a 5% C02 incubator. SKBR3 were passaged by washing with calcium/magnesium-free Phosphate Balanced Saline (PBS) and harvested with HyQTase (Hyclone; Thermo Scientific; Waltham, MA).
[00456] Cell killing activities of Trastuzumab and Brentuximab (Adcetris) variants were measured using CellTiter-Glo® cell proliferation assay. Briefly, 104 suspension cells or 3xl03 SKBR3 cells were plated in 40μ1 per well in a 96-well half-area white TC-treated plate and incubated at 37°C for 2 hours prior to adding antibodies. Antibodies were formulated in the respective cell culture media and filter-sterilized with 0.45 μιη celluloase aceteate Costar Spin-X® centrifuge tube filters (Corning; Tewksbury, MA). 40 μΐ of unconjugated antibody, AB4285-conjugated antibody or AB4285 free drug were added to cells and cultured for either 3 days or 5 days for suspension cells and SKBR3 cells, respectively. Cell viability was measured by adding 80 μΐ of Cell Titer-Glo® reagent (Promega Corp.; Madison, WI) to each well and processed following product instructions. Luminescence was measured with the ENVISION® plate reader (Perkin-Elmer; Waltham, MA). Relative luminescence readings were converted to %> viability using untreated cells as controls and plotted versus antibody concentration. IC50 was calculated from the non-linear regression equation, log (inhibitor) versus response - variable slope (4 parameters) using the statistical software, Prism
(GraphPad Software; San Diego, CA). Results are shown in Figures 8 and 9 and Table 14.
Table 14: Cell Killing by Brentuximab and Trastuzumab Variants Cell Line
SKBR3 arpas 540
ADC Site
C50 C50 C50 nM) nM) nM) glycosylated
Brentuximab C F404 .078 .22
DBCO-MMAF 2 glycosylated
Brentuximab C K121 .040 .12
DBCO-MMAF 2 glycosylated
Brentuximab C N152 .037 .12
DBCO-MMAF 2 glycoaylated
Trastuzumab C F404 .043 DBCO-MMAF 2 ree drug DBCO- 43 46 78 MMAF 2
[00457] Cell binding affinities of trastuzumab and brentuximab variants were measured using a FACS-based assay. Briefly, 2xl05 Karpas 299 or L540 cells in 25 μΐ of binding buffer, which consists of PBS containing 0.5% bovine serum albumin (BSA) (Invitrogen; Carlsbad, CA) and 0.09%> sodium azide (Sigma; St. Louis, MO) were plated in a 96-well U- bottom polypropylene plate (Greiner Bio-One; Monroe, NC). Antibodies were formulated in binding buffer and 2-fold serial dilutions were prepared in a separate 96-well plate. Equal volume of diluted antibodies were added to cells and incubated at 4°C for 1 hour. Cells were washed twice with 200 μΐ of binding buffer to remove unbound antibodies. For secondary antibody detection, 5 μg/ml Alexa-488 conjugated goat anti-human IgG (Invitrogen;
Carlsbad, CA) was prepared in binding buffer and 50 μΐ was added to cells and incubated at 4°C for 1 hour. Cells were washed twice, resuspended in 200 μΐ of binding buffer and analyzed using a BD FACScan® flow cytometer (Cytek; Fremont, CA) equipped with a 96- well automated microsampler (Cytek; Fremont, CA). Data was acquired and analyzed using Flow Jo (Tree Star; Ashland, OR). Mean fluorescence intensity readings were expressed as % binding by normalizing to averaged maximum MFI values and data was plotted versus antibody concentration. Binding affinities was calculated from the non-linear regression saturation binding equation, one site - total binding using Prism software. Results are shown in Figure 10 and table 15.
Table 15: Cell Binding of Brentuximab Variants
Figure imgf000175_0001
Example 14: Antibody-Drug Conjugates in Alternative Scaffolds: scFv Formats
[00458] To demonstrate the feasibility of using scFv as alternative scaffold for ADC, DNA encoding trastuzumab scFv (VL VH) with an amber codon was cloned into expression vector pYD317. The TAG codon was inserted by overlapping PCR mutagenesis at the nucleotides corresponding to the amino acid serine at the position (-1).
[00459] To express the scFv, cell-free extracts were thawed to room temperature and incubated with 50 uM iodoacetamide for 30 min. Cell-free reactions were run at 30C for up to 10 h containing 30% (v/v) iodoacetamide-treated extract with 8 mM magnesium glutamate, 10 mM ammonium glutamate, 130 mM potassium glutamate, 35 mM sodium pyruvate, 1.2 mM AMP, 0.86 mM each of GMP, UMP, and CMP, 2 mM amino acids for all 18 amino acids except tyrosine and phenylalanine which were added at 0.5 mM, 4 mM sodium oxalate, 1 mM putrescine, 1.5 mM spermidine, 15 mM potassium phosphate, 100 uM T7 RNAP, 1.3 uM E. coli DsbC, 2 mM oxidized (GSSG) glutathione, 10 ug/mL scFv plasmid 15 uM in vivo produced m.j. tRNA, 5 uM m.j RNA synthetase and 1 mM pAzido
Phenylanine (pN3F). Wild type scFv was expressed as control.
[00460] scFv(-l)pN3F and wild type scFv were purified by Protein L followed by SEC. 5uM scFv (-1) was incubated with 50 uM of the DBCO-MMAF reagent shown in Figure 1 for 16 hours at room temperature. The excess free drug was removed by zeba desalting column.
[00461] Hydrophobic Interaction Chromatography was then performed to quantitate the samples and to determine the drug-antibody ratios as follows. Samples and standards were diluted 1 : 1 in 3M Ammonium Sulfate (EMD Chemical), 50mM Sodium Phosphate pH 7.0 (Mallinckrodt) prepared in MilliQ water. A Dionex HPLC system was equipped with a Tosoh Bioscience LLC TSK-gel Butyl-NPR® (4.6mm x 3.5cm) column with a column
compartment temperature of 30°C. The mobile phase A was 1.5M Ammonium Sulfate, 50mM Sodium Phosphate, pH 7.0. The mobile phase B was 50mM Sodium Phosphate, pH 7.0 in 80:20 watenisopropyl Alcohol (Honeywell). The mobile phase was delivered at a flow rate of 1.0 mL/minute. The separation was performed with a linear gradient of 15% mobile phase B to 100% mobile phase B in 10 minutes. The UV data was acquired at 214 nm. The peak areas were quantitated using Chromeleon software (Thermo) to calculate Drug
Antibody Ratio (DAR).
[00462] To assess binding of the conjugated alternative scaffold variants, a binding assay to cells expressing HER2 was performed as follows. The binding of the purified conjugated variants to HER2 on SKBR3 cells, which overexpress the HER2/c-erb-2 gene product, with over 1.5 million receptor copies per cell (ATCC # HTB-30, Manassas, VA) was compared to clinical grade Herceptin®, unglycosylated trastuzumab produced by cell-free protein synthesis, or human serum IgGl as a negative control (Sigma- Aldrich; St. Louis, MO).
SKBR3 cells were cultured in DMEM:Ham's F-12 (50:50), high glucose (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum (Hyclone;
Thermo Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASE™ (Hyclone; Thermo Scientific; Waltham, MA). A total of 200,000 cells per sample in total volume of 10 were incubated with serial dilutions of either conjugated alternative scaffold variants, clinical grade HERCEPTIN®, or aglycosylated trastuzumab made in Ι ΟμΙ, FACS buffer (DPBS buffer supplemented with 1% bovine serum albumin). Cells plus antibody or ADC were incubated for 60 minutes on ice. Unstained cells, human IgGl (Isotype control) and Secondary antibody (goat anti-human IgG) were used as controls. To detect HERCEPTIN® or aglycosylated trastuzumab binding, cells were washed twice with ice-cold FACS buffer and incubated with 5 μg/ml Alexa 647 labeled goat anti-human IgG secondary antibody (Invitrogen; Carlsbad, CA) on ice for 1 hour. Alternative scaffold variant cell binding was detected by incubating cells on ice for lh with either 5 μg/ml Alexa 647 labeled Protein L (Pierce) or goat anti-human-Fc labeled with Alexa 647 (Invitrogen; Carlsbad, CA). All samples were washed using FACS buffer and analyzed using a BD FACS Calibur system (BD Biosciences; San Jose, CA).
[00463] Mean fluorescence intensities were fitted using non-linear regression analysis with one site specific binding equation using GraphPad Prism (GraphPad v 5.00, Software; San Diego, CA). Data was expressed as Relative MFI vs. concentration of antibody or antibody variant in nM.
[00464] Next, the effects of the conjugated alternative scaffold variants on cell killing were measured with a cell proliferation assay as follows. SKBR3 cells were obtained from ATCC and maintained in DMEM: Ham's F-12 (50:50), high glucose (Cellgro-Mediatech; Manassas, VA) supplemented with 10% heat-inactivated fetal bovine serum (Hyclone; Thermo Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). Adherent cells were washed twice with calcium and magnesium-free Hanks Balanced Salt Solution (HBSS), harvested with HYQ®TASE™ (Hyclone; Thermo Scientific; Waltham, MA). A total of 103 cells were seeded in a volume of 40 μΐ in a 96-well half area flat bottom white Polystyrene plate. The cells were allowed to adhere overnight at 37°C in a C02 incubator. ADC variants were formulated at 2x concentration in DMEM/F12 medium and filtered through MultiScreen HTS 96- Well Filter Plates (Millipore; Billerica, MA). Filter sterilized conjugated alternative scaffold variants, HERCEPTIN , or aglycoslyated trastuzumab were added into treatment wells and plates were cultured at 37°C in a C02 incubator for 120hrs. For cell viability measurement, 80μ1 of Cell Titer-Glo reagent (Promega Corp.; Madison, WI) was added into each well, and plates processed as per product instructions. Relative luminescence was measured on an ENVISION® plate reader (Perkin-Elmer; Waltham, MA). Relative luminescence readings were converted to % viability using untreated cells as controls. Data was fitted with non-linear regression analysis, using log(inhibitor) vs. response -Variable slope, 4 parameter fit equation using GraphPad Prism (GraphPad v 5.00, Software; San Diego, CA). Data was expressed as relative cell viability, ATP content % vs. dose of ADC in nM.
[00465] Results from the HIC analysis, the cell binding, and cell killing experiments are presented in Table 16.
Table 16: scFv Cell Binding, Cell Killing, and DAR
Figure imgf000178_0001
Example 15: Antibody-Drug Conjugates
in Alternative Scaffolds: scFv-Fc Formats
[00466] To demonstrate the feasibility of using scFv Fc as alternative scaffold for ADC, DNA encoding trastuzumab scFv Fc (VL VH Fc) with amber was cloned into expression vector pYD317. TAG codon was inserted by overlapping PCR mutagenesis at the nucleotides corresponding to the amino acid serine at the position (-1), Fc R355, Fc N389, and Fc F404 (EU index numbering). [00467] CFPS reaction conditions were same as described in Example 14, except that 5 uM yeast PDI was added. Wild type scFv Fc was expressed as control.
[00468] To conjugate aglycosylated scFv-Fc, proteins were first purified by Protein A followed by SEC. 5uM pN3F containing scFv-Fc was incubated with 50 uM DBCO-MMAF for 16 hours at room temperature. The excess free drug was removed by zeba desalting column.
[00469] Additionally, pAzido Methyl Phenylanine was incorporated to scFv Fc at the sites of R355, N389, and F404, respectively. The reaction condition was same as described in Example 14, except that 1 uM m.j. pCyano FRS and 1 mM pAzido Methyl Phe were used to replace the pair of m.j. FRS and pAzdio Phe. The protein A purified protein was then conjugated with DBCO-MMAF reagent 2 (DBCO-MMAF 2). The structure of DBCO- MMAF 2 is shown in Figure 11.
[00470] Next, LC-MS was performed to quantitate the samples and to determine the drug- antibody ratios as follows. Samples were analyzed by liquid chromatography (CHIP-Cube nanoLC, Agilent) coupled to a qTOF mass spectrometer (Agilent 6520). Proteins were separated on a reverse phase HPLC-Chip (PLRP-S, 4000A , 5 μ; Enrichment column: 25mm; Separation column: 150 mm x 75 μιη) with 0.1 % formic acid in water (solvent A) and 0.1 % formic acid in acetonitrile +isopropyl alcohol (80:20 v/v, solvent B). Data was processed using MassHunter Qualitative Software (Agilent). Data is shown in Table 17.
Table 17: DAR and Cell Binding and Killing of scFv-Fc variants
Figure imgf000179_0001
MMAF
scFv-Fc (N389) pN3CH2F
3.0 1.97
DBCO-MMAF 2
scFv-Fc (R355) pN3CH2 F
5.0 0.055 1.97
DBCO-MMAF 2
scFv-Fc (F404) vH-vL pN3CH2 F
0.05 1.99
DBCO-MMAF 2
scFv-Fc (F404) vL-vLH pN3CH2
0.068 1.97
F DBCO-MMAF 2
[00471] In vivo stability of drug linker ADC conjugates was measured by dosing 2mg/kg of respective scFv-Fc DBCO-MMAF 2 conjugates into Beige nude Xid mice. Plasma was collected by terminal bleeds at 30mins, d3, d7, dl4 and d21 from n=2 animals for each time point. Total circulating ScFv-FC ADCs were captured by Biotin- (Fab)2 Goat Anti-Human IgG, Fey fragment specific. Complex was pulled down with streptavidin Mag Sepharose. Captured complex was washed to remove nonspecific binding and eluted with 1% formic acid. Neutralized eluate was analyzed by intact LCMS. The results indicate that scFv-Fc (N389) pN3CH2F DBCO-MMAF 2 and scFv-Fc (R355) pN3CH2 F DBCO-MMAF 2 are stable up to 28 days.
[00472] Next, pharmacokinetics properties of ScFv-Fc ADCs were analyzed in beige nude xid mice. Animals were dosed intravenously at a dose level of approximately of 2.0 mg/kg of scFv-Fc R355 and scFv-Fc N389. The plasma concentrations, sampled out to 28 days, were determined by immunoassay and the pharmacokinetic parameters calculated using a non- compartmental approach with WinNonlin V 5.2 (Pharsight, CA). Results are shown in Figure 12.
[00473] To assess in vivo efficacy of the scFc-Fc ADCs, KPL-4 human breast tumor cells were inoculated into the mammary fat pads of SCID beige mice (Charles River Laboratories). A total of 3 million cells per mouse, suspended in 50% phenol red-free Matrigel (Becton Dickinson Bioscience) mixed with culture medium were injected. Once tumor size was reached all animals were randomly assigned into treatment groups, such that the mean tumor volume for each group was 100 -150mm .
[00474] Trastuzumab (30 mg/kg) was given i.p. (single injection on treatment day 0), followed by (15mg/kg) per week for 3 weeks. Aglycosylated Trastuzumab 2nnAA variant scFv-Fc N389 DBCO-MMAF 2 15mg/kg (872ug MMAF/m2, DAR 1.901), Aglycosylated Trastuzumab 2nnAA variant HC-S136 (15mg/kg) (unconjugated) Vehicle (PBS) and free drug (0.54mg/kg) were given via i.v (single injection on treatment day 0). The results of this experiment are presented in Figure 13 a.
[00475] In another experiment, scFv-Fc F404 vL-vH DBCO-MMAF 2 (15 mg/kg), scFv- Fc F404 vH-vL DBCO-MMAF 2 (15 mg/kg), Trastuzumab-CF HC F404 DBCO-MMAF 2 (15 mg/kg), Trastuzumab-CF (15 mg/kg), and vehicle were administered by single i.v. injection on day 0. The results of this experiment are presented in Figure 13b.
[00476] For both experiments, all treatment groups consisted of 10 animals per group, and tumor size was monitored twice weekly using caliper measurement. Mice were housed in standard rodent microisolator cages. Environmental controls for the animal rooms were set to maintain a temperature of 70°F, a relative humidity of 40% to 60%, and an approximate 14-h light/10-h dark cycle.
[00477] The results of this experiment demonstrate that the ADCs conjugated at positions N389 and F404 were effective in an animal to durably regress tumor size. Of particular note, the F404 scFv-Fc conjugates achieved regression below baseline, demonstrating particular efficacy for this scaffold in a solid tumor model.
Example 16: Exemplary ADCs Specific for CD74 and Her2 and with Additional
Exemplary Linker- Warhead Combinations
[00478] This example provides exemplary antibody-drug conjugates prepared with an antibody specific for CD74 and containing different exemplary linker-warhead combinations as described herein. This example further provides exemplary antibody-drug conjugates prepared from trastuzumab conjugated with certain of the linker-warhead combinations.
[00479] The protein sequence of the heavy and light chains of the anti-CD74 antibody used in this example are provided as SEQ ID NO:5 and 6, respectively. The heavy chain sequence includes a 6-His C-terminal tag to assist with puridication. Amber codons at the positions encoding HC K212, HC S136, HC F241, HC F404, LCS7, or LC N152 were introduced using the methods described in Example 13. Anti-CD74 antibodies containing p- methylazido-Phe were expressed and purified using the methods described in Example 13. Trastuzumab variants containing p-methylazido-Phe at positions HC SI 36 or HC F404 were also expressed and purified as described in Example 13. [00480] Next, the anti-CD74 or trastuzumab variants were conjugated with DBCO-MMAF 2 (Figure 11 A), DBCO-DM4 (Figure 1 IB), DBCO-DM4 2 (Figure 11C), or DBCO-MMAE (Figure 1 ID). The method used to perform the conjugation reactions between the antibody variants and the linker- warhead combinations was as described in Example 13.
[00481] The drug-antibody ratios (DARs) of the ADCs was then determined by LC-MS according to the method described in Example 13. It should be noted that the LC-MS method for the anti-CD74 samples had not been optimized for this antibody; the results of the analysis contained peaks overlapping with unconjugated species, artificially lowering the DAR of these samples. The DAR of the ADC variants prepared in this example therefore showed good agreement with the ADCs containing a nnAA at corresponding sites discussed in Examples 1-15. Results of the DAR analysis are presented in Table 18, below.
[00482] Next, the ADC variants were used in cell killing experiments to determine their IC50 values. Trastuzumab variants were analyzed as described in Example 13. The effects of the conjugated anti-CD74 variants on cell killing were measured by a cell proliferation assay. SU-DHL-6 and NCI-H929 cells were obtained from ATCC and maintained in RPMI-1640 medium (Cellgro-Mediatech; Manassas, VA) supplemented with 20% heat-inactivated fetal bovine serum (Hyclone; Thermo Scientific; Waltham, MA), 2 mM glutamax (Invitrogen; Carlsbad, CA) and lx Pencillin/streptomycin (Cellgro-Mediatech; Manassas, VA). SU-DHL- 6 and NCI-H929 cells were harvested and re-suspended in culture medium at final concentration of 0.5xl06 cells/mL. A total of 20xl03 cells in a volume of 40 μΐ were seeded in each well of a 96-well half area flat bottom white polystyrene plate. ADC variants were formulated at 2x concentration in RPMI-1640 complete medium and filtered through
MultiScreenHTs 96-Well Filter Plates (Millipore; Billerica, MA). Filter sterilized ADCs were added into treatment wells and plates were cultured at 37°C in a C02 incubator for 72hrs. For cell viability measurement, 80μ1 of Cell Titer-Glo reagent (Promega Corp. Madison, WI) was added into each well, and plates were processed as per product instructions. Relative luminescence was measured on an ENVISION® plate reader (Perkin-Elmer; Waltham, MA). Relative luminescence readings were converted to % viability using untreated cells as controls. Data was fitted with non-linear regression analysis, using log(inhibitor) vs. response -variable slope, 4 parameter fit equation using GraphPad Prism (GraphPad v 5.00, Software; San Diego, CA). Data was expressed as relative cell viability, ATP content % vs. dose of ADC in nM. Results of the cell killing assays are presented in Table 18.
Table 18: DAR and ICsn Values for Exemplary Anti-CD74 and Anti-HER2 ADCs Antibody Drug Conjugate Site DAR ICso
Anti-CD74 Antibody DBCO-MMAF 2 HC K121 1.601 0.122
Anti-CD74 Antibody DBCO-MMAF 2 HC S136 1.601 0.100
Anti-CD74 Antibody DBCO-MMAF 2 HC F241 1.58 0.078
Anti-CD74 Antibody DBCO-MMAF 2 HC F404 1.631 0.137
Anti-CD74 Antibody DBCO-MMAF 2 LC S7 1.543 0.120
Anti-CD74 Antibody DBCO-MMAF 2 LC N152 1.457 0.130
Anti-CD74 Antibody DBCO-DM4 HC K121 1.572 0.191
Anti-CD74 Antibody DBCO-DM4 HC S136 1.61 0.271
Anti-CD74 Antibody DBCO-DM4 HC F241 1.581 0.187
Anti-CD74 Antibody DBCO-DM4 HC F404 1.531 0.253
Anti-CD74 Antibody DBCO-DM4 LC S7 1.509 0.293
Anti-CD74 Antibody DBCO-DM4 LC N152 1.474 0.281
Anti-CD74 Antibody DBCO-DM4 2 HC K121 1.578 0.215
Anti-CD74 Antibody DBCO-DM4 2 HC S136 1.589 0.215
Anti-CD74 Antibody DBCO-DM4 2 HC F241 1.612 0.196
Anti-CD74 Antibody DBCO-DM4 2 HC F404 1.63 0.154
Anti-CD74 Antibody DBCO-DM4 2 LC S7 1.561 0.291
Anti-CD74 Antibody DBCO-DM4 2 LC N152 1.495 0.235
Anti-CD74 Antibody DBCO-MMAE HC K121 1.811 0.166
Anti-CD74 Antibody DBCO-MMAE HC S136 1.752 0.242
Anti-CD74 Antibody DBCO-MMAE HC F241 1.81 0.238
Anti-CD74 Antibody DBCO-MMAE HC F404 1.572 0.235
Anti-CD74 Antibody DBCO-MMAE LC S7 1.581 0.224
Anti-CD74 Antibody DBCO-MMAE LC N152 1.616 0.251
Trastuzumab DBCO-DM4 HC F404 0.036 1.84
Trastuzumab DBCO-DM4 HC S136 0.038 1.82
Trastuzumab DBCO-DM4 2 HC F404 0.043 1.94
Trastuzumab DBCO-DM4 2 HC S136 0.038 1.82
[00483] Example 17 further demonstrates that the site of incorporation of a nnAA into an antibody can transfer reasonably predictably between antibodies. Further, the identity of the linker and warhead does not appear to significantly affect the conjugation efficiency or DAR of the resulting ADC, demonstrating reasonable predictability that a given warhead-linker combination can be conjugated to the an antibody containing a non-natural amino acid at one of the preferred sites.
[00484] All publications and patent, applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. While the claimed subject matter has been described in terms of various embodiments, the skilled artisan will appreciate that various modifications, substitutions, omissions, and changes may be made without departing from the spirit thereof. Accordingly, it is intended that the scope of the subject matter limited solely by the scope of the following claims, including equivalents thereof.
Sequence Listing
<210> SEQ ID NO 1
<211> LENGTH: 449
<212> TYPE: PRT
<213> ORGANISM: Artificial sequence
<220> FEATURE:
<223> OTHER INFORMATION: sequence is synthesized
<400> SEQUENCE: 1
Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly
1 5 10 15
Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn He Lys
20 25 30
Asp Thr Tyr He His Trp Val Arg Gin Ala Pro Gly Lys Gly Leu
35 40 45
Glu Trp Val Ala Arg He Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr
50 55 60
Ala Asp Ser Val Lys Gly Arg Phe Thr He Ser Ala Asp Thr Ser
65 70 75
Lys Asn Thr Ala Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp
80 85 90
Thr Ala Val Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr
95 100 105
Ala Met Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser
110 115 120
Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser
125 130 135
Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys
140 145 150
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala
155 160 165
Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gin Ser Ser
170 175 180
Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser
185 190 195
Leu Gly Thr Gin Thr Tyr He Cys Asn Val Asn His Lys Pro Ser
200 205 210
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys
215 220 225
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
230 235 240
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
245 250 255
He Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
260 265 270
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
275 280 285
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr Asn
290 295 300
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin Asp
305 310 315
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
320 325 330
Leu Pro Ala Pro He Glu Lys Thr He Ser Lys Ala Lys Gly Gin
335 340 345
Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu
350 355 360
Met Thr Lys Asn Gin Val Ser Leu Thr Cys Leu Val Lys Gly Phe
365 370 375
Tyr Pro Ser Asp He Ala Val Glu Trp Glu Ser Asn Gly Gin Pro
380 385 390 Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
395 400 405
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
410 415 420
Gin Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
425 430 435
His Asn His Tyr Thr Gin Lys Ser Leu Ser Leu Ser Pro Gly
440 445
<210> SEQ ID NO 2
<211> LENGTH: 214
<212> TYPE: PRT
<213> ORGANISM: Artificial sequence
<220> FEATURE:
<223> OTHER INFORMATION: Sequence is synthesized.
<400> SEQUENCE: 2
Asp lie Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val
1 5 10 15
Gly Asp Arg Val Thr lie Thr Cys Arg Ala Ser Gin Asp Val Asn
20 25 30
Thr Ala Val Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys
35 40 45
Leu Leu lie Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro Ser
50 55 60
Arg Phe Ser Gly Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr lie
65 70 75
Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin
80 85 90
His Tyr Thr Thr Pro Pro Thr Phe Gly Gin Gly Thr Lys Val Glu
95 100 105 lie Lys Arg Thr Val Ala Ala Pro Ser Val Phe lie Phe Pro Pro
110 115 120
Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu
125 130 135
Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gin Trp Lys Val
140 145 150
Asp Asn Ala Leu Gin Ser Gly Asn Ser Gin Glu Ser Val Thr Glu
155 160 165
Gin Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr
170 175 180
Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu
185 190 195
Val Thr His Gin Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn
200 205 210
Arg Gly Glu Cys
SEQ ID NO 3
> Sequence of brentuximab heavy chain: HC-6His
MQIQLQQSGPEVVKPGASVKISCKASGYTFTDYYITWVKQKPGQGLEWIGWIYPGSGNTKYNEKFKGK ATLTVDTSSSTAFMQLSSLTSEDTAVYFCANYGNYWFAYWGQGTQVTVSAASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGSHHHHHH SEQ ID NO 4
> Sequence of brentuximab light chain: LC
MDIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKVLIYAASNLESGIPARFS GSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTAS WCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC
SEQ ID NO 5
>Sequence of anti-CD74 heavy chain: HC
M 0 V Q L V E s G G G V V Q P G P. S L R L s C A A S G F T F s S Y G
M H w V R Q A P D K G L E w " J A V I W Y D G s N K Y Y A D S K G R
F T I S R D N s K N T L Y L Q M N s L R A E D T A V Y Y C A R G G T
L V R G A M Y G T D V W G Q G T T V T V S S A s T K Lv P S V F P L A
P S S K S T s Lv G T A A L G c L V K D Y F P E P V T s W N s G A L
T S G V H T F P A V L Q S S G L Y s L s S " j T V P s S S L G T Q T
Y I 0 N V N H K P s N T K V D K K J E P K s C D K T H T C P P C P A
P E L L G G P s V F L F P P K P K D T L M I S R T P E V T 0 V V D
V S H E D P E V K F N Y V D G V E H N A K T K P R E E Q Y N S T
Y R V V S V L T V L H Q D W L N G K E Y K 0 K V s N K A L P A P I E
K T I S K A K G Q P R E P Q V Y T L P P R E Ξ T K N Q V ,ς L T C
L V K G F Ύ P S D I A V Ξ ¾ E S N G Q P Ξ N N Y K T T P P V L D D
G S F F L Y K L T V D K R W Q Q G N V F ,ς C s V M H E A L H N H
Y T Q K S L S L S P G K G G S H H K H H H
SEQ ID NO 6
>Sequence of anti- -CD74 :light chain
M D I Q T Q S P L S A S V G D R V T I T P R A ,ς Q G I S S L
A Y Q Q K ? E K A P K L I Y A A S S L Q ,ς G V P S R F G 3 G S
G T D F T L T I s L Q P E D F A T Y Y c Q Q Y N Y P L T F G G G
T K V E I K R T V A A P V F I F P P s D E Q L K S G T A V V r; L
L N N tr Y P R E A K V Q K D N A ], Q S G 8 Q E S V :r E o D K
D S ΐ Y S I; Q S T L ΐ L s K 1 D Y E K H V Y A C E Ί H Q G L s g
P V T K s N R G E c

