WO2013142809A1 - Baculovirus-based enterovirus 71 vlp as a vaccine - Google Patents

Baculovirus-based enterovirus 71 vlp as a vaccine Download PDF

Info

Publication number
WO2013142809A1
WO2013142809A1 PCT/US2013/033543 US2013033543W WO2013142809A1 WO 2013142809 A1 WO2013142809 A1 WO 2013142809A1 US 2013033543 W US2013033543 W US 2013033543W WO 2013142809 A1 WO2013142809 A1 WO 2013142809A1
Authority
WO
WIPO (PCT)
Prior art keywords
vaccine
vlps
cells
strain
gene
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/033543
Other languages
French (fr)
Inventor
Denise A. GALLOWAY
Joerg Enssle
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fred Hutchinson Cancer Center
Original Assignee
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fred Hutchinson Cancer Center filed Critical Fred Hutchinson Cancer Center
Priority to US14/387,159 priority Critical patent/US20150044257A1/en
Publication of WO2013142809A1 publication Critical patent/WO2013142809A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/125Picornaviridae, e.g. calicivirus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5258Virus-like particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/32011Picornaviridae
    • C12N2770/32311Enterovirus
    • C12N2770/32334Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • Enterovirus 71 is an emerging virus with a severe impact on human health. It is an etiological agent responsible for hand-foot-and-mouth disease (HFMD) in young children and infants.
  • EV71 is a picornavirus (picornaviridae), a virus family that is divided into six genera, among which are the human enteroviruses, rhinoviruses, parechoviruses, aphthoviruses, cardio viruses, and hepato viruses.
  • the genus Enterovirus includes the human virus species of polio viruses and human enterovirus groups A to D. Human enterovirus A consists of 12 serotypes, including coxsackievirus A2, A16 and enterovirus 71.
  • Enteroviruses cause a wide spectrum of clinical syndromes ranging from mild fever to respiratory infections, meningitis, encephalitis, paralytic poliomyelitis and myocarditis. Life-threatening enteroviral infections may occur, especially in high-risk individuals such as immunocompromised patients, infants and young children. Reminiscent of experiences with poliovirus, EV71 infection may also have severe neurologic adverse effects (Ooi et al, Lancet Neurol. 9.11 (2010): 1097-105; Solomon et al., Lancet Infect.Dis. 10.11 (2010): 778-90). These include aseptic meningitis, brain stem encephalitis, and death.
  • Enteroviruses are single-stranded RNA viruses. Their genomes comprise approximately 7500 nts. The genomic organization and replication of EV71 follows the enterovirus prototype genome organization (Kirkegaard, Curr. Opin. Genet. Dev. 2.1 (1992): 64-70): a single open reading frame (ORF) encoding a polyprotein is expressed and subsequently cleaved. The PI region of the polyprotein gene encodes the four structural virus capsid subunit proteins VP4, VP2, VP3 and VPl . Cleavage of the PI polyprotein into VPO (VP4+VP2), VP3 and VPl is mediated by the viral 3CD protease, the 3CD part of the viral polyprotein, at the plasma membrane.
  • ORF enterovirus prototype genome organization
  • Prophylactic vaccines against EV71 are being developed, although these attempts are either directed against formerly EV71 subgenotypes like the EV71 neu strain (Lin et al, Vaccine 20.19-20 (2002): 2485-93; Chung et al, World J. Gastroenterol. 12.6 (2006): 921-27), or are based on inactivated virus (Riedmann, Hum. Vaccin. 7.8 (2011): 802-05; Liang et al, Vaccine 29.52 (2011):9668-74; Chang et al, Vaccine 30.4 (2012): 703-11) with potential risk factors as occurs in poliovirus vaccines (Arita and Francis, Vaccine 29.48 (2011): 8827-34). Safer approaches are needed for vaccine production that are independent from any infectious virus, such as heterologous viral subunit transgene expression systems using, for example, bacteria, yeast, plants or insect baculo viruses (BVs).
  • BVs insect baculo viruses
  • VLPs virus-like particles
  • van Oers Adv. Virus Res. 68 (2006) 193-253; Kost et al, Nat. Biotechnol 23.5 (2005) 567-75. Due to the huge coding capacity of BVs large recombinant transgenic insertions can be accomplished. Using one BV containing all heterologous genes of choice greatly simplifies virus handling and has been shown to result in up to a 30-fold higher heterologous protein expression (Berger et al, Nat. Biotechnol.