Claims

WHAT IS CLAIMED IS:
1. An antibody comprising a polypeptide chain having one or more non-natural amino acid residues at specific sites selected from the group consisting of heavy chain or light chain residues H404, H121, H180, H241, L22, L7, L152, H136, H25, H40, HI 19,
HI 90, H222, HI 9, H52, or H70 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
2. The antibody of claim 1 comprising a polypeptide chain having one or more non-natural amino acid residues at specific sites selected from the group consisting of heavy chain or light chain residues H404, H121, HI 80, H241, L22, L7, LI 52, HI 36, H25, H40, HI 19, HI 90, and H222 according to the Kabat or Chothia numbering scheme, or a post- translationally modified variant thereof.
3. The antibody of claim 1 comprising a polypeptide chain having one or more non-natural amino acid residues at specific sites selected from the group consisting of heavy chain or light chain residues H404, H121, H180, H241, L22, L7, L152, and H136 according to the Kabat or Chothia numbering scheme, or a post-translationally modified variant thereof.
4. The antibody of claim 1 comprising a polypeptide chain having at least 70%, 80% or 90% homology to SEQ ID NO: 1 and having one or more non-natural amino acid residues at specific sites selected from the group consisting of sites corresponding to residues 404, 121, 180, 241, 136, 25, 40, 119, 190, 222, 19, 52, or 70 of the representative heavy chain polypeptide according to SEQ ID NO: l, or a post-translationally modified variant thereof.
5. The antibody of claim 1 comprising a polypeptide chain having at least 70%, 80% or 90% homology to SEQ ID NO:2 and having one or more non-natural amino acid residues at specific sites selected from the group consisting of sites corresponding to residues 22, 7 and 152 of the representative light chain polypeptide according to SEQ ID NO:2, or a post-translationally modified variant thereof.
6. The antibody of any of the preceding claims wherein said polypeptide chain is a heavy chain of a type selected from the group consisting of α, δ, ε and μ.
7. The antibody of any of the preceding claims wherein said polypeptide chain is a light chain of a type selected from λ and κ.
8. The antibody of any of the preceding claims that is of a class or subclass selected from the group consisting of IgA, IgA, IgA2, IgD, IgE, IgG, IgGl, IgG2, IgG3 and IgM.
9. The antibody of any of the preceding claims wherein said non-natural amino acid residue comprises a moiety selected from the group consisting of amino, carboxy, acetyl, hydrazino, hydrazido, semicarbazido, sulfanyl, azido and alkynyl.
10. The antibody of any of the preceding claims wherein each non-natural amino acid residue is according to the formula
Figure imgf000189_0001
wherein each L is independently a divalent linker; and
each R is independently a functional group.
11. The antibody of claim 10 wherein R is a reactive group, a therapeutic moiety or a labeling moiety.
12. The antibody of claim 10 wherein each R is a reactive group selected from the group consisting of amino, carboxy, acetyl, hydrazino, hydrazido, semicarbazido, sulfanyl, azido and alkynyl.
13. The antibody of claim 10 wherein each L is a divalent linker selected from the group consisting of a bond, alkylene, substituted alkylene, heteroalkylene, substituted heteroalkylene, arylene, substituted arylene, heteroarlyene and substituted heteroarylene.
14. An antibody conjugate comprising the antibody of any of the preceding claims linked to one or more therapeutic moieties or labeling moieties.
15. The antibody conjugate of claim 14 that comprises said antibody linked to one or more drugs or polymers.
16. The antibody conjugate of claim 14 that comprises said antibody linked to one or more labeling moieties.
17. The antibody conjugate of claim 14 that comprises said antibody linked to one or more single chain binding domains (scFv).
18. The antibody conjugate of any of claims 14-17 wherein said antibody is linked to said one or more therapeutic moieties or labeling moieties via one or more linkers.
19. A composition comprising the antibody of any of the preceding claims, wherein said composition is substantially pure.
20. A composition comprising the antibody of any of the preceding claims wherein said antibody is at least 95% by mass of the total antibody mass of said composition.
PCT/US2013/044843 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use WO2013185115A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
AU2013270684A AU2013270684B2 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
ES13730764T ES2718478T3 (en) 2012-06-08 2013-06-07 Antibodies comprising non-natural amino acid residues of specific location, methods for their preparation and methods for their use
SI201331372T SI2859017T1 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
CN201380041954.0A CN104583235B (en) 2012-06-08 2013-06-07 The antibody of the Unnatural amino acid residues containing site-specific, its preparation and application
SG11201408161RA SG11201408161RA (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
JP2015516266A JP6498600B2 (en) 2012-06-08 2013-06-07 Antibodies containing site-specific unnatural amino acid residues, methods for their preparation, and methods for their use
KR1020157000097A KR102172897B1 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
EP19154161.4A EP3505534A1 (en) 2012-06-08 2013-06-07 Antibodies comprising sitespecific nonnatural amino acid residues, methods of their preparation and methods of their use
DK13730764.1T DK2859017T3 (en) 2012-06-08 2013-06-07 ANTIBODIES INCLUDING PLACE-SPECIFIC NON-NATURAL AMINO ACID, PROCEDURE FOR MANUFACTURING ITS AND METHODS OF USE THEREOF
BR112014030278A BR112014030278A2 (en) 2012-06-08 2013-06-07 antibody and composition.
PL13730764T PL2859017T3 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
EP13730764.1A EP2859017B1 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
CA2875989A CA2875989A1 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
IL236111A IL236111B (en) 2012-06-08 2014-12-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
HK15103823.0A HK1203518A1 (en) 2012-06-08 2015-04-20 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
HRP20190475TT HRP20190475T1 (en) 2012-06-08 2019-03-11 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261657556P 2012-06-08 2012-06-08
US61/657,556 2012-06-08
US201261725433P 2012-11-12 2012-11-12
US61/725,433 2012-11-12

Publications (1)

Publication Number Publication Date
WO2013185115A1 true WO2013185115A1 (en) 2013-12-12

Family

ID=48670845

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/044843 WO2013185115A1 (en) 2012-06-08 2013-06-07 Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use

Country Status (18)

Country Link
US (3) US9738724B2 (en)
EP (2) EP3505534A1 (en)
JP (1) JP6498600B2 (en)
KR (1) KR102172897B1 (en)
CN (1) CN104583235B (en)
AU (1) AU2013270684B2 (en)
BR (1) BR112014030278A2 (en)
CA (1) CA2875989A1 (en)
DK (1) DK2859017T3 (en)
ES (1) ES2718478T3 (en)
HK (1) HK1203518A1 (en)
HR (1) HRP20190475T1 (en)
HU (1) HUE043552T2 (en)
IL (1) IL236111B (en)
PL (1) PL2859017T3 (en)
SG (1) SG11201408161RA (en)
SI (1) SI2859017T1 (en)
WO (1) WO2013185115A1 (en)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014124258A3 (en) * 2013-02-08 2014-11-20 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014124316A3 (en) * 2013-02-08 2014-11-27 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2015006555A3 (en) * 2013-07-10 2015-03-05 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
JP2015529208A (en) * 2012-08-31 2015-10-05 ストロ バイオファーマ インコーポレーテッド Modified amino acids containing azido groups
WO2015162293A1 (en) * 2014-04-25 2015-10-29 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
US9669106B2 (en) 2015-10-26 2017-06-06 Pierre Fabre Medicament Conjugate of monomethyl auristatin F and trastuzumab and its use for the treatment of cancer
WO2017132617A1 (en) 2016-01-27 2017-08-03 Sutro Biopharma, Inc. Anti-cd74 antibody conjugates, compositions comprising anti-cd74 antibody conjugates and methods of using anti-cd74 antibody conjugates
JP2018509933A (en) * 2015-02-16 2018-04-12 ロンザ リミテッドＬｏｎｚａ Ｌｉｍｉｔｅｄ Antibody for drug conjugation with mutated CL and / or CH1
WO2019023316A1 (en) 2017-07-26 2019-01-31 Sutro Biopharma, Inc. Methods of using anti-cd74 antibodies and antibody conjugates in treatment of t-cell lymphoma
CN109420167A (en) * 2017-08-28 2019-03-05 四川九章生物科技有限公司 A kind of combination medicine for treating tumour
WO2019055931A1 (en) 2017-09-18 2019-03-21 Sutro Biopharma, Inc. Anti- folate receptor alpha antibody conjugates and their uses
WO2020060944A1 (en) 2018-09-17 2020-03-26 Sutro Biopharma, Inc. Combination therapies with anti-folate receptor antibody conjugates
WO2020081493A1 (en) 2018-10-16 2020-04-23 Molecular Templates, Inc. Pd-l1 binding proteins
WO2020168017A1 (en) * 2019-02-12 2020-08-20 Ambrx, Inc. Compositions containing, methods and uses of antibody-tlr agonist conjugates
WO2020227105A1 (en) 2019-05-03 2020-11-12 Sutro Biopharma, Inc. Anti-bcma antibody conjugates
WO2020252043A1 (en) 2019-06-10 2020-12-17 Sutro Biopharma, Inc. 5H-PYRROLO[3,2-d]PYRIMIDINE-2,4-DIAMINO COMPOUNDS AND ANTIBODY CONJUGATES THEREOF
WO2020257235A1 (en) 2019-06-17 2020-12-24 Sutro Biopharma, Inc. 1-(4-(aminomethyl)benzyl)-2-butyl-2h-pyrazolo[3,4-c]quinolin-4-amine derivatives and related compounds as toll-like receptor (tlr) 7/8 agonists, as well as antibody drug conjugates thereof for use in cancer therapy and diagnosis
US10973922B2 (en) 2013-05-02 2021-04-13 Glykos Finland Oy Glycoprotein-toxic payload conjugates
US11149074B2 (en) 2016-05-02 2021-10-19 Ajinomoto Co., Inc. Azide group-containing Fc protein
WO2021216478A1 (en) 2020-04-22 2021-10-28 Merck Sharp & Dohme Corp. HUMAN INTERLEUKIN-2 CONJUGATES BIASED FOR THE INTERLEUKIN-2 RECEPTOR BETA GAMMAc DIMER AND CONJUGATED TO A NONPEPTIDIC, WATER-SOLUBLE POLYMER
US20210340586A1 (en) * 2020-04-30 2021-11-04 Sutro Biopharma, Inc. Methods of Producing Full-Length Antibodies Using E. coli
WO2024006542A1 (en) 2022-06-30 2024-01-04 Sutro Biopharma, Inc. Anti-ror1 antibodies and antibody conjugates, compositions comprising anti-ror1 antibodies or antibody conjugates, and methods of making and using anti-ror1 antibodies and antibody conjugates
US11958909B2 (en) 2012-06-08 2024-04-16 Sutro Biopharma, Inc. Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9956275B2 (en) 2011-01-31 2018-05-01 Kai Yuan Xu Methods of inhibiting platelet aggregation and preventing thrombosis using antibodies that bind (Na++K+)-ATPase beta subunit
KR20150008171A (en) * 2012-05-10 2015-01-21 자임워크스 인코포레이티드 Single-arm monovalent antibody constructs and uses thereof
EP2863955B1 (en) 2012-06-26 2016-11-23 Sutro Biopharma, Inc. Modified fc proteins comprising site-specific non-natural amino acid residues, conjugates of the same, methods of their preparation and methods of their use
WO2015013579A1 (en) 2013-07-26 2015-01-29 Update Pharma Inc. Compositions to improve the therapeutic benefit of bisantrene
EP3068430A4 (en) * 2013-11-13 2017-07-05 Zymeworks Inc. Methods using monovalent antigen binding constructs targeting her2
CA3184805A1 (en) 2014-12-04 2016-06-09 Celgene Corporation Biomolecule conjugates
TW201811824A (en) 2016-07-06 2018-04-01 美商西建公司 Antibodies with low immunogenicity and uses thereof
CN110612309A (en) 2017-03-27 2019-12-24 细胞基因公司 Methods and compositions for reducing immunogenicity
CN118652192A (en) 2017-05-24 2024-09-17 德克萨斯州大学系统董事会 Linker for antibody drug conjugates
JP2020534352A (en) 2017-09-07 2020-11-26 キュー バイオファーマ，インコーポレーテッド T cell regulatory multimeric polypeptide with conjugation site and how to use it
TW201930345A (en) 2017-12-27 2019-08-01 日商協和醱酵麒麟有限公司 Il-2 variant
US20220281949A1 (en) * 2019-07-30 2022-09-08 University Health Network Mhc class ii molecules and methods of use thereof
CN110551195B (en) * 2019-08-01 2022-08-09 天津科技大学 Alpha-synuclein aggregation-induced emission system and construction and application thereof
WO2021055816A1 (en) 2019-09-18 2021-03-25 Molecular Templates, Inc. Pd-l1 binding molecules comprising shiga toxin a subunit scaffolds
CN112552410A (en) * 2019-09-26 2021-03-26 三生国健药业（上海）股份有限公司 Antibody fusion protein, preparation method thereof and application thereof in anti-tumor
WO2021178597A1 (en) 2020-03-03 2021-09-10 Sutro Biopharma, Inc. Antibodies comprising site-specific glutamine tags, methods of their preparation and methods of their use
JP2023540526A (en) 2020-09-04 2023-09-25 ノヴァロック バイオセラピューティクス， リミテッド Nectin-4 antibody and its use
JP2023544254A (en) 2020-09-14 2023-10-23 ストロ バイオファーマ， インコーポレイテッド Large-scale antibody production method using cell-free protein synthesis system
CA3213295A1 (en) 2021-03-17 2022-09-22 Molecular Templates, Inc. Pd-l1 binding proteins comprising shiga toxin a subunit scaffolds and cd8+ t cell antigens