  • VLP formation has been accomplished in a BV system with a full-length poliovirus open reading frame (ORF) (Urakawa et al., J.Gen. Virol. 70 (Pt 6) (1989): 1453-63).
  • ORF poliovirus open reading frame
  • the desired product is an expressed protein that is produced in large amounts and that is as similar to the natural protein as possible, including necessary post-translation processing and modification.
  • post-translational processing steps that have been shown to occur in insect cells are fatty acid acylation, phosphorylation, and glycosylation (Luckow, V. A. 1995. In: Baculoviruses Expression Systems and Biopesticides, Shuler et al, Eds. Wiley-Liss, New York, NY, pages 51-90).
  • Most proteins recovered from insect cell cultures however, have a lower molecular weight than the native protein because of incomplete post-translational modification. Yields of protein from baculovirus expression vectors in insect cell cultures are reported to be many times higher than those from mammalian cells.
  • the invention provides a vaccine composition of virus-like particles (VLPs) of human enterovirus 71 (EV71) strain EU703812 for preventing human EV71 infection or inhibiting development of EV71 disease manifestations.
  • a vaccine may comprise capsid proteins VPO, VP4, VP2, VP3 and VPl, and preferably will be free of infectious genomic EV71 RNA, and substantially free of any RNA.
  • the vaccine of the invention is preferably available in a concentration of 20 to 100 ⁇ g per human dose, together with an adjuvant, such as an aluminum salt.
  • the vaccine may be contained in a vessel such as a vial, capsule, syringe, etc. that is suitable for containing a 500 ⁇ to 1.0ml human vaccine dose.
  • the invention provides a method for producing a vaccine against EV71 infection or disease, by infecting Spodoptera frugiperda (Sf) cells with a recombinant baculo virus comprising a PI gene of EV71 strain EU703812 and a 3 CD protease gene of prototype EV71 strain BrCr-Tr under control of a CMV promoter in a bicistronic configuration.
  • Sf Spodoptera frugiperda
  • a recombinant baculo virus comprising a PI gene of EV71 strain EU703812 and a 3 CD protease gene of prototype EV71 strain BrCr-Tr under control of a CMV promoter in a bicistronic configuration.
  • the infected Sf cells are cultured under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs, which are then harvested and combined with a physiologically acceptable carrier or an adjuvant to produce the vaccine.
  • the PI gene is preferably placed under control of a polyhedrin promoter, and/or the 3CD protease gene is preferably under control of a CMV promoter.
  • the Sf cells are Sf21.
  • the resulting vaccine is preferably free of infectious genomic EV71 RNA.
  • the present invention provides a method for producing a vaccine against EV71 by obtaining EV71 VLPs from a culture of Sf cells, such as, e.g., Sf21 cells, infected with a recombinant baculovirus.
  • the recombinant baculovirus comprises a PI gene of EV71 strain, which in some instances may be EU703812, and a 3CD protease gene, which in some instances may be from prototype EV71 strain BrCr-Tr, under control of a CMV promoter in a bicistronic configuration.
  • a translational enhancer L21 is inserted 5' of the PI gene.
  • the infected Sf cells are cultured under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs.
  • the EV71 VLPs are combined with an adjuvant to produce the vaccine.
  • the invention provides a method for inhibiting or preventing EV71 infection or inhibiting the development of EV71 disease, by administering an effective amount of an EV71 vaccine that comprises EV71 VLPs of strain EU703812, together with a pharmaceutically acceptable excipient and optionally an adjuvant.
  • the vaccine is administered in an amount sufficient to generate an immune response in the individual that prevents EV71 infection or disease, and may be given in two consecutive doses consisting of a first dose and a second dose, where, for example, the second dose is administered at least about two to six months after the first dose.
  • the adjuvant may be an aluminum salt, such as aluminum hydroxide.
  • the EV71 VLPs may comprise capsid proteins VPO, VP3 and VPl or VP4, VP2, VP3 and VPl and are free of genomic EV71 RNA. DESCRIPTION OF THE DRAWINGS
  • FIG. 1 shows the genome structures of recombinant EV71 -transgenic BVs.