Citations (183)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4289872A (en) 1979-04-06 1981-09-15 Allied Corporation Macromolecular highly branched homogeneous compound based on lysine units
US4412989A (en) 1981-06-10 1983-11-01 Ajinomoto Company Incorporated Oxygen carrier
US4486414A (en) 1983-03-21 1984-12-04 Arizona Board Of Reagents Dolastatins A and B cell growth inhibitory substances
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4542225A (en) 1984-08-29 1985-09-17 Dana-Farber Cancer Institute, Inc. Acid-cleavable compound
EP0183503A2 (en) 1984-11-30 1986-06-04 Beecham Group Plc Conjugates of pharmaceutically useful proteins
US4625014A (en) 1984-07-10 1986-11-25 Dana-Farber Cancer Institute, Inc. Cell-delivery agent
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US4671958A (en) 1982-03-09 1987-06-09 Cytogen Corporation Antibody conjugates for the delivery of compounds to target sites
EP0229108A1 (en) 1985-06-26 1987-07-22 Cetus Corp Solubilization of proteins for pharmaceutical compositions using polymer conjugation.
US4753894A (en) 1984-02-08 1988-06-28 Cetus Corporation Monoclonal anti-human breast cancer antibodies
US4816444A (en) 1987-07-10 1989-03-28 Arizona Board Of Regents, Arizona State University Cell growth inhibitory substance
US4879278A (en) 1989-05-16 1989-11-07 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15
US4902502A (en) 1989-01-23 1990-02-20 Cetus Corporation Preparation of a polymer/interleukin-2 conjugate
WO1990005719A1 (en) 1988-11-23 1990-05-31 British Bio-Technology Limited Hydroxamic acid based collagenase inhibitors
US4943533A (en) 1984-03-01 1990-07-24 The Regents Of The University Of California Hybrid cell lines that produce monoclonal antibodies to epidermal growth factor receptor
WO1990013540A1 (en) 1989-04-19 1990-11-15 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
EP0400472A2 (en) 1989-05-27 1990-12-05 Sumitomo Pharmaceuticals Company, Limited Process for preparing polyethylene glycol derivatives and modified protein.
US4978744A (en) 1989-01-27 1990-12-18 Arizona Board Of Regents Synthesis of dolastatin 10
EP0402378A1 (en) 1988-01-20 1990-12-19 Cetus Corp Conjugation of polymer to colony stimulating factor-1.
US4986988A (en) 1989-05-18 1991-01-22 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13
EP0439508A1 (en) 1988-10-20 1991-08-07 PolyMASC Pharmaceuticals plc Polyethylene glycolcol (peg)-protein adducts and process for their fractionation
US5076973A (en) 1988-10-24 1991-12-31 Arizona Board Of Regents Synthesis of dolastatin 3
US5122614A (en) 1989-04-19 1992-06-16 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
US5138036A (en) 1989-11-13 1992-08-11 Arizona Board Of Regents Acting On Behalf Of Arizona State University Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14
WO1992016555A1 (en) 1991-03-18 1992-10-01 Enzon, Inc. Hydrazine containing conjugates of polypeptides and glycopolypeptides with polymers
EP0510356A1 (en) 1991-03-25 1992-10-28 F. Hoffmann-La Roche Ag Polyethylene glycol protein conjugates
US5219564A (en) 1990-07-06 1993-06-15 Enzon, Inc. Poly(alkylene oxide) amino acid copolymers and drug carriers and charged copolymers based thereon
US5229490A (en) 1987-05-06 1993-07-20 The Rockefeller University Multiple antigen peptide system
WO1993015189A1 (en) 1992-01-29 1993-08-05 Consiglio Nazionale Delle Ricerche A method to maintain the activity in polyethylene glycol-modified proteolytic enzymes
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
WO1993021259A1 (en) 1992-04-14 1993-10-28 Cornell Research Foundation Inc. Dendritic based macromolecules and method of production
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
WO1994004193A1 (en) 1992-08-21 1994-03-03 Enzon, Inc. Novel attachment of polyalkylene oxides to bio-effecting substances
WO1994009027A1 (en) 1992-10-13 1994-04-28 Enzon, Inc. Fractionation of polyalkylene oxide-conjugated hemoglobin solutions
US5324844A (en) 1989-04-19 1994-06-28 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
WO1994014758A1 (en) 1992-12-22 1994-07-07 Enzon, Inc. Aryl imidate activated polyalkylene oxides
EP0605963A2 (en) 1992-12-09 1994-07-13 Ortho Pharmaceutical Corporation Peg hydrazone and peg oxime linkage forming reagents and protein derivatives thereof
EP0606046A1 (en) 1993-01-06 1994-07-13 Ciba-Geigy Ag Arylsulfonamido-substituted hydroxamic acids
WO1994015625A1 (en) 1993-01-15 1994-07-21 Enzon, Inc. Factor viii - polymeric conjugates
WO1994017039A1 (en) 1993-01-19 1994-08-04 Enzon, Inc. Cyclic imide thione activated polyalkylene oxides
WO1994018247A1 (en) 1993-02-02 1994-08-18 Enzon, Inc. Azlactone activated polyalkylene oxides
WO1994028024A1 (en) 1993-06-01 1994-12-08 Enzon, Inc. Carbohydrate-modified polymer conjugates with erythropoietic activity
WO1995000162A1 (en) 1993-06-21 1995-01-05 Enzon, Inc. Site specific synthesis of conjugated peptides
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
WO1995006058A1 (en) 1993-08-24 1995-03-02 Polymasc Pharmaceuticals Plc Polymer modification
US5410024A (en) 1993-01-21 1995-04-25 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide amides
WO1995011924A1 (en) 1993-10-27 1995-05-04 Enzon, Inc. Non-antigenic branched polymer conjugates
WO1995013090A1 (en) 1993-11-10 1995-05-18 Enzon, Inc. Improved interferon polymer conjugates
WO1995013312A1 (en) 1993-11-12 1995-05-18 Shearwater Polymers, Inc. Water soluble active sulfones of poly(ethylene glycol)
WO1995020045A1 (en) 1994-01-21 1995-07-27 The Institute Of Cancer Research: Royal Cancer Hospital Antibodies to egf receptor and their antitumour effect
US5468478A (en) 1987-08-03 1995-11-21 Oxis International, Inc. Conjugates of superoxide dismutage coupled to high molecular weight polyalkylene glycols
US5473034A (en) 1994-03-18 1995-12-05 Hyogo Prefectural Government Method for producing protein-synthetic polymer conjugate and said conjugate produced thereby
WO1995033490A1 (en) 1994-06-02 1995-12-14 Enzon, Inc. Method of solubilizing substantially water insoluble materials
US5476653A (en) 1992-06-17 1995-12-19 Amgen Inc. Polyoxymethylene-oxyethylene copolymers in conjuction with biomolecules
WO1996000080A1 (en) 1994-06-24 1996-01-04 Enzon, Inc. Non-antigenic amine derived polymers and polymer conjugates
WO1996007670A1 (en) 1994-09-09 1996-03-14 Surface Engineering Technologies, Division Of Innerdyne, Inc. Electrophilic polyethylene oxides for the modification of polysaccharides, polypeptides (proteins) and surfaces
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5504191A (en) 1994-08-01 1996-04-02 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide methyl esters
WO1996013590A2 (en) 1994-10-21 1996-05-09 Innogenetics N.V. New sequences of hepatitis c virus genotypes and their use as prophylactic, therapeutic and diagnostic agents
US5516673A (en) 1993-02-15 1996-05-14 Bar Ilan University Bioactive conjugates of cellulose with amino compounds
US5521284A (en) 1994-08-01 1996-05-28 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide amides and esters
US5530097A (en) 1994-08-01 1996-06-25 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory peptide amides
WO1996021469A1 (en) 1995-01-10 1996-07-18 Shearwater Polymers, Inc. Multi-armed, monofunctional, and hydrolytically stable derivatives of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US5554725A (en) 1994-09-14 1996-09-10 Arizona Board Of Regents Acting On Behalf Of Arizona State University Synthesis of dolastatin 15
WO1996027583A1 (en) 1995-03-08 1996-09-12 Pfizer Inc. Arylsulfonylamino hydroxamic acid derivatives
US5558864A (en) 1991-03-06 1996-09-24 Merck Patent Gesellschaft Mit Beschrankter Haftung Humanized and chimeric anti-epidermal growth factor receptor monoclonal antibodies
WO1996029605A2 (en) 1995-03-14 1996-09-26 Corixa Corporation Compounds and methods for the dectection of t. cruzi infection
WO1996033172A1 (en) 1995-04-20 1996-10-24 Pfizer Inc. Arylsulfonyl hydroxamic acid derivatives as mmp and tnf inhibitors
WO1996040791A1 (en) 1995-06-07 1996-12-19 Novo Nordisk A/S Modification of polypeptides
WO1996040210A1 (en) 1995-06-07 1996-12-19 Imclone Systems Incorporated Antibody and antibody fragments for inhibiting the growth of tumors
WO1996041813A2 (en) 1994-11-09 1996-12-27 Offord Robin E Functionalized polymers for site-specific attachment
WO1997003106A1 (en) 1995-07-07 1997-01-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
US5599902A (en) 1994-11-10 1997-02-04 Arizona Board Of Regents Acting On Behalf Of Arizona State University Cancer inhibitory peptides
US5629384A (en) 1994-05-17 1997-05-13 Consiglio Nazionale Delle Ricerche Polymers of N-acryloylmorpholine activated at one end and conjugates with bioactive materials and surfaces
WO1997018832A1 (en) 1995-11-21 1997-05-29 Enzon, Inc. Interferon-polymer conjugates and process for preparing the same
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
EP0780386A1 (en) 1995-12-20 1997-06-25 F. Hoffmann-La Roche Ag Matrix metalloprotease inhibitors
WO1997022596A1 (en) 1995-12-18 1997-06-26 Zeneca Limited Quinazoline derivatives
WO1997030035A1 (en) 1996-02-13 1997-08-21 Zeneca Limited Quinazoline derivatives as vegf inhibitors
US5663149A (en) 1994-12-13 1997-09-02 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides
WO1997032607A2 (en) 1996-03-06 1997-09-12 Amgen Inc. Activated linkers and methods for making and purifying the same
WO1997032856A1 (en) 1996-03-05 1997-09-12 Zeneca Limited 4-anilinoquinazoline derivatives
US5677171A (en) 1988-01-12 1997-10-14 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
EP0809996A2 (en) 1996-05-31 1997-12-03 F. Hoffmann-La Roche Ag Interferon conjugates
EP0818442A2 (en) 1996-07-12 1998-01-14 Pfizer Inc. Cyclic sulphone derivatives as inhibitors of metalloproteinases and of the production of tumour necrosis factor
WO1998003516A1 (en) 1996-07-18 1998-01-29 Pfizer Inc. Phosphinate based inhibitors of matrix metalloproteases
WO1998005363A2 (en) 1996-08-02 1998-02-12 Ortho-Mcneil Pharmaceutical, Inc. Polypeptides having a single covalently bound n-terminal water-soluble polymer
WO1998007697A1 (en) 1996-08-23 1998-02-26 Pfizer Inc. Arylsulfonylamino hydroxamic acid derivatives
WO1998013354A1 (en) 1996-09-25 1998-04-02 Zeneca Limited Quinazoline derivatives and pharmaceutical compositions containing them
US5736137A (en) 1992-11-13 1998-04-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US5736625A (en) 1990-11-14 1998-04-07 Cargill, Incorporated Method for stabilizing proteins with saccharide linked protein polymer conjugates
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1998030566A1 (en) 1997-01-06 1998-07-16 Pfizer Inc. Cyclic sulfone derivatives
WO1998032466A1 (en) 1997-01-29 1998-07-30 Polymasc Pharmaceuticals Plc Pegylation process
US5789554A (en) 1994-08-12 1998-08-04 Immunomedics, Inc. Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells
WO1998033768A1 (en) 1997-02-03 1998-08-06 Pfizer Products Inc. Arylsulfonylamino hydroxamic acid derivatives
WO1998034918A1 (en) 1997-02-11 1998-08-13 Pfizer Inc. Arylsulfonyl hydroxamic acid derivatives
WO1998034915A1 (en) 1997-02-07 1998-08-13 Pfizer Inc. N-hydroxy-beta-sulfonyl-propionamide derivatives and their use as inhibitors of matrix metalloproteinases
WO1998035985A1 (en) 1997-02-12 1998-08-20 The Regents Of The University Of Michigan Protein markers for lung cancer and use thereof
WO1998041562A1 (en) 1997-03-20 1998-09-24 Enzon, Inc. Non-antigenic branched polymer conjugates
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5824778A (en) 1988-12-22 1998-10-20 Kirin-Amgen, Inc. Chemically-modified G-CSF
WO1998048837A1 (en) 1997-04-30 1998-11-05 Enzon, Inc. Polyalkylene oxide-modified single chain polypeptides
WO1999007675A1 (en) 1997-08-08 1999-02-18 Pfizer Products Inc. Aryloxyarylsulfonylamino hydroxamic acid derivatives
US5891996A (en) 1972-09-17 1999-04-06 Centro De Inmunologia Molecular Humanized and chimeric monoclonal antibodies that recognize epidermal growth factor receptor (EGF-R); diagnostic and therapeutic use
EP0921131A1 (en) 1997-06-06 1999-06-09 Kyowa Hakko Kogyo Co., Ltd. Chemically modified polypeptides
WO1999029667A1 (en) 1997-12-05 1999-06-17 Pfizer Limited Hydroxamic acid derivatives as matrix metalloprotease (mmp) inhibitors
WO1999032139A1 (en) 1997-12-19 1999-07-01 Shering Corporation Improved interferon polymer conjugates
WO1999032134A1 (en) 1997-12-19 1999-07-01 Enzon, Inc. Substantially pure histidine-linked protein polymer conjugates
WO1999032140A1 (en) 1997-12-19 1999-07-01 Enzon, Inc. Alpha-interferon-polymer-conjugates having enhanced biological activity and methods of preparing the same
EP0931788A2 (en) 1998-01-27 1999-07-28 Pfizer Limited Metalloprotease inhibitors
EP0945864A2 (en) 1998-03-26 1999-09-29 Sony Corporation Selecting video material
WO1999052910A1 (en) 1998-04-10 1999-10-21 Pfizer Products Inc. Bicyclic hydroxamic acid derivatives
WO1999052889A1 (en) 1998-04-10 1999-10-21 Pfizer Products Inc. (4-arylsulfonylamino)-tetrahydropyran-4-carboxylic acid hydroxamides
US5980948A (en) 1996-08-16 1999-11-09 Osteotech, Inc. Polyetherester copolymers as drug delivery matrices
US5990237A (en) 1997-05-21 1999-11-23 Shearwater Polymers, Inc. Poly(ethylene glycol) aldehyde hydrates and related polymers and applications in modifying amines
US6004573A (en) 1997-10-03 1999-12-21 Macromed, Inc. Biodegradable low molecular weight triblock poly(lactide-co-glycolide) polyethylene glycol copolymers having reverse thermal gelation properties
US6034065A (en) 1992-12-03 2000-03-07 Arizona Board Of Regents Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10
EP1004578A2 (en) 1998-11-05 2000-05-31 Pfizer Products Inc. 5-oxo-pyrrolidine-2-carboxylic acid hydroxamide derivatives
WO2000034337A1 (en) 1998-12-10 2000-06-15 Tsukuba Research Laboratory, Toagosei Co., Ltd. Humanized monoclonal antibodies against vascular endothelial cell growth factor
WO2000047212A1 (en) 1999-02-10 2000-08-17 Astrazeneca Ab Quinazoline derivatives as angiogenesis inhibitors
US6129912A (en) 1997-09-26 2000-10-10 Uab Research Foundation Polyethylene glycol-protein compositions which reduce the antigenic display of red blood cells
US6130237A (en) 1996-09-12 2000-10-10 Cancer Research Campaign Technology Limited Condensed N-aclyindoles as antitumor agents
US6201072B1 (en) 1997-10-03 2001-03-13 Macromed, Inc. Biodegradable low molecular weight triblock poly(lactide-co- glycolide) polyethylene glycol copolymers having reverse thermal gelation properties
US6214966B1 (en) 1996-09-26 2001-04-10 Shearwater Corporation Soluble, degradable poly(ethylene glycol) derivatives for controllable release of bound molecules into solution
WO2001032651A1 (en) 1999-11-05 2001-05-10 Astrazeneca Ab Quinazoline derivatives as vegf inhibitors
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US6239104B1 (en) 1997-02-25 2001-05-29 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18
US6258562B1 (en) 1996-02-09 2001-07-10 Basf Aktiengesellschaft Human antibodies that bind human TNFα
WO2001060814A2 (en) 2000-02-15 2001-08-23 Sugen, Inc. Pyrrole substituted 2-indolinone protein kinase inhibitors
US6281211B1 (en) 1999-02-04 2001-08-28 Euro-Celtique S.A. Substituted semicarbazides and the use thereof
WO2001062931A2 (en) 2000-02-25 2001-08-30 The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services ANTI-EGFRvIII SCFVS WITH IMPROVED CYTOTOXICITY AND YIELD, IMMUNOTOXINS BASED THEREON, AND METHODS OF USE THEREOF
US20010027217A1 (en) 1998-12-28 2001-10-04 Thomas Jaetsch Chemical formulations for incorporation into adhesives used in the production of wooden materials or wood composites
US6306821B1 (en) 1999-04-16 2001-10-23 Wm. Marsh Rice University Functionalized poly(propylene fumarate) and poly(propylene fumarate-co-ethylene glycol)
US20010044526A1 (en) 2000-02-22 2001-11-22 Shearwater Corporation N-maleimidyl polymer derivatives
WO2001088138A1 (en) 2000-05-19 2001-11-22 Scancell Limited Humanised antibodies to the epidermal growth factor receptor
US6323315B1 (en) 1999-09-10 2001-11-27 Basf Aktiengesellschaft Dolastatin peptides
US20010056171A1 (en) 1999-12-22 2001-12-27 Shearwater Corporation Method for the preparation of 1-benzotriazolyl carbonate esters of poly(ethylene glycol)
US20020002250A1 (en) 1999-12-22 2002-01-03 Shearwater Corporation Sterically hindered poly(ethylene glycol) alkanoic acids and derivatives thereof
US20020037949A1 (en) 1998-03-12 2002-03-28 Shearwater Corporation Poly(ethylene glycol) derivatives with proximal reactive groups
US20020052009A1 (en) 1997-11-03 2002-05-02 Hans Hornauer Polyethylene glycol-derivatized biomolecules and their use in heterogeneous detection methods
US20020072573A1 (en) 1997-11-06 2002-06-13 Shearwater Corporation Heterobifunctional poly(ethylene glycol) derivatives and methods for their preparation
US20020082345A1 (en) 2000-12-18 2002-06-27 Shearwater Corporation Synthesis of high molecular weight non-peptidic polymer derivatives
US6420339B1 (en) 1998-10-14 2002-07-16 Amgen Inc. Site-directed dual pegylation of proteins for improved bioactivity and biocompatibility
US6423685B1 (en) 1998-03-05 2002-07-23 Chiron Corporation Method for increasing the serum half-life of a biologically active molecule
US6436386B1 (en) 2000-11-14 2002-08-20 Shearwater Corporation Hydroxyapatite-targeting poly (ethylene glycol) and related polymers
US6451346B1 (en) 1998-12-23 2002-09-17 Amgen Inc Biodegradable pH/thermosensitive hydrogels for sustained delivery of biologically active agents
US6461603B2 (en) 2000-02-28 2002-10-08 Shearwater Corporation Water-soluble polymer conjugates of artelinic acid
US20020156047A1 (en) 2001-01-19 2002-10-24 Shearwater Corporation Multi-arm block copolymers as drug delivery vehicles
WO2002085923A2 (en) 2001-04-19 2002-10-31 The Scripps Research Institute In vivo incorporation of unnatural amino acids
WO2002088172A2 (en) 2001-04-30 2002-11-07 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
US20030023023A1 (en) 1999-12-10 2003-01-30 Shearwater Corporation Hydrolytically degradable polymers and hydrogels made therefrom
US6552167B1 (en) 1998-08-28 2003-04-22 Gryphon Therapeutics, Inc. Polyamide chains of precise length
US20030083263A1 (en) 2001-04-30 2003-05-01 Svetlana Doronina Pentapeptide compounds and uses related thereto
WO2003039486A2 (en) 2001-11-09 2003-05-15 Idec Pharmaceuticals Corporation Anti-cd80 antibody having adcc activity for adcc mediated killing of b cell lymphoma cells alone or in combination with other therapies
US20030105224A1 (en) 2001-10-09 2003-06-05 Shearwater Corporation Thioester polymer derivatives and method of modifying the N-terminus of a polypeptide therewith
US20030143596A1 (en) 2001-11-07 2003-07-31 Shearwater Corporation Branched polymers and their conjugates
US20030162949A1 (en) 1997-07-14 2003-08-28 Bolder Biotechnology, Inc. Cysteine variants of granulocyte-macrophage colony-stimulating factor
US6646110B2 (en) 2000-01-10 2003-11-11 Maxygen Holdings Ltd. G-CSF polypeptides and conjugates
US20040001838A1 (en) 2001-12-21 2004-01-01 Immunogen, Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
US20040013637A1 (en) 1999-12-23 2004-01-22 Nektar Therapeutics Al, Corportion Hydrolytically degradable carbamate derivatives of poly(ethylene glycol)
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
WO2004016778A1 (en) 2002-08-19 2004-02-26 The Board Of Trustees Of The Leland Stanford Junior University Improved methods of in vitro protein synthesis
EP1444268A2 (en) 2001-11-12 2004-08-11 Gundram Jung Bispecific anti-cd28 antibody molecule
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
US20050147610A1 (en) 2003-11-12 2005-07-07 Tariq Ghayur IL-18 binding proteins
US20050238649A1 (en) 2003-11-06 2005-10-27 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005111082A1 (en) 2004-04-30 2005-11-24 Inserm (Institut National De La Sante Et De La Recherche Medicale) Anti-tfr antibody.
US20060018899A1 (en) 2004-07-22 2006-01-26 Genentech, Inc. HER2 antibody composition
US7247301B2 (en) 2001-06-13 2007-07-24 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (EGFR)
WO2007124299A2 (en) 2006-04-21 2007-11-01 Novartis Ag Antagonist anti-cd40 antibody pharmaceutical compositions
US20080085277A1 (en) 2004-06-18 2008-04-10 Ambrx, Inc. Novel antigen-binding polypeptides and their uses
WO2008066583A2 (en) 2006-06-29 2008-06-05 The Board Of Trustees Of The Leland Stanford Junior University Cell-free synthesis of proteins containing unnatural amino acids
US20080317670A1 (en) 2005-12-14 2008-12-25 Ambrx, Inc. Compositions Containing, Methods Involving, and Uses of Non-Natural Amino Acids and Polypeptides
US20090035836A1 (en) * 2004-03-30 2009-02-05 California Institute Of Technology Modulating ph-sensitive binding using non-natural amino acids
US20090093405A1 (en) 2006-01-19 2009-04-09 Ambrx, Inc. Non-Natural Amino Acid Polypeptides Having Modified Immunogenicity
US20100093082A1 (en) 2006-09-08 2010-04-15 Ambrx, Inc. Site Specific Incorporation of Non-Natural Amino Acids by Vertebrate Cells
US20100098630A1 (en) 2006-12-28 2010-04-22 Ambrx, Inc. Phenazine and Quinoxaline Substituted Amino Acids and Polypeptides
WO2010051056A2 (en) * 2008-03-11 2010-05-06 Ambrx, Inc. ANTI-FcεRI POLYPEPTIDES AND THEIR USES
WO2010081110A1 (en) 2009-01-12 2010-07-15 Sutro Biopharma, Inc. Dual charging system for selectively introducing non-native amino acids into proteins using an in vitro synthesis method
WO2012032181A2 (en) * 2010-09-10 2012-03-15 Allozyne, Inc Novel antibody derivatives
WO2013068874A1 (en) * 2011-11-11 2013-05-16 Pfizer Inc. Antibody-drug conjugates

Family Cites Families (60)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SU11248A1 (en) 1927-03-29 1929-09-30 В.С. Григорьев Anthracene cleaning method
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5175384A (en) 1988-12-05 1992-12-29 Genpharm International Transgenic mice depleted in mature t-cells and methods for making transgenic mice
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
LU91067I2 (en) 1991-06-14 2004-04-02 Genentech Inc Trastuzumab and its variants and immunochemical derivatives including immotoxins
ES2136092T3 (en) 1991-09-23 1999-11-16 Medical Res Council PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES.
ATE244763T1 (en) 1992-02-11 2003-07-15 Cell Genesys Inc ACHIEVEMENT OF HOMOZYGOTE THROUGH TARGETED GENETIC EVENTS
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US5869644A (en) 1992-04-15 1999-02-09 The Johns Hopkins University Synthesis of diverse and useful collections of oligonucleotidies
US5534615A (en) 1994-04-25 1996-07-09 Genentech, Inc. Cardiac hypertrophy factor and uses therefor
EP0953639A1 (en) 1998-04-30 1999-11-03 Boehringer Ingelheim International GmbH FAPalpha-specific antibody with improved producibility
DK1308456T3 (en) 1998-05-06 2007-12-27 Genentech Inc Antibody purification by ion exchange chromatography
US7829064B2 (en) 1999-05-10 2010-11-09 Immunomedics, Inc. Anti-CD74 immunoconjugates and methods
US6924359B1 (en) 1999-07-01 2005-08-02 Yale University Neovascular-targeted immunoconjugates
EP1360288B1 (en) 2000-12-18 2011-02-16 Dyax Corp. Focused libraries of genetic packages
US20040110226A1 (en) 2002-03-01 2004-06-10 Xencor Antibody optimization
US20040202666A1 (en) 2003-01-24 2004-10-14 Immunomedics, Inc. Anti-cancer anthracycline drug-antibody conjugates
JP4870569B2 (en) 2003-11-13 2012-02-08 ハンミ ホールディングス カンパニー リミテッド Protein conjugate using immunoglobulin fragment and method for producing the same
EP2357201B1 (en) 2004-04-13 2017-08-30 F. Hoffmann-La Roche AG Anti-P-selectin antibodies
US20060074225A1 (en) 2004-09-14 2006-04-06 Xencor, Inc. Monomeric immunoglobulin Fc domains
TWI380996B (en) 2004-09-17 2013-01-01 Hoffmann La Roche Anti-ox40l antibodies
MX2007004892A (en) 2004-10-27 2007-08-16 Scripps Research Inst Orthogonal translation components for the in vivo incorporation of unnatural amino acids.
US7385028B2 (en) 2004-12-22 2008-06-10 Ambrx, Inc Derivatization of non-natural amino acids and polypeptides
KR100754667B1 (en) 2005-04-08 2007-09-03 한미약품 주식회사 Immunoglobulin Fc fragment modified by non-peptide polymer and pharmaceutical composition comprising the same
US8008443B2 (en) 2005-04-26 2011-08-30 Medimmune, Llc Modulation of antibody effector function by hinge domain engineering
WO2008020827A2 (en) * 2005-08-01 2008-02-21 Biogen Idec Ma Inc. Altered polypeptides, immunoconjugates thereof, and methods related thereto
US8008453B2 (en) 2005-08-12 2011-08-30 Amgen Inc. Modified Fc molecules
DK1931709T3 (en) 2005-10-03 2017-03-13 Xencor Inc FC VARIETIES WITH OPTIMIZED FC RECEPTOR BINDING PROPERTIES
AU2007248680C1 (en) 2006-05-02 2014-01-23 Allozyne, Inc. Non-natural amino acid substituted polypeptides
AU2007292903B2 (en) 2006-09-08 2012-03-29 Ambrx, Inc. Modified human plasma polypeptide or Fc scaffolds and their uses
WO2008134761A2 (en) 2007-04-30 2008-11-06 Intezyne Technologies, Inc. Modification of biological targeting groups for the treatment of cancer
US8691730B2 (en) 2007-09-14 2014-04-08 Adimab, Llc Rationally designed, synthetic antibody libraries and uses therefor
US8937161B2 (en) 2007-10-19 2015-01-20 Genentech, Inc. Cysteine engineered anti-TENB2 antibodies and antibody drug conjugates
EP2244729B1 (en) * 2008-01-18 2016-11-02 MedImmune, LLC Cysteine engineered antibodies for site-specific conjugation
WO2010006214A1 (en) 2008-07-09 2010-01-14 Ambrx, Inc. Fgf-21 neutralizing antibodies and their uses
JP2012515556A (en) 2009-01-23 2012-07-12 バイオジェン・アイデック・エムエイ・インコーポレイテッド Stabilized Fc polypeptides with reduced effector function and methods of use
GB2470770A (en) 2009-06-04 2010-12-08 Medical Res Council Incorporation of unnatural amino acids having an orthogonal functional group into polypeptides using orthogonal tRNA/tRNA synthetase pairs
EP2648749A2 (en) 2010-12-08 2013-10-16 Stem Centrx, Inc. Novel modulators and methods of use
CN103458930B (en) 2011-02-01 2019-10-15 健玛保 For the human antibody and antibody-drug conjugates of CD74
ES2721882T3 (en) 2011-12-23 2019-08-06 Pfizer Constant regions of genetically engineered antibody for site-specific conjugation and procedures and uses thereof
CN102627615B (en) 2012-03-23 2014-01-01 兰州大学 Novel compound L-4-terazine-phenylalanine, preparation method and application thereof
AU2013270684B2 (en) 2012-06-08 2018-04-19 Sutro Biopharma, Inc. Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
EP2863955B1 (en) 2012-06-26 2016-11-23 Sutro Biopharma, Inc. Modified fc proteins comprising site-specific non-natural amino acid residues, conjugates of the same, methods of their preparation and methods of their use
JP6826367B2 (en) 2012-08-31 2021-02-03 ストロ バイオファーマ インコーポレーテッド Modified amino acids containing azide groups
SG10201702387YA (en) 2012-09-24 2017-04-27 Medimmune Ltd Cell lines
WO2014065860A1 (en) 2012-10-24 2014-05-01 The General Hospital Corporation Functionalized 1,2,4,5-tetrazine compounds for use in bioorthogonal coupling reactions
ES2878749T3 (en) 2013-02-20 2021-11-19 Innate Pharma A compound that specifically binds to KIR3DL2 for use in the treatment of peripheral T-cell lymphoma
EP3019522B1 (en) 2013-07-10 2017-12-13 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
WO2016014434A2 (en) 2014-07-22 2016-01-28 Sutro Biopharma, Inc. Anti-cd74 antibodies, compositions comprising anti-cd74 antibodies and methods of using anti-cd74 antibodies
SG11201703192SA (en) 2014-11-21 2017-05-30 Bristol Myers Squibb Co Antibodies against cd73 and uses thereof
JP6883518B2 (en) 2015-01-30 2021-06-09 ストロ バイオファーマ インコーポレーテッド Conjugated and therapeutic hemiasterin derivatives
CN106146663B (en) 2015-04-10 2019-11-08 北京大学 Novel antibodies-drug conjugates of unnatural amino acid label and its preparation
CN114796520A (en) 2016-01-27 2022-07-29 苏特罗生物制药公司 anti-CD 74 antibody conjugates, compositions comprising anti-CD 74 antibody conjugates, and methods of use of anti-CD 74 antibody conjugates
TW201801751A (en) 2016-05-13 2018-01-16 塔維達治療公司 Targeted constructs and formulations thereof
WO2018187074A1 (en) 2017-04-03 2018-10-11 Immunomedics, Inc. Subcutaneous administration of antibody-drug conjugates for cancer therapy
EP3658588A1 (en) 2017-07-26 2020-06-03 Sutro Biopharma, Inc. Methods of using anti-cd74 antibodies and antibody conjugates in treatment of t-cell lymphoma