  • A Monocistronic BVs. Upper left: BV PI, upper right: BV 3CD, lower left: BV L21 PI, lower right: BV PI codop.
  • B Bicistronic BVs. Upper left: BV Bi A, lower: BV Bi B, right: BV Bi B L21.
  • T Transposon recognition sequence
  • P Polyhedrin promoter PHpr
  • PI EV71 PI polyprotein ORF
  • A poly A signal light gray: SV40, dark gray: BGH
  • C CMV promoter
  • 3CD EV71 protease 3CD ORF
  • L L21 translation enhancer
  • PI codop codon-optimized EV71 polyprotein ORF.
  • Gentamicin resistance cassette used for selection of recombinant bacmids in bacteria present in all constructs between the left transposon recognition sequence and the PHpr as well as the constant parts of the respective 5' UTRs of the transgene cassettes are not shown. Vector genomes are not drawn to scale.
  • FIGURE 2 shows the electron microscopic detection of EV71 VLPs.
  • B Electron microscopic detection of EV71 VLPs in Sf21 cells after infection with BV Bi B. The white arrow indicates VLP aggregates, putatively forming due to the high expression efficiency when using BV Bi B. Bar size 50 nm.
  • FIGURE 3 A Faster processing of EV71 capsid transgenic proteins in Sf21 cells compared to Sf9 cells and higher EV 71 capsid protein yield through the L21 translational enhancer. Equal amounts of protein were analyzed with the monoclonal antibody (Mab) 10F0. Lane 1 : cells infected with BV PI, lane 2: cells infected with BV PI L21. In these two experiments the cells were co-infected with BV 3 CD (multiplicity of infection (MOI) 10). Lane 3: cells infected with BV 3 CD only (MOI 10), lane 4: uninfected cells. Upper panel: Sf9 cells, lower panel: Sf21 cells. The EV71 PI and VP0 proteins are indicated.
  • FIGURE 3B Superior EV71 capsid protein expression levels from bicistronic BVs in insect cells with the transgene cassettes in opposite orientations. Sf21 cells were infected with BV Bi A (lane 1) and BV Bi B (lane 2) at respective MOIs of 10. Three days post infection cell lysates were harvested. After electrophoretic separation of equal amounts of cellular proteins followed by western blot transfer, EV71 capsid protein expression was detected with the Mab 10F0. Lane 3: uninfected cells.
  • FIGURE 3C Higher EV71 capsid protein expression in Sf21 cells through the L21 leader sequence in the monocistronic BV infection system but not in the bicistronic configuration.
  • Lane 1 Sf21 cells infected with BV PI (MOI 10)
  • lane 2 Sf21 cells infected with BV PI L21 (MOI 10)
  • lane 3 Sf21 cells co-infected with BV PI (MOI 10) and BV 3 CD (MOI 10)
  • lane 4 Sf21 cells co-infected with BV PI L21 (MOI 10) and BV 3 CD (MOI 10)
  • lane 5 Sf21 cells co-infected with BV PI (MOI 10) and BV 3 CD (MOI 1)
  • lane 6 SF21 cells co-infected with BV PI L21 (MOI 10) and BV 3 CD (MOI 1)
  • lane 7 Sf21 cells infected with BV Bi B (MOI 10)
  • EV71 PI and VPO proteins are indicated. Putative additional EV71 -specific intermediate cleavage products are indicated with asterisks.
  • CI Impaired EV71 VPO accumulation with L21 in 5' to the PI ORF in the bicistronic configuration is detected when fewer amounts of protein are analyzed compared to C for the BV Bi B and BV Bi B L21 infection experiments.
  • Lane 1 Uninfected Sf21 cells
  • lane 2 BV 3CD-infected cells
  • lane 3 BV Bi B-infected cells
  • lane 4 BV Bi B L21 infected cells. Equal amounts of protein were loaded in lanes 3 and 4.
  • FIGURE 3D Sf21 cells were infected with BV PI (lanes 1 and 4) or two independent BV stocks with codon-optimized PI ORF (lanes 2, 3, 5 and 6) at an MOI of 10 either in the absence (lanes 1 to 3) or presence of BV 3CD (MOI 10, lanes 4 to 6). Three days post infection cell lysates were harvested. Lane 7: BV 3CD-infected cells, lane 8: uninfected cells.