Patent Citations (220)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5891996A (en) 1972-09-17 1999-04-06 Centro De Inmunologia Molecular Humanized and chimeric monoclonal antibodies that recognize epidermal growth factor receptor (EGF-R); diagnostic and therapeutic use
US4289872A (en) 1979-04-06 1981-09-15 Allied Corporation Macromolecular highly branched homogeneous compound based on lysine units
US4412989A (en) 1981-06-10 1983-11-01 Ajinomoto Company Incorporated Oxygen carrier
US4671958A (en) 1982-03-09 1987-06-09 Cytogen Corporation Antibody conjugates for the delivery of compounds to target sites
US4486414A (en) 1983-03-21 1984-12-04 Arizona Board Of Reagents Dolastatins A and B cell growth inhibitory substances
US4753894A (en) 1984-02-08 1988-06-28 Cetus Corporation Monoclonal anti-human breast cancer antibodies
US4943533A (en) 1984-03-01 1990-07-24 The Regents Of The University Of California Hybrid cell lines that produce monoclonal antibodies to epidermal growth factor receptor
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4625014A (en) 1984-07-10 1986-11-25 Dana-Farber Cancer Institute, Inc. Cell-delivery agent
US4542225A (en) 1984-08-29 1985-09-17 Dana-Farber Cancer Institute, Inc. Acid-cleavable compound
US4618492A (en) 1984-08-29 1986-10-21 Dana-Farber Cancer Institute, Inc. Acid-cleavable compound
EP0183503A2 (en) 1984-11-30 1986-06-04 Beecham Group Plc Conjugates of pharmaceutically useful proteins
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
EP0229108A1 (en) 1985-06-26 1987-07-22 Cetus Corp Solubilization of proteins for pharmaceutical compositions using polymer conjugation.
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5229490A (en) 1987-05-06 1993-07-20 The Rockefeller University Multiple antigen peptide system
US4816444A (en) 1987-07-10 1989-03-28 Arizona Board Of Regents, Arizona State University Cell growth inhibitory substance
US5468478A (en) 1987-08-03 1995-11-21 Oxis International, Inc. Conjugates of superoxide dismutage coupled to high molecular weight polyalkylene glycols
US6165464A (en) 1988-01-12 2000-12-26 Genetech, Inc. Monoclonal antibodies directed to the HER2 receptor
US5677171A (en) 1988-01-12 1997-10-14 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
EP0402378A1 (en) 1988-01-20 1990-12-19 Cetus Corp Conjugation of polymer to colony stimulating factor-1.
EP0439508A1 (en) 1988-10-20 1991-08-07 PolyMASC Pharmaceuticals plc Polyethylene glycolcol (peg)-protein adducts and process for their fractionation
US5076973A (en) 1988-10-24 1991-12-31 Arizona Board Of Regents Synthesis of dolastatin 3
WO1990005719A1 (en) 1988-11-23 1990-05-31 British Bio-Technology Limited Hydroxamic acid based collagenase inhibitors
US5824778A (en) 1988-12-22 1998-10-20 Kirin-Amgen, Inc. Chemically-modified G-CSF
US4902502A (en) 1989-01-23 1990-02-20 Cetus Corporation Preparation of a polymer/interleukin-2 conjugate
US4978744A (en) 1989-01-27 1990-12-18 Arizona Board Of Regents Synthesis of dolastatin 10
US5122614A (en) 1989-04-19 1992-06-16 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
US5808096A (en) 1989-04-19 1998-09-15 Enzon, Inc. Process for preparing active carbonates of polyalkylene oxides for modification of polypeptides
WO1990013540A1 (en) 1989-04-19 1990-11-15 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
US5324844A (en) 1989-04-19 1994-06-28 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
US5612460A (en) 1989-04-19 1997-03-18 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
US4879278A (en) 1989-05-16 1989-11-07 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15
US4986988A (en) 1989-05-18 1991-01-22 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13
EP0400472A2 (en) 1989-05-27 1990-12-05 Sumitomo Pharmaceuticals Company, Limited Process for preparing polyethylene glycol derivatives and modified protein.
US5138036A (en) 1989-11-13 1992-08-11 Arizona Board Of Regents Acting On Behalf Of Arizona State University Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14
US5219564A (en) 1990-07-06 1993-06-15 Enzon, Inc. Poly(alkylene oxide) amino acid copolymers and drug carriers and charged copolymers based thereon
US5736625A (en) 1990-11-14 1998-04-07 Cargill, Incorporated Method for stabilizing proteins with saccharide linked protein polymer conjugates
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5558864A (en) 1991-03-06 1996-09-24 Merck Patent Gesellschaft Mit Beschrankter Haftung Humanized and chimeric anti-epidermal growth factor receptor monoclonal antibodies
WO1992016555A1 (en) 1991-03-18 1992-10-01 Enzon, Inc. Hydrazine containing conjugates of polypeptides and glycopolypeptides with polymers
US5849860A (en) 1991-03-25 1998-12-15 Hoffmann-La Roche Inc. Polyethylene-protein conjugates
US5834594A (en) 1991-03-25 1998-11-10 Hoffman-La Roche Inc. Polyethylene-protein conjugates
US5747646A (en) 1991-03-25 1998-05-05 Hoffmann-La Roche Inc. Polyethylene-protein conjugates
EP0510356A1 (en) 1991-03-25 1992-10-28 F. Hoffmann-La Roche Ag Polyethylene glycol protein conjugates
US5559213A (en) 1991-03-25 1996-09-24 Hoffmann-La Roche Inc. Polyethylene-protein conjugates
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
WO1993015189A1 (en) 1992-01-29 1993-08-05 Consiglio Nazionale Delle Ricerche A method to maintain the activity in polyethylene glycol-modified proteolytic enzymes
WO1993021259A1 (en) 1992-04-14 1993-10-28 Cornell Research Foundation Inc. Dendritic based macromolecules and method of production
US5476653A (en) 1992-06-17 1995-12-19 Amgen Inc. Polyoxymethylene-oxyethylene copolymers in conjuction with biomolecules
WO1994004193A1 (en) 1992-08-21 1994-03-03 Enzon, Inc. Novel attachment of polyalkylene oxides to bio-effecting substances
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
WO1994009027A1 (en) 1992-10-13 1994-04-28 Enzon, Inc. Fractionation of polyalkylene oxide-conjugated hemoglobin solutions
US5736137A (en) 1992-11-13 1998-04-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US6034065A (en) 1992-12-03 2000-03-07 Arizona Board Of Regents Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10
EP0605963A2 (en) 1992-12-09 1994-07-13 Ortho Pharmaceutical Corporation Peg hydrazone and peg oxime linkage forming reagents and protein derivatives thereof
WO1994014758A1 (en) 1992-12-22 1994-07-07 Enzon, Inc. Aryl imidate activated polyalkylene oxides
EP0606046A1 (en) 1993-01-06 1994-07-13 Ciba-Geigy Ag Arylsulfonamido-substituted hydroxamic acids
WO1994015625A1 (en) 1993-01-15 1994-07-21 Enzon, Inc. Factor viii - polymeric conjugates
WO1994017039A1 (en) 1993-01-19 1994-08-04 Enzon, Inc. Cyclic imide thione activated polyalkylene oxides
US5410024A (en) 1993-01-21 1995-04-25 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1994018247A1 (en) 1993-02-02 1994-08-18 Enzon, Inc. Azlactone activated polyalkylene oxides
US5516673A (en) 1993-02-15 1996-05-14 Bar Ilan University Bioactive conjugates of cellulose with amino compounds
WO1994028024A1 (en) 1993-06-01 1994-12-08 Enzon, Inc. Carbohydrate-modified polymer conjugates with erythropoietic activity
WO1995000162A1 (en) 1993-06-21 1995-01-05 Enzon, Inc. Site specific synthesis of conjugated peptides
WO1995006058A1 (en) 1993-08-24 1995-03-02 Polymasc Pharmaceuticals Plc Polymer modification
WO1995011924A1 (en) 1993-10-27 1995-05-04 Enzon, Inc. Non-antigenic branched polymer conjugates
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
WO1995013090A1 (en) 1993-11-10 1995-05-18 Enzon, Inc. Improved interferon polymer conjugates
WO1995013312A1 (en) 1993-11-12 1995-05-18 Shearwater Polymers, Inc. Water soluble active sulfones of poly(ethylene glycol)
US5739208A (en) 1993-11-12 1998-04-14 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US5446090A (en) 1993-11-12 1995-08-29 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US6610281B2 (en) 1993-11-12 2003-08-26 Shearwater Corporation Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules
US5900461A (en) 1993-11-12 1999-05-04 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
WO1995020045A1 (en) 1994-01-21 1995-07-27 The Institute Of Cancer Research: Royal Cancer Hospital Antibodies to egf receptor and their antitumour effect
US5473034A (en) 1994-03-18 1995-12-05 Hyogo Prefectural Government Method for producing protein-synthetic polymer conjugate and said conjugate produced thereby
US5629384A (en) 1994-05-17 1997-05-13 Consiglio Nazionale Delle Ricerche Polymers of N-acryloylmorpholine activated at one end and conjugates with bioactive materials and surfaces
WO1995033490A1 (en) 1994-06-02 1995-12-14 Enzon, Inc. Method of solubilizing substantially water insoluble materials
WO1996000080A1 (en) 1994-06-24 1996-01-04 Enzon, Inc. Non-antigenic amine derived polymers and polymer conjugates
US5530097A (en) 1994-08-01 1996-06-25 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory peptide amides
US5521284A (en) 1994-08-01 1996-05-28 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide amides and esters
US5665860A (en) 1994-08-01 1997-09-09 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory peptide amides
US5504191A (en) 1994-08-01 1996-04-02 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide methyl esters
US5789554A (en) 1994-08-12 1998-08-04 Immunomedics, Inc. Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells
WO1996007670A1 (en) 1994-09-09 1996-03-14 Surface Engineering Technologies, Division Of Innerdyne, Inc. Electrophilic polyethylene oxides for the modification of polysaccharides, polypeptides (proteins) and surfaces
US5650234A (en) 1994-09-09 1997-07-22 Surface Engineering Technologies, Division Of Innerdyne, Inc. Electrophilic polyethylene oxides for the modification of polysaccharides, polypeptides (proteins) and surfaces
US5554725A (en) 1994-09-14 1996-09-10 Arizona Board Of Regents Acting On Behalf Of Arizona State University Synthesis of dolastatin 15
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
WO1996013590A2 (en) 1994-10-21 1996-05-09 Innogenetics N.V. New sequences of hepatitis c virus genotypes and their use as prophylactic, therapeutic and diagnostic agents
WO1996041813A2 (en) 1994-11-09 1996-12-27 Offord Robin E Functionalized polymers for site-specific attachment
US5599902A (en) 1994-11-10 1997-02-04 Arizona Board Of Regents Acting On Behalf Of Arizona State University Cancer inhibitory peptides
US6506883B2 (en) 1994-11-18 2003-01-14 Centro De Inmunologia Molecular Humanized and chimeric monoclonal antibodies that recognize epidermal growth factor receptor (EGF-R); diagnostic and therapeutic use
US5663149A (en) 1994-12-13 1997-09-02 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides
WO1996021469A1 (en) 1995-01-10 1996-07-18 Shearwater Polymers, Inc. Multi-armed, monofunctional, and hydrolytically stable derivatives of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US20030114647A1 (en) 1995-01-10 2003-06-19 Shearwater Corporation Multi-armed, monofunctional, and hydrolytically stable derivatives of poly (ethylene glycol) and related polymers for modification of surfaces and molecules
WO1996027583A1 (en) 1995-03-08 1996-09-12 Pfizer Inc. Arylsulfonylamino hydroxamic acid derivatives
US5863949A (en) 1995-03-08 1999-01-26 Pfizer Inc Arylsulfonylamino hydroxamic acid derivatives
WO1996029605A2 (en) 1995-03-14 1996-09-26 Corixa Corporation Compounds and methods for the dectection of t. cruzi infection
US5861510A (en) 1995-04-20 1999-01-19 Pfizer Inc Arylsulfonyl hydroxamic acid derivatives as MMP and TNF inhibitors
WO1996033172A1 (en) 1995-04-20 1996-10-24 Pfizer Inc. Arylsulfonyl hydroxamic acid derivatives as mmp and tnf inhibitors
WO1996040791A1 (en) 1995-06-07 1996-12-19 Novo Nordisk A/S Modification of polypeptides
WO1996040210A1 (en) 1995-06-07 1996-12-19 Imclone Systems Incorporated Antibody and antibody fragments for inhibiting the growth of tumors
US5672662A (en) 1995-07-07 1997-09-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
WO1997003106A1 (en) 1995-07-07 1997-01-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
WO1997018832A1 (en) 1995-11-21 1997-05-29 Enzon, Inc. Interferon-polymer conjugates and process for preparing the same
WO1997022596A1 (en) 1995-12-18 1997-06-26 Zeneca Limited Quinazoline derivatives
EP0780386A1 (en) 1995-12-20 1997-06-25 F. Hoffmann-La Roche Ag Matrix metalloprotease inhibitors
US6258562B1 (en) 1996-02-09 2001-07-10 Basf Aktiengesellschaft Human antibodies that bind human TNFα
WO1997030035A1 (en) 1996-02-13 1997-08-21 Zeneca Limited Quinazoline derivatives as vegf inhibitors
WO1997032856A1 (en) 1996-03-05 1997-09-12 Zeneca Limited 4-anilinoquinazoline derivatives
WO1997032607A2 (en) 1996-03-06 1997-09-12 Amgen Inc. Activated linkers and methods for making and purifying the same
EP0809996A2 (en) 1996-05-31 1997-12-03 F. Hoffmann-La Roche Ag Interferon conjugates
EP0818442A2 (en) 1996-07-12 1998-01-14 Pfizer Inc. Cyclic sulphone derivatives as inhibitors of metalloproteinases and of the production of tumour necrosis factor
WO1998003516A1 (en) 1996-07-18 1998-01-29 Pfizer Inc. Phosphinate based inhibitors of matrix metalloproteases
WO1998005363A2 (en) 1996-08-02 1998-02-12 Ortho-Mcneil Pharmaceutical, Inc. Polypeptides having a single covalently bound n-terminal water-soluble polymer
US5980948A (en) 1996-08-16 1999-11-09 Osteotech, Inc. Polyetherester copolymers as drug delivery matrices
WO1998007697A1 (en) 1996-08-23 1998-02-26 Pfizer Inc. Arylsulfonylamino hydroxamic acid derivatives
US6130237A (en) 1996-09-12 2000-10-10 Cancer Research Campaign Technology Limited Condensed N-aclyindoles as antitumor agents
WO1998013354A1 (en) 1996-09-25 1998-04-02 Zeneca Limited Quinazoline derivatives and pharmaceutical compositions containing them
US20030220447A1 (en) 1996-09-26 2003-11-27 Shearwater Corporation Soluble, degradable poly (ethylene glycol) derivatives for controllable release of bound molecules into solution
US6515100B2 (en) 1996-09-26 2003-02-04 Shearwater Corporation Soluble, degradable poly (ethylene glycol) derivatives for controllable release of bound molecules into solution
US20010021763A1 (en) 1996-09-26 2001-09-13 Shearwater Corporation Soluble, degradable poly (ethylene glycol) derivatives for controllable release of bound molecules into solution
US6214966B1 (en) 1996-09-26 2001-04-10 Shearwater Corporation Soluble, degradable poly(ethylene glycol) derivatives for controllable release of bound molecules into solution
WO1998030566A1 (en) 1997-01-06 1998-07-16 Pfizer Inc. Cyclic sulfone derivatives
WO1998032466A1 (en) 1997-01-29 1998-07-30 Polymasc Pharmaceuticals Plc Pegylation process
WO1998033768A1 (en) 1997-02-03 1998-08-06 Pfizer Products Inc. Arylsulfonylamino hydroxamic acid derivatives
WO1998034915A1 (en) 1997-02-07 1998-08-13 Pfizer Inc. N-hydroxy-beta-sulfonyl-propionamide derivatives and their use as inhibitors of matrix metalloproteinases
WO1998034918A1 (en) 1997-02-11 1998-08-13 Pfizer Inc. Arylsulfonyl hydroxamic acid derivatives
WO1998035985A1 (en) 1997-02-12 1998-08-20 The Regents Of The University Of Michigan Protein markers for lung cancer and use thereof
US6239104B1 (en) 1997-02-25 2001-05-29 Arizona Board Of Regents Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18
WO1998041562A1 (en) 1997-03-20 1998-09-24 Enzon, Inc. Non-antigenic branched polymer conjugates
WO1998048837A1 (en) 1997-04-30 1998-11-05 Enzon, Inc. Polyalkylene oxide-modified single chain polypeptides
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US5990237A (en) 1997-05-21 1999-11-23 Shearwater Polymers, Inc. Poly(ethylene glycol) aldehyde hydrates and related polymers and applications in modifying amines
EP0921131A1 (en) 1997-06-06 1999-06-09 Kyowa Hakko Kogyo Co., Ltd. Chemically modified polypeptides
US20030162949A1 (en) 1997-07-14 2003-08-28 Bolder Biotechnology, Inc. Cysteine variants of granulocyte-macrophage colony-stimulating factor
WO1999007675A1 (en) 1997-08-08 1999-02-18 Pfizer Products Inc. Aryloxyarylsulfonylamino hydroxamic acid derivatives
US6129912A (en) 1997-09-26 2000-10-10 Uab Research Foundation Polyethylene glycol-protein compositions which reduce the antigenic display of red blood cells
US6201072B1 (en) 1997-10-03 2001-03-13 Macromed, Inc. Biodegradable low molecular weight triblock poly(lactide-co- glycolide) polyethylene glycol copolymers having reverse thermal gelation properties
US6004573A (en) 1997-10-03 1999-12-21 Macromed, Inc. Biodegradable low molecular weight triblock poly(lactide-co-glycolide) polyethylene glycol copolymers having reverse thermal gelation properties
US20020052009A1 (en) 1997-11-03 2002-05-02 Hans Hornauer Polyethylene glycol-derivatized biomolecules and their use in heterogeneous detection methods
US20020072573A1 (en) 1997-11-06 2002-06-13 Shearwater Corporation Heterobifunctional poly(ethylene glycol) derivatives and methods for their preparation
WO1999029667A1 (en) 1997-12-05 1999-06-17 Pfizer Limited Hydroxamic acid derivatives as matrix metalloprotease (mmp) inhibitors
WO1999032139A1 (en) 1997-12-19 1999-07-01 Shering Corporation Improved interferon polymer conjugates
WO1999032134A1 (en) 1997-12-19 1999-07-01 Enzon, Inc. Substantially pure histidine-linked protein polymer conjugates
WO1999032140A1 (en) 1997-12-19 1999-07-01 Enzon, Inc. Alpha-interferon-polymer-conjugates having enhanced biological activity and methods of preparing the same
EP0931788A2 (en) 1998-01-27 1999-07-28 Pfizer Limited Metalloprotease inhibitors
US6423685B1 (en) 1998-03-05 2002-07-23 Chiron Corporation Method for increasing the serum half-life of a biologically active molecule
US20020037949A1 (en) 1998-03-12 2002-03-28 Shearwater Corporation Poly(ethylene glycol) derivatives with proximal reactive groups
US20020052430A1 (en) 1998-03-12 2002-05-02 Shearwater Corporation Poly (ethylene glycol) derivatives with proximal reactive groups
US20020040076A1 (en) 1998-03-12 2002-04-04 Shearwater Corporation Poly(ethylene glycol) derivatives with proximal reactive groups
EP0945864A2 (en) 1998-03-26 1999-09-29 Sony Corporation Selecting video material
WO1999052889A1 (en) 1998-04-10 1999-10-21 Pfizer Products Inc. (4-arylsulfonylamino)-tetrahydropyran-4-carboxylic acid hydroxamides
WO1999052910A1 (en) 1998-04-10 1999-10-21 Pfizer Products Inc. Bicyclic hydroxamic acid derivatives
US6552167B1 (en) 1998-08-28 2003-04-22 Gryphon Therapeutics, Inc. Polyamide chains of precise length
US20030228274A1 (en) 1998-08-28 2003-12-11 Gryphon Sciences Polyamide chains of precise length
US6420339B1 (en) 1998-10-14 2002-07-16 Amgen Inc. Site-directed dual pegylation of proteins for improved bioactivity and biocompatibility
EP1004578A2 (en) 1998-11-05 2000-05-31 Pfizer Products Inc. 5-oxo-pyrrolidine-2-carboxylic acid hydroxamide derivatives
WO2000034337A1 (en) 1998-12-10 2000-06-15 Tsukuba Research Laboratory, Toagosei Co., Ltd. Humanized monoclonal antibodies against vascular endothelial cell growth factor
US6451346B1 (en) 1998-12-23 2002-09-17 Amgen Inc Biodegradable pH/thermosensitive hydrogels for sustained delivery of biologically active agents
US20010027217A1 (en) 1998-12-28 2001-10-04 Thomas Jaetsch Chemical formulations for incorporation into adhesives used in the production of wooden materials or wood composites
US6281211B1 (en) 1999-02-04 2001-08-28 Euro-Celtique S.A. Substituted semicarbazides and the use thereof
WO2000047212A1 (en) 1999-02-10 2000-08-17 Astrazeneca Ab Quinazoline derivatives as angiogenesis inhibitors
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
US6306821B1 (en) 1999-04-16 2001-10-23 Wm. Marsh Rice University Functionalized poly(propylene fumarate) and poly(propylene fumarate-co-ethylene glycol)
US6323315B1 (en) 1999-09-10 2001-11-27 Basf Aktiengesellschaft Dolastatin peptides
WO2001032651A1 (en) 1999-11-05 2001-05-10 Astrazeneca Ab Quinazoline derivatives as vegf inhibitors
US20030023023A1 (en) 1999-12-10 2003-01-30 Shearwater Corporation Hydrolytically degradable polymers and hydrogels made therefrom
US20020099133A1 (en) 1999-12-22 2002-07-25 Shearwater Corporation Method for the preparation of 1-benzotriazolyl carbonate esters of poly(ethylene glycol)
US20020086939A1 (en) 1999-12-22 2002-07-04 Shearwater Corporation Method for the preparation of 1-benzotriazolyl carbonate esters of poly(ethylene glycol)
US20030105275A1 (en) 1999-12-22 2003-06-05 Shearwater Corporation Sterically hindered poly(ethylene glycol) alkanoic acids and derivatives thereof
US20020002250A1 (en) 1999-12-22 2002-01-03 Shearwater Corporation Sterically hindered poly(ethylene glycol) alkanoic acids and derivatives thereof
US20010056171A1 (en) 1999-12-22 2001-12-27 Shearwater Corporation Method for the preparation of 1-benzotriazolyl carbonate esters of poly(ethylene glycol)
US20040013637A1 (en) 1999-12-23 2004-01-22 Nektar Therapeutics Al, Corportion Hydrolytically degradable carbamate derivatives of poly(ethylene glycol)
US6646110B2 (en) 2000-01-10 2003-11-11 Maxygen Holdings Ltd. G-CSF polypeptides and conjugates
WO2001060814A2 (en) 2000-02-15 2001-08-23 Sugen, Inc. Pyrrole substituted 2-indolinone protein kinase inhibitors
US20010044526A1 (en) 2000-02-22 2001-11-22 Shearwater Corporation N-maleimidyl polymer derivatives
WO2001062931A2 (en) 2000-02-25 2001-08-30 The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services ANTI-EGFRvIII SCFVS WITH IMPROVED CYTOTOXICITY AND YIELD, IMMUNOTOXINS BASED THEREON, AND METHODS OF USE THEREOF
US6461603B2 (en) 2000-02-28 2002-10-08 Shearwater Corporation Water-soluble polymer conjugates of artelinic acid
WO2001088138A1 (en) 2000-05-19 2001-11-22 Scancell Limited Humanised antibodies to the epidermal growth factor receptor
US6436386B1 (en) 2000-11-14 2002-08-20 Shearwater Corporation Hydroxyapatite-targeting poly (ethylene glycol) and related polymers
US20020082345A1 (en) 2000-12-18 2002-06-27 Shearwater Corporation Synthesis of high molecular weight non-peptidic polymer derivatives
US20020156047A1 (en) 2001-01-19 2002-10-24 Shearwater Corporation Multi-arm block copolymers as drug delivery vehicles
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US20030082575A1 (en) 2001-04-19 2003-05-01 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US20030108885A1 (en) 2001-04-19 2003-06-12 The Scripps Research Institute Methods and compositions for the production of orthogonal tRNA-aminoacyltRNA synthetase pairs
US7083970B2 (en) 2001-04-19 2006-08-01 The Scripps Research Institute Methods and compositions for the production of orthogonal tRNA-aminoacyl tRNA synthetase pairs
WO2002085923A2 (en) 2001-04-19 2002-10-31 The Scripps Research Institute In vivo incorporation of unnatural amino acids
US20050009751A1 (en) 2001-04-30 2005-01-13 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
WO2002088172A2 (en) 2001-04-30 2002-11-07 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
US20030083263A1 (en) 2001-04-30 2003-05-01 Svetlana Doronina Pentapeptide compounds and uses related thereto
US7247301B2 (en) 2001-06-13 2007-07-24 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (EGFR)
US20030158333A1 (en) 2001-10-09 2003-08-21 Shearwater Corporation Thioester-terminated water soluble polymers and method of modifying the N-terminus of a polypeptide therewith
US20030105224A1 (en) 2001-10-09 2003-06-05 Shearwater Corporation Thioester polymer derivatives and method of modifying the N-terminus of a polypeptide therewith
US20030143596A1 (en) 2001-11-07 2003-07-31 Shearwater Corporation Branched polymers and their conjugates
WO2003039486A2 (en) 2001-11-09 2003-05-15 Idec Pharmaceuticals Corporation Anti-cd80 antibody having adcc activity for adcc mediated killing of b cell lymphoma cells alone or in combination with other therapies
EP1444268A2 (en) 2001-11-12 2004-08-11 Gundram Jung Bispecific anti-cd28 antibody molecule
US20040001838A1 (en) 2001-12-21 2004-01-01 Immunogen, Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
US7338789B2 (en) 2002-08-19 2008-03-04 The Board Of Trustees Of The Leland Stanford Junior University Methods of in vitro protein synthesis
WO2004016778A1 (en) 2002-08-19 2004-02-26 The Board Of Trustees Of The Leland Stanford Junior University Improved methods of in vitro protein synthesis
US20050238649A1 (en) 2003-11-06 2005-10-27 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US20050147610A1 (en) 2003-11-12 2005-07-07 Tariq Ghayur IL-18 binding proteins
US20090035836A1 (en) * 2004-03-30 2009-02-05 California Institute Of Technology Modulating ph-sensitive binding using non-natural amino acids
WO2005111082A1 (en) 2004-04-30 2005-11-24 Inserm (Institut National De La Sante Et De La Recherche Medicale) Anti-tfr antibody.
US20080085277A1 (en) 2004-06-18 2008-04-10 Ambrx, Inc. Novel antigen-binding polypeptides and their uses
US20060018899A1 (en) 2004-07-22 2006-01-26 Genentech, Inc. HER2 antibody composition
US20080317670A1 (en) 2005-12-14 2008-12-25 Ambrx, Inc. Compositions Containing, Methods Involving, and Uses of Non-Natural Amino Acids and Polypeptides
US20090093405A1 (en) 2006-01-19 2009-04-09 Ambrx, Inc. Non-Natural Amino Acid Polypeptides Having Modified Immunogenicity
WO2007124299A2 (en) 2006-04-21 2007-11-01 Novartis Ag Antagonist anti-cd40 antibody pharmaceutical compositions
WO2008066583A2 (en) 2006-06-29 2008-06-05 The Board Of Trustees Of The Leland Stanford Junior University Cell-free synthesis of proteins containing unnatural amino acids
US20100093082A1 (en) 2006-09-08 2010-04-15 Ambrx, Inc. Site Specific Incorporation of Non-Natural Amino Acids by Vertebrate Cells
US20100098630A1 (en) 2006-12-28 2010-04-22 Ambrx, Inc. Phenazine and Quinoxaline Substituted Amino Acids and Polypeptides
WO2010051056A2 (en) * 2008-03-11 2010-05-06 Ambrx, Inc. ANTI-FcεRI POLYPEPTIDES AND THEIR USES
WO2010081110A1 (en) 2009-01-12 2010-07-15 Sutro Biopharma, Inc. Dual charging system for selectively introducing non-native amino acids into proteins using an in vitro synthesis method
WO2012032181A2 (en) * 2010-09-10 2012-03-15 Allozyne, Inc Novel antibody derivatives
WO2013068874A1 (en) * 2011-11-11 2013-05-16 Pfizer Inc. Antibody-drug conjugates