  • FIGURE 4 EV71 BrCr VPO processing into VP2 in 293TT cells in the absence of viral proteases and inhibition of processing in two VPO alanine mutants.
  • 293TT cells were transfected with plasmids expressing the wt VPO ORF (lane 1) or two VPO ORF versions with alanine residues instead of the authentic amino acids at the putative VP4-VP2 cleavage position (lanes 2 and 3). Cell lysates were harvested at day 2 post transfection and subjected to Western blot analysis applying Mab 10F0.
  • Lane 4 Lysate from untransfected 293TT cells
  • lane 5 lysate from EV71 BrCr-infected 293TT cells.
  • FIGURE 5 BV Bi B infection kinetic in insect cells reveals highest EV71 capsid protein yield five days after infection.
  • Cell lysates harvested at different times post infection were Western blot analyzed with Mab 10F0.
  • FIGURE 6 Purity of EV71 VLPs.
  • Sf21 cells were infected with BV Bi B (MOI 10) and harvested three days post infection. The lysate was subjected to separation on a discontinuous sucrose gradient. The opaque band occurring in the lower part of the 30% sucrose fraction was harvested and dialyzed in a Vivaspin 500 column and separated on 12% Tris/Bis gels.
  • Lane 1 10 ug BSA
  • lane 2 1 ug BSA
  • lane 3 EV71 VLPs.
  • Left part proteins visualized with Gel Code Blue.
  • Right part Western Blot with MAb 10F0. Origins of detectable bands are given. Note that in this gel system VP0 and VP1 run as a doublet. The triplet consisting of the bands A, B and C is discussed in the Example section.
  • the present invention provides a means to produce a safe and effective vaccine to quickly respond to EV71 outbreaks, such as occurred recently in the People's Republic of China and elsewhere in Asia.
  • the EV71 PI gene derived from a recent fatal case in China, and the 3 CD protease from the BrCr-TR prototype strain are co-expressed by a baculovirus (BV) / insect cell system.
  • the EV71 PI ORF is placed under control of a promoter, such as, for example, the BV polyhedrin promoter (PHpr) (Smith et al, Mol. Cell Biol. 3.12 (1983): 2156-65; Pennock et al, Mol. Cell Biol. 4.3 (1984): 399-406).
  • a promoter such as, for example, the BV polyhedrin promoter (PHpr) (Smith et al, Mol. Cell Biol. 3.12 (1983): 2156-65; Pennock et al, Mol. Cell Biol. 4.3 (1984
  • the 3 CD protease of the prototype strain BrCr-TR (Arita et al, J. Gen. Virol. 86. Pt 5 (2005): 1391-401) is placed under the control of a different promoter, such as, by way of example, the cytomegalovirus (CMV) promoter (Boshart et al, Cell 41.2 (1985): 521-30).
  • CMV cytomegalovirus
  • Using such a strategy as described herein, VLPs of EV71 capsid proteins are generated.
  • the invention thus provides a highly efficient means to produce VLPs that can be used to formulate a protective vaccine against EV71 outbreaks.
  • the invention augments the rate of translation from
  • EV71 -specific mRNA transcripts in BV -infected insect cells The translational enhancer sequence L21 is inserted into 5' of the PI ORF and leads to a much higher amount of processed PI subunits.
  • EV71 capsid protein expression was not found to be augmented by using a codon-optimized approach, in contrast to codon-optimization in other BV-systems that led to increased production of the respective heterologous transgene (Angov, Biotechnol. J. 6.6 (2011): 650-59; Zhang et al, Biochem. Biophvs. Res. Commun. 227.3 (1996): 707-11).
  • Sf21 cells was found to be superior to Sf9 cells, and thus useful in producing EV71 VLP on a large scale.
  • both the same gene cassettes - albeit with different EV71 ORFs and other slight modifications like the polyadenylation signals used - were either in a sense configuration with the PI cassette positioned in 5' to the 3 CD cassette, or in antisense orientation with adjacent polyadenylation cassettes.
  • Proper proteolytic PI processing was observed with both versions, implying functional expression of PI and 3CD, i.e., the positions and orientations of the transgene cassettes in both constructs allowed BV-mediated transgene production in insect cells.