Non-Patent Citations (116)

* Cited by examiner, † Cited by third party
Title
ABUCHOWSKI ET AL., CANCER BIOCHEM. BIOPHYS., vol. 7, 1984, pages 175
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
ANDRESZ ET AL., MAKROMOL. CHEM., vol. 179, 1978, pages 301
ANGEW CHEM. INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186
AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1995
AXUP, PROC. NAT. ACAD. SCI. USA, vol. 109, no. 40, 2012, pages 16101 - 16106
AZOULAY, M.; VILMONT, M.; FRAPPICR, F.: "Glutaminc analogues as Potential Antimalarials", EUR. J. MED. CHEM., vol. 26, 1991, pages 201 - 5
BARTON ET AL.: "Synthesis of Novel a-Amino-Acids and Derivatives Using Radical Chemistry: Synthesis of L- and D-a-Amino-Adipic Acids, L-a-aminopimelic Acid and Appropriate Unsaturated Derivatives", TETRAHEDRON LETT., vol. 43, 1987, pages 4297 - 4308
BEAUCHAMP ET AL., ANAL. BIOCHEM., vol. 131, 1983, pages 25
BENJAMIN M HUTCHINS ET AL: "Site-Specific Coupling and Sterically Controlled Formation of Multimeric Antibody Fab Fragments with Unnatural Amino Acids", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 406, no. 4, 4 January 2011 (2011-01-04), pages 595 - 603, XP028363709, ISSN: 0022-2836, [retrieved on 20110113], DOI: 10.1016/J.JMB.2011.01.011 *
BRUGGEMANN; TAUSSIG, CURR. OPIN. BIOTECHNOL., vol. 8, 1997, pages 455 - 458
BUCKMANN ET AL., MAKROMOL. CHEM., vol. 182, 1981, pages 1379
BURROWS ET AL.: "Association of asthma with serum IgE levels and skin-test reactivity to allergens", NEW ENGL. L. MED., vol. 320, 1989, pages 271 - 277
CAREY; SUNDBERG: "Advanced Organic Chemistry Third Edition,", 1990, PLENUM PRESS
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 10, 1992, pages 4285 - 4289
CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131
CHIN J., SCIENCE, vol. 301, 2003, pages 964 - 7
CHIN, J. W. ET AL., J. AM. CHEM. SOC., vol. 124, 2002, pages 9026 - 9027
CHRISTIE, B. D.; RAPOPORT, H.: "Synthesis of Optically Pure Pipecolates from L-Asparagine. Application to the Total Synthesis of (+)-Apovincamine through Amino Acid Decarbonylation and Tminium Ion Cyclization", J. ORG. CHEM., vol. 1989, 1985, pages 1859 - 1866
CLARK, IMMUNOL. TODAY, vol. 21, 2000, pages 397 - 402
CORNISH, V. W. ET AL., J. AM. CHEM. SOC., vol. 118, 1996, pages 8150 - 8151
CRAIG, J. C. ET AL.: "Absolute Configuration of the Enantiomers of 7-Chloro-4 [[4- (diethylamino)-1-methylbutyl]amino]quinoline (Chloroquine", J. ORG. CHEM., vol. 53, 1988, pages 1167 - 1170
DEITERS, A. ET AL., J. AM. CHEM. SOC., vol. 125, 2003, pages 11782 - 11783
DELGADO ET AL., CRITICAL REVIEWS IN THERAPEUTIC DRUG CARRIER SYSTEMS, vol. 9, 1992, pages 249 - 304
DUNN, R. L., ET AL., E: "POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS", vol. 469, 1991, ACS SYMPOSIUM SERIES
E. SAXON; C. BERTOZZI, SCIENCE, vol. 287, 2000, pages 2007 - 2010
E.W. MARTIN: "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO
ELLING ET AL., BIOTECH. APPL. BIOCHEM., vol. 13, 1991, pages 354
FANGER, M W ET AL., CRIT REV IMMUNOL., vol. 12, no. 34, 1992, pages 101 - 24
FESSENDON; FESSENDON: "Organic Chemistry, Second Edition,", 1982, WILLARD GRANT PRESS
FRIEDMAN, O. M.; CHATTERRJI, R.: "Synthesis of Derivatives of Glutamine as Model Substrates for Anti-Tumor Agents", J. AM. CHEM. SOC., vol. 81, 1959, pages 3750 - 3752
G. T. HERMANSON ET AL.: "IMMOBILIZED AFFINITY LIGAND TECHNIQUES", 1993, ACADEMIC PRESS
GEOGHEGAN, K. F.; STROH, J. G., BIOCONJUG. CHEM., vol. 3, 1992, pages 138 - 146
GOODSON ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 343
GRIFFITHS; DUNCAN, CURR. OPIN. BIOTECHNOL., vol. 9, 1998, pages 102 - 108
H. HANG; C. BERTOZZI, ACC. CHEM. RES., vol. 34, 2001, pages 727 - 736
H. HANG; C. BERTOZZI, ACC. CHEM. RES., vol. 34, no. 9, 2001, pages 727 - 736
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY, pages: 555 - 612
HARRIS & ANGAL,: "PROTEIN PURIFICATION METHODS, A PRACTICAL APPROACH", 1989, IRL PRESS, pages: 293 - 306
HARRIS ET AL., J. POLYM. SCI. CHEM. ED., vol. 22, 1984, pages 341
HARRIS, MACRONOL. CHEM. PHYS., vol. C25, 1985, pages 325 - 373
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HUDSON, CURR. OPIN. BIOTECHNOL., vol. 9, 1998, pages 395 - 402
HUISGEN, R.: "1,3-DIPOLAR CYCLOADDITION CHEMISTRY", 1984, pages: 1 - 176
J. SHAO; J. TAM, J. AM. CHEM. SOC., vol. 117, no. 14, 1995, pages 3893 - 3899
J. Y. AXUP ET AL: "Synthesis of site-specific antibody-drug conjugates using unnatural amino acids", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 40, 2 October 2012 (2012-10-02), pages 16101 - 16106, XP055076259, ISSN: 0027-8424, DOI: 10.1073/pnas.1211023109 *
JAMES F. ZAWADA ET AL: "Microscale to manufacturing scale-up of cell-free cytokine production-a new approach for shortening protein production development timelines", BIOTECHNOLOGY AND BIOENGINEERING, vol. 108, no. 7, 31 July 2011 (2011-07-31), pages 1570 - 1578, XP055076263, ISSN: 0006-3592, DOI: 10.1002/bit.23103 *
JENCKS, W. P., J. AM. CHCM. SOC., vol. 81, 1959, pages 475 - 481
JEWETT, M.C.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 86, 2004, pages 19 - 26
JEWETT, M.C.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 87, 2004, pages 465 - 72
JOPPICH ET AL., MACROLOL. CHEM., vol. 180, 1979, pages 1381
JUNGBLUTH ET AL., PROC. NATL. ACAD. SCI. USA., vol. 100, no. 2, 2003, pages 639 - 44
KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787
KAYSCR, B., TETRAHEDRON, vol. 53, no. 7, 1997, pages 2475 - 2484
KETTLEBOROUGH ET AL., PROTEIN ENG., vol. 4, no. 7, 1991, pages 773 - 83
KIICK ET AL.: "Incorporation of azides into recombinant proteins for chemoselective modification by the Staudinger ligation", PNAS, vol. 99, 2002, pages 19 - 24
KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 74, 2001, pages 309 - 16
KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 85, 2004, pages 122 - 29
KIM, D.M.; SWARTZ, J.R., BIOTECHNOL. PROG., vol. 16, 2000, pages 385 - 90
KIM, D.M; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 66, 1999, pages 180 - 8
KING, F. E.; KIDD, D. A. A.: "A New Synthesis of Glutamine and of y-Dipeptides of Glutamic Acid from Phthylated Intermediates", J. CHEM. SOC., 1949, pages 3315 - 3319
KOGAN, SYNTHETIC COMM., vol. 22, 1992, pages 2417
KOSKINEN, A. M. P.; RAPOPORT, H.: "Synthesis of 4-Substituted Prolines as Conformationally Constrained Amino Acid Analogues", J. ORG. CHEM., vol. 54, 1989, pages 1859 - 1866
M. CARRASCO; R. BROWN, J. ORG. CHEM., vol. 68, 2003, pages 8853 - 8858
MAHAL, L. K. ET AL., SCIENCE, vol. 276, 1997, pages 1125 - 1128
MARCH: "Advanced Organic Chemistry Third Edition,", 1985, WILEY AND SONS
MATEO ET AL., IMMUNOTECHNOL., vol. 3, no. 1, 1997, pages 71 - 81
MATSOUKAS ET AL.: "In vivo incorporation of Unnatural Amino Acids", J. MED. CHEM., vol. 38, 1995, pages 4660 - 4669
MAYNARD; GEORGIOU, ANNU. REV. BIOMED. ENG., vol. 2, 2000, pages 339 - 76
MCNDCLSOHN; BASCLGA: "Biologic Therapy of Cancer", 1995, J B LIPPINCOTT, article "Antibodies to growth factors and receptors", pages: 607 - 623
MODJTAHEDI ET AL., BR. J. CANCER, vol. 67, no. 2, 1993, pages 247 - 53
MODJTAHEDI ET AL., BR. J. CANCER, vol. 73, no. 2, 1996, pages 228 - 35
MODJTAHEDI ET AL., INT. J. CANCER, vol. 105, no. 2, 2003, pages 273 - 80
MODJTAHEDI ET AL., J. CELL. BIOPHYS, vol. 22, no. 1-3, 1993, pages 129 - 46
MURTHY ET AL., ARCH. BIOCHEM. BIOPHYS, vol. 252, no. 2, 1987, pages 549 - 60
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NOLAN, 0; R. O'KENNEDY, BIOCHIM BIOPHYS ACTA, vol. 1040, no. 1, 1 August 1990 (1990-08-01), pages 1 - 11
OLSON ET AL.: "Poly(ethylene glycol) Chemistry & Biological Applications", 1997, ACS, pages: 170 - 181
PADWA, A.: "COMPREHENSIVE ORGANIC SYNTHESIS", vol. 4, 1991, pages: 1069 - 1109
PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PEPINSKY B. ET AL., J. PHARMCOL. & EXP. THER., vol. 297, no. 3, 2001, pages 1059 - 66
PITHA ET AL., EUR. J BIOCHEM., vol. 94, 1979, pages 11
PRESTA, L. G., J. ALLERGY CLIN. IMMUNOL., vol. 116, 2005, pages 731 - 6, Retrieved from the Internet <URL:www<dot>path<dot>cam<dot>ac<dot>uk</><dot>about<dot>mrc<7></>humanisation</>a ntibodies<dot>html>
R. F. TAYLOR: "PROTEIN IMMOBILISATION. FUNDAMENTAL AND APPLICATIONS", 1991, MARCEL DEKKER
RODECK ET AL., J. CELL. BIOCHEM., vol. 35, no. 4, 1987, pages 315 - 20
ROMANI ET AL., CHEMISTRY OF PEPTIDES AND PROTEINS, vol. 2, 1984, pages 29
ROSENTHAL, G. ET AL., LIFE SCI., vol. 60, 1997, pages 1635 - 1641
ROSTOVTSEV ET AL., ANGEW. CHEM. INT. ED., vol. 41, 2002, pages 2596 - 2599
S. A. KAZANE ET AL: "Site-specific DNA-antibody conjugates for specific and sensitive immuno-PCR", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 10, 6 March 2012 (2012-03-06), pages 3731 - 3736, XP055076255, ISSN: 0027-8424, DOI: 10.1073/pnas.1120682109 *
S. S. WONG: "CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING", 1992, CRC PRESS
SANDLER; KARO: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161
SARTORE ET AL., APPL. BIOCHEM. BIOTECH., vol. 27, 1991, pages 45
SAWHNEY ET AL., MACROMOLECULES, vol. 26, 1993, pages 581
SCOUTEN, METHODS IN ENZYMOLOGY, vol. 135, 1987, pages 30 - 65
SHAO, J.; TAM, J. P., J. AM. CHCM. SOC., vol. 117, 1995, pages 3893 - 3899
SHAO, J.; TAM, J., J. AM. CHEM. SOC., vol. 117, 1995, pages 3893 - 3899
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1970, pages 482C
STEPHANIE A. KAZANE ET AL: "Self-Assembled Antibody Multimers through Peptide Nucleic Acid Conjugation", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 135, no. 1, 9 January 2013 (2013-01-09), pages 340 - 346, XP055076261, ISSN: 0002-7863, DOI: 10.1021/ja309505c *
SUBASINGHE ET AL.: "Quisqualic acid analogues: synthesis of beta-heterocyclic 2- aminopropanoic acid derivatives and their activity at a novel quisqualatc-scnsitizcd site", J. MED. CHEM., vol. 35, 1992, pages 4602 - 7
SWARTZ ET AL., METHODS MOL BIOL., vol. 267, 2004, pages 169 - 82
TONDELLI ET AL., J. CONTROLLED RELEASE, vol. 1, 1985, pages 251
TORNOE, C. W. ET AL., J. ORG. CHEM., vol. 67, 2002, pages 3057 - 3064
VERONESE ET AL., APPL. BIOCHEM. BIOTECH., vol. 11, 1985, pages 141
VERONESE, APP. BIOCHEM. BIOTECH., vol. 11, 1985, pages 141 - 45
VOLOSHIN, A.M.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 91, 2005, pages 516 - 21
WANG, Q. ET AL., J. AM. CHEM. SOC., vol. 125, 2003, pages 3192 - 3193
WANG, Q., J. AM. CHEM. SOC., vol. 125, 2003, pages 3192 - 3193
WOGHIREN ET AL., BIOCONJ. CHEM., vol. 4, 1993, pages 314
WONG ET AL., ENZYME MICROB. TECHNOL., vol. 14, 1992, pages 866 - 874
YIN GANG ET AL: "Aglycosylated antibodies and antibody fragments produced in a scalable in vitro transcription-translation system", MABS, vol. 4, no. 2, March 2012 (2012-03-01), pages 217 - 225, XP002711741 *
YIN, G.; SWARTZ, J.R., BIOTECHNOL. BIOENG., vol. 86, 2004, pages 188 - 95
YOUNG ET AL., BIOCHEM., vol. 50, 2011, pages 1894 - 1900
ZALIPSKY, BIOCONJUGATE CHEM., vol. 6, 1995, pages 150 - 165
ZAPLIPSKY ET AL., EUR. POLYM. J., vol. 19, 1983, pages 1177
ZAWADA ET AL., BIOTECHNOL. BIOENG., vol. 108, no. 7, 2011, pages 1570 - 1578

Cited By (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11958909B2 (en) 2012-06-08 2024-04-16 Sutro Biopharma, Inc. Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
JP2015529208A (en) * 2012-08-31 2015-10-05 ストロ バイオファーマ インコーポレーテッド Modified amino acids containing azido groups
WO2014124316A3 (en) * 2013-02-08 2014-11-27 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
EP2953976B1 (en) * 2013-02-08 2021-03-24 Novartis Ag Specific sites for modifying antibodies to make immunoconjugates
EP3929217A3 (en) * 2013-02-08 2022-03-02 Novartis AG Specific sites for modifying antibodies to make immunoconjugates
US11596695B2 (en) 2013-02-08 2023-03-07 Novartis Ag Specific sites for modifying antibodies to make immunoconjugates
WO2014124258A3 (en) * 2013-02-08 2014-11-20 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
US10973922B2 (en) 2013-05-02 2021-04-13 Glykos Finland Oy Glycoprotein-toxic payload conjugates
EP3336103A1 (en) * 2013-07-10 2018-06-20 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
WO2015006555A3 (en) * 2013-07-10 2015-03-05 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
US11344626B2 (en) 2013-07-10 2022-05-31 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
US11918656B2 (en) 2014-04-25 2024-03-05 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
JP2017513904A (en) * 2014-04-25 2017-06-01 ピエール、ファーブル、メディカマン Antibody-drug conjugates and their use for the treatment of cancer
WO2015162293A1 (en) * 2014-04-25 2015-10-29 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
CN106470708A (en) * 2014-04-25 2017-03-01 皮埃尔法布雷医药公司 Antibody-drug-conjugates and their use for the treatment of cancer
US10912841B2 (en) 2014-04-25 2021-02-09 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
US10314921B2 (en) 2014-04-25 2019-06-11 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
AU2015250761B2 (en) * 2014-04-25 2019-10-31 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
CN106470708B (en) * 2014-04-25 2019-12-31 皮埃尔法布雷医药公司 Antibody-drug-conjugates and their use for the treatment of cancer
EP3607996A1 (en) * 2014-04-25 2020-02-12 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
US11219693B2 (en) 2014-04-25 2022-01-11 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
US11517625B2 (en) 2014-04-25 2022-12-06 Pierre Fabre Medicament Antibody-drug-conjugate and its use for the treatment of cancer
JP2018509933A (en) * 2015-02-16 2018-04-12 ロンザ リミテッドＬｏｎｚａ Ｌｉｍｉｔｅｄ Antibody for drug conjugation with mutated CL and / or CH1
US11833222B2 (en) 2015-02-16 2023-12-05 Lonza Ltd CL and/or CH1 mutated antibodies for drug conjugation
US10953106B2 (en) 2015-02-16 2021-03-23 Lonza Ltd Antibodies
EP3878861A1 (en) 2015-02-16 2021-09-15 Lonza Ltd. Cl and/or ch1 mutated antibodies for drug conjugation
US9669106B2 (en) 2015-10-26 2017-06-06 Pierre Fabre Medicament Conjugate of monomethyl auristatin F and trastuzumab and its use for the treatment of cancer
WO2017132617A1 (en) 2016-01-27 2017-08-03 Sutro Biopharma, Inc. Anti-cd74 antibody conjugates, compositions comprising anti-cd74 antibody conjugates and methods of using anti-cd74 antibody conjugates
US11708413B2 (en) 2016-01-27 2023-07-25 Sutro Biopharma, Inc. Anti-CD74 antibody conjugates, compositions comprising anti-CD74 antibody conjugates and methods of using anti-CD74 antibody conjugates
WO2017132615A1 (en) 2016-01-27 2017-08-03 Sutro Biopharma, Inc. Anti-cd74 antibody conjugates, compositions comprising anti-cd74 antibody conjugates and methods of using anti-cd74 antibody conjugates
US11149074B2 (en) 2016-05-02 2021-10-19 Ajinomoto Co., Inc. Azide group-containing Fc protein
WO2019023316A1 (en) 2017-07-26 2019-01-31 Sutro Biopharma, Inc. Methods of using anti-cd74 antibodies and antibody conjugates in treatment of t-cell lymphoma
CN109420167A (en) * 2017-08-28 2019-03-05 四川九章生物科技有限公司 A kind of combination medicine for treating tumour
CN109420167B (en) * 2017-08-28 2022-02-11 四川九章生物科技有限公司 Combined medicine for treating tumor
US12071477B2 (en) 2017-09-18 2024-08-27 Sutro Biopharma, Inc. Anti-folate receptor alpha antibody conjugated with hemiasterlins
WO2019055931A1 (en) 2017-09-18 2019-03-21 Sutro Biopharma, Inc. Anti- folate receptor alpha antibody conjugates and their uses
WO2019055909A1 (en) 2017-09-18 2019-03-21 Sutro Biopharma, Inc. Anti-folate receptor alpha antibody conjugates and their uses
US10596270B2 (en) 2017-09-18 2020-03-24 Sutro Biopharma, Inc. Anti-folate receptor antibody conjugates, compositions comprising anti-folate receptor antibody conjugates, and methods of making and using anti-folate receptor antibody conjugates
WO2020060944A1 (en) 2018-09-17 2020-03-26 Sutro Biopharma, Inc. Combination therapies with anti-folate receptor antibody conjugates
WO2020081493A1 (en) 2018-10-16 2020-04-23 Molecular Templates, Inc. Pd-l1 binding proteins
WO2020168017A1 (en) * 2019-02-12 2020-08-20 Ambrx, Inc. Compositions containing, methods and uses of antibody-tlr agonist conjugates
WO2020227105A1 (en) 2019-05-03 2020-11-12 Sutro Biopharma, Inc. Anti-bcma antibody conjugates
WO2020252043A1 (en) 2019-06-10 2020-12-17 Sutro Biopharma, Inc. 5H-PYRROLO[3,2-d]PYRIMIDINE-2,4-DIAMINO COMPOUNDS AND ANTIBODY CONJUGATES THEREOF
WO2020257235A1 (en) 2019-06-17 2020-12-24 Sutro Biopharma, Inc. 1-(4-(aminomethyl)benzyl)-2-butyl-2h-pyrazolo[3,4-c]quinolin-4-amine derivatives and related compounds as toll-like receptor (tlr) 7/8 agonists, as well as antibody drug conjugates thereof for use in cancer therapy and diagnosis
US11827684B2 (en) 2020-04-22 2023-11-28 Merck Sharp & Dohme Llc Human interleukin-2 conjugates biased for the interleukin-2 receptor beta GAMMAc dimer and conjugated to a nonpeptidic, water-soluble polymer
WO2021216478A1 (en) 2020-04-22 2021-10-28 Merck Sharp & Dohme Corp. HUMAN INTERLEUKIN-2 CONJUGATES BIASED FOR THE INTERLEUKIN-2 RECEPTOR BETA GAMMAc DIMER AND CONJUGATED TO A NONPEPTIDIC, WATER-SOLUBLE POLYMER
WO2021222719A1 (en) * 2020-04-30 2021-11-04 Sutro Biopharma, Inc. Methods of producing full-length antibodies using e.coli
US20210340586A1 (en) * 2020-04-30 2021-11-04 Sutro Biopharma, Inc. Methods of Producing Full-Length Antibodies Using E. coli
WO2024006542A1 (en) 2022-06-30 2024-01-04 Sutro Biopharma, Inc. Anti-ror1 antibodies and antibody conjugates, compositions comprising anti-ror1 antibodies or antibody conjugates, and methods of making and using anti-ror1 antibodies and antibody conjugates

Also Published As

Publication number Publication date
BR112014030278A2 (en) 2017-06-27
KR20150023630A (en) 2015-03-05
CN104583235B (en) 2019-03-01
HUE043552T2 (en) 2019-09-30
HK1203518A1 (en) 2015-10-30
HRP20190475T1 (en) 2019-05-31
AU2013270684A1 (en) 2015-01-22
EP2859017B1 (en) 2019-02-20
CN104583235A (en) 2015-04-29
US9738724B2 (en) 2017-08-22
PL2859017T3 (en) 2019-07-31
CA2875989A1 (en) 2013-12-12
EP2859017A1 (en) 2015-04-15
ES2718478T3 (en) 2019-07-02
AU2013270684B2 (en) 2018-04-19
US10669347B2 (en) 2020-06-02
JP6498600B2 (en) 2019-04-10
EP3505534A1 (en) 2019-07-03
US11958909B2 (en) 2024-04-16
US20140046030A1 (en) 2014-02-13
JP2015518905A (en) 2015-07-06
SI2859017T1 (en) 2019-05-31
IL236111A0 (en) 2015-01-29
IL236111B (en) 2019-03-31
DK2859017T3 (en) 2019-05-13
SG11201408161RA (en) 2015-01-29
US20200299403A1 (en) 2020-09-24
US20170362334A1 (en) 2017-12-21
KR102172897B1 (en) 2020-11-02

Similar Documents

Publication Publication Date Title
US11958909B2 (en) Antibodies comprising site-specific non-natural amino acid residues, methods of their preparation and methods of their use
US20230114070A1 (en) Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
US11548852B2 (en) Modified amino acids
US10442789B2 (en) Modified amino acids comprising tetrazine functional groups, methods of preparation, and methods of their use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13730764

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2013730764

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 122021025612

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2875989

Country of ref document: CA

Ref document number: 2015516266

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20157000097

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013270684

Country of ref document: AU

Date of ref document: 20130607

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014030278

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014030278

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20141203