  • both transgene cassettes can be arranged in the described configuration suggesting at least a partial non-interfering activity of both promoters, and a qualitative superiority in protein expression with the opposite orientations.
  • VPO processing into VP2 and VP4 requires viral RNA encapsidation
  • the VPO cleavage into VP2 and VP4 may also occur without encapsidation of viral genomic RNA into a preformed capsid, and even if only the VPO subunit itself is present in a cell. It is likely that the final proteolytic VPO processing step into VP2 and VP4 observed in lysates of infected insect cells and in 3CD-deficient 293TT cells after expression of VPO leads to mature VLPs containing processed VP2 and VP4 even in the absence of encapsidated viral genomic RNA. At least a certain percentage of EV71 VLPs would more resemble fully processed infectious viral capsids.
  • VLPs derived from the supernatant of infected Sf21 cells were not observed with VP2, implying that in particles released from infected insect cells the final maturation VPO cleavage into VP2 and VP4 would not occur.
  • the shape of a fully matured VLP would more closely resemble an infectious viral particle and therefore trigger a protective vaccine-based immune response more efficiently and more specifically to viral capsid domains suggesting a qualitative difference in protective immunity depending on whether the VLP source is either infected insect cells or the cell supernatant.
  • virus-like particles refers to virus particles of EV71 that self-assemble into intact virus structures comprised of capsid proteins such as EV71 capsid proteins.
  • VLPs are morphologically and antigenically similar to authentic virions, but do not contain genetic information sufficient to replicate and thus are non-infectious.
  • VLPs are produced in suitable host cells (i.e., insect host cells) wherein upon isolation and further purification under suitable conditions they are purified as intact VLPs.
  • suitable host cells i.e., insect host cells
  • mutation includes substitutions, transversions, transitions, transpositions, reversions, deletions, insertions, or other events that may have improved desired activity, or a decreased undesirable activity of the gene.
  • Mutation encompasses null mutations in natural virus isolates or in synthesized genes that may change the primary amino acid sequences of the expressed protein but do not affect self-assembly of capsid proteins, and antigenicity or immunogenicity of VLPs or chimeric VLPs.
  • Virus-like particles typically self assemble in the cell and remain intracellular; therefore isolation of these particles requires processes of cell disruption and protein solubilization with the accompanying risks of VLP disruption, proteolysis and contamination of the end product. In some cases infected cells extracellularly express viral capsid proteins that self assemble into VLPs.
  • the invention thus provides a vaccine comprising VLPs produced according to the methods described herein.
  • the vaccine or medicament is preferably used for protection against and/or treatment of an EV71 related disease.
  • Said vaccine or medicament can be administered to an individual at risk of said disease, preferably in combination with a suitable adjuvant and/or carrier, before an EV71 infection has taken place.
  • Such immunization provides a degree of protection against subsequent infection and disease symptoms.
  • the VLP produced according to the invention may in some instances be administered as a medicament after an EV71 infection.
  • the medicament will at least in part counteract EV71 infection.
  • a medicament comprising a VLP molecule of the invention can of course be combined with one or more other medicaments, such as inflammation inhibitors.
  • VLPs of the invention can be made by disassembly and reassembly techniques. For example, as described in McCarthy et al, 1998 J. Virology 72(1):33-41, employing the disassembly and reassembly of recombinant human papilloma virus VLPs purified from insect cells to obtain a homogeneous preparation of VLPs.
  • US Pat. 6,245,568 also describes a general disassembly/reassembly process for making HPV VLPs that can be employed in the context of preparing VLPs of the present invention.
  • VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
  • the vaccine can also be formulated or co-administered with VLPs of other strains of EV71, or with other, non-EV71 antigens.
  • these non-EV71 antigens can provide protection against other diseases that typically affect the targeted patient population of infants and young children.
  • the vaccine may provide protection against both EV71 and rotavirus.
  • the vaccine is provided in a liquid vaccine formulation, although the vaccine can be lyophilized and reconstituted prior to administration.
  • the vaccine described herein can be formulated to comprise an adjuvant or a mixture of adjuvants, in combination with the VLPs.
  • the VLPs can be used in combination with aluminum, and can be adsorbed or partially adsorbed onto aluminum adjuvant.
  • Other adjuvants which can be used are adjuvants which stimulate a Thl type response such as lipopolysaccharides, for example a non-toxic derivative of lipid A, such as monophosphoryl lipid A or more particularly 3-0-desacyl-4'-monophoshoryl lipid A (3D-MPL).
  • the adjuvant is an aluminum salt, preferably in combination with a lipopolysaccharide such as 3D-MPL.
  • the adjuvant is aluminum hydroxide, or the combination of aluminum hydroxide with 3D-MPL.
  • VLPs of the invention When VLPs of the invention are adsorbed onto aluminum containing adjuvants, the VLPs can be adsorbed to the aluminum adjuvant prior to mixing of the VLPs to form the final vaccine product.
  • the vaccine can also comprise aluminum or an aluminum compound.
  • the vaccine described herein can be administered by any of a variety of routes such as oral, topical, subcutaneous, musosal, intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository. Oral, intramuscular and intradermal deliveries are preferred.
  • the EV71 vaccine prepared as described herein can be tested using standard techniques, for example in standard preclinical models, to confirm that the vaccine is sufficiently immunogenic.
  • a vaccine is used for the vaccination of children aged from 6 months and older, e.g., such as 6 months to 4 years. However, children above 4 years old can also be vaccinated. Similarly the vaccine can be administered to older age groups such as 8 to 12 years and older or women of childbearing age.
  • the vaccine of the present invention is administered in one, two or three doses wherein each dose of the vaccine comprises EV71 VLPs in a concentration of greater than about 10 ⁇ g up to about 1 mg, more typically from about 15 to 20 ⁇ g up to 500 ⁇ g, more often 20 ⁇ g up to about 100 or 200 ⁇ g per dose.
  • the vaccine is administered in two or three doses wherein each dose of the vaccine comprises EV71 VLPs in a concentration of greater than 20 ⁇ g, for example, 30 ⁇ g of VLP, or 40 ⁇ g of VLP, or 60 ⁇ g of VLP, together with an adjuvant.
  • Administration of the vaccine can follow any appropriate dosing schedule, e.g., a 2-dose schedule, for example a 0, 1 month schedule, a 0, 2 month schedule, a 0, 3 month schedule, a 0, 4 month schedule, a 0, 5 month schedule or a 0, 6 month schedule.
  • a 2-dose schedule for example a 0, 1 month schedule, a 0, 2 month schedule, a 0, 3 month schedule, a 0, 4 month schedule, a 0, 5 month schedule or a 0, 6 month schedule.
  • the second dose is administered between 2 weeks and 8 months after administration of the first dose, for example between 1 and 6 months after the first dose or between 3 and 8 months after the first dose.
  • the second dose may be administered for example one month or two months or three months or four months or five months or six months after the first dose.
  • the second dose of vaccine is administered more than two months after the first dose, for example 3 or more months, or 4 or more months, or 5 or more months, or 6 or more months after the first dose, where in each case there can be an upper limit of 8 to 12 months after the first dose.
  • the vaccine, use or method can employ EV71 VLPs, each in an amount greater than 10 to 20 ⁇ g per human dose, for example 30 ⁇ g per dose or greater than 30 ⁇ g per dose, for example 40 ⁇ g per dose or 60 ⁇ g per dose or 80 ⁇ g per dose.
  • the amount of EV71 VLPs per dose can be the same or different.
  • vaccine refers to a composition that comprises an immunogenic component capable of provoking an immune response in an individual, such as a human, wherein the composition may be formulated to optionally contain an adjuvant.
  • a vaccine for EV71 suitably elicits at least a partial protective immune response against infection, or persistent infection, more preferably a complete protective immune response against infection.
  • human dose is meant a dose which is in a volume suitable for human use and may be contained in a single dosage unit container, such as a vial, syringe or other suitable vessel. Generally this is a liquid between 0.3 and 1.5 ml in volume.
  • a human dose is 0.5 ml.
  • a human dose is higher than 0.5 ml, for example 0.6, 0.7, 0.8, 0.9 or 1 ml.
  • a human dose is between 1 ml and 1.5 ml.
  • a preferred expression vector of the invention is a baculovirus vector.
  • baculovirus vectors and baculovirus DNA as well as insect cell culture procedures, see, for example, O'Reilly et al., Baculovirus Expression Vectors: A Laboratory Manual, Oxford University Press, New York, 1994, incorporated herein by reference in its entirety.
  • the baculovirus vector construct of the invention preferably contains additional elements, such as an origin of replication, one or more selectable markers allowing amplification in the alternative hosts, such as E. coli and insect cells.
  • Insect host cells include, for example, Lepidopteran cells, and particularly preferred are Spodoptera frugiperda, Bombyx mori, Heliothis virescens, Heliothis zea, Mamestra brassicas, Estigmene acrea or Trichoplusia insect cells.
  • Non- limiting examples of insect cell lines include, for example, Sf21, Sf9, High Five (BT1-TN-5B1-4), BT1-Ea88, Tn-368, mb0507, Tn mg-1, and Tn Ap2, among others.
  • baculovirus vectors that contain cis-acting control regions effective for expression in a host operatively linked to the polynucleotide to be expressed.
  • Appropriate trans-acting factors are either supplied by the host, supplied by a complementing vector or supplied by the vector itself upon introduction into the host.
  • Host cells are genetically transformed to incorporate EV71 PI and 3 CD protease polynucleotides and express polypeptides of the present invention.
  • the recombinant vectors containing a polynucleotide of interest are introduced into the host cell by any of a number of appropriate means, including infection (where the vector is an infectious agent, such as a viral or baculovirus genome), transduction, transfection, transformation, electroporation, microprojectile bombardment, lipofection, or combinations thereof.
  • a preferred method of genetic transformation of the host cells, according to the invention described herein, is infection.
  • polynucleotides are introduced alone or with other polynucleotides. Such other polynucleotides are introduced independently, co-introduced or introduced joined to the polynucleotides of the invention.
  • a polynucleotide i.e., PI gene
  • another, separate polynucleotide i.e., X2 or fusion X2 genes
  • polynucleotides encoding PI capsid protein and the polynucleotides encoding X2 protein or an L2 fusion protein are present on two mutually compatible baculovirus expression vectors which are each under the control of their own promoter.
  • the EV71 3CD protease/polymerase ORF was amplified from pEV71 (BrCr-TR) containing the sequence for the prototype EV71 strain BrCr-TR ((Arita et al., J.Gen. Virol.
  • pl6mSV40ori LI a modified version of plasmid pl6LlrLOCUSm
  • NotI and Sail thus generating pl6m SV40ori 3CD.
  • a 2603 bp Notl-Sall DNA fragment from pl6m SV40ori PI was cloned into NotI -Xhol digested pFastBacl (Invitrogen).
  • the respective nucleotide sequences (set forth below) for the PI ORF were equipped with [SEQ ID NO:3] 5 * -GCGGCCGCTCTAGACC-3 * as 5 * -untranslated region (UTR) and [SEQ ID NO:4] 5 * -TCGACAAGCTT-3 * as 3 * -UTR, respectively.
  • the cloned authentic PI ORF was inserted as a Notl-Sall fragment into Notl-Xhol digested pFastBac 1 leading to pPl NS.
  • the codon-optimized PI ORF was cloned in the same way leading to pPl codop.
  • a 2710 bp PCR fragment encoding the CMV promoter plus EV71 3 CD protease and the bovine growth hormone (BGH) poly-adenylation signal was amplified from pl6mSV40ori3CD with primers Avrll sense [SEQ ID NO:5] (5 '-GGCCT AGGGT ATT AGTC ATCGCTATT ACC A-3 ') and Avrll anti [SEQ ID NO:6] (5 * -GGCCTAGGTCCCCAGCATGCCTGCTATTGT-3 * ).
  • PCR L21s [SEQ ID NO:7] (5 * -CTCTAGAAGCTTCCTAAAAAACCGCCACCATGGGTTCGCAAGTGTCTA-3 * ) and i-VPO RF [SEQ ID NO:8] (5 * -GCGTGACTGCCTGCCTAAGACC-3 * ) with pPl NS as template.
  • PCR fragment encoding for the optimized translation initiation sequence upstream of the PI ORF was inserted into Xbal- Pmll-digested pPlNS leading to pPl L21.
  • a bicistronic BV expression plasmid with the CMV-promoted 3 CD ORF and the PHpr-driven Chinese PI ORF with the improved translation initiation sequence L21 positioned in 5' to the PI ORF was cloned by inserting a 3319 bp BsrGI-Kpnl fragment from pPl L21 into the BsrGI-Kpnl digested pBi B. The sequence integrity of all PCR-amplified cloning fragments was verified in the final basic plasmid clones.
  • Sf21 cells Vaughn et al, id.
  • SF Easy Titer cell line (Hopkins et al, Biotechniques 47.3 (2009): 785-88)) were cultivated in SF-900II SFM medium (Invitrogen) with 10% FBS (Gemini Bio-Products, West Sacramento, CA) and antibiotics at 30°C in a humidified atmosphere.
  • Cellfectin II (Invitrogen) was used to transfect recombinant bacmid DNA into insect cells according to the manufacturer's instructions.
  • Recombinant EV71 -transgenic BV stocks were prepared from infected cell supematants by filtrating through 0.22 ⁇ filters and titrated using the SF Easy Titer cell line according to the authors' instruction.
  • Infected or control (Mock) infected insect cells were harvested from tissue culture dishes and pelleted (5 min at 8000 rpm). After resuspending in PBS they were subjected to one freeze/thaw cycle (liquid N 2 ). Insoluble debris was pelleted from the protein lysates in an Eppendorf centrifuge at 8000 rpm for 5 minutes at room temperature. Protein concentrations of lysates were measured with a Nanodrop analyzer (Fisher Scientific, Rockford, IL).
  • Lysates were electrophoretically separated on 12% Tris/Bis protein gels (Invitrogen) and transferred to nitrocellulose membranes (Micron Separations, Inc, Westborough, MA).
  • membranes were stained with Ponceau red (Invitrogen) to corroborate the transfer of equal amounts of whole protein.
  • EV71 protein expression was detected using the anti-EV71 monoclonal antibody (Mab) 10F0 (Abeam, San Fransisco, CA) at 1 : 10000 in PBS with 5% dry milk powder at 4°C overnight.
  • HRP horse radish peroxidase
  • Jackson ImmunoResearch Laboratories West Grove, PA
  • Lumi Light detection kit F. Hoffmann-LaRoche Ltd., Basel, Switzerland
  • signals on western blot films were analyzed with the ImageJ software program (http://imagej.nih.gov/ij/).
  • VLP Preparation by Ultracentrifugation and Electron Microscopic Detection EV71 VLPs were purified from the lysate of infected cells by physico-chemical steps as follows: The cells were harvested from tissue culture dishes and pelleted (1500 rpm, 5 min). The supernatant was removed, and the cell pellet was resuspended in PBS. After one freeze/thaw cycle in liquid N 2 insoluble debris was pelleted (8000 rpm, 5 min, Eppendorf centrifuge). The supernatant was loaded on a discontinuous sucrose gradient (15%, 30%> and 65%>) and fractionated by ultracentrifugation (SW55TI rotor, 15000 rpm, 3 hrs, 4°C).
  • the viral 3 CD protease ORF derived from the EV71 prototype strain BrCr was expressed using PHpr (FIG. 1, BV 3CD).
  • Sf cells were co-infected with BV PI and BV 3 CD, and cell lysates were analyzed with a commercially available monoclonal antibody (see above) recognizing the EV71 capsid protein PI and its subunits VP0 and VP2.
  • VP0 was detected in the lysate of infected cells, indicating that the prototype BrCr strain 3CD protease recognizes PI as a substrate.
  • the lysate of these cells was further subjected to ultracentrifugation and further VLP purification steps. EV71 VLPs were then detected using electron microscopic techniques (FIG. 2A).
  • EV71 capsid subunit proteins were optimized in the insect cell / BV system.
  • the translational enhancer sequence L21 was inserted into the PI transgene cassette (FIG. 1, BV PI L21).
  • the impact of L21 on PI synthesis was determined by measuring the VPO subunit levels in infected cells in a monocistronic co-infection system with the PI variants and 3 CD on separate BVs, both EV71 transgenes being controlled by PHpr.
  • Sf9 and Sf21 cells were infected with BV PI EU and BV PI L21 respectively, at an MOI of 10 and co-infected with BV 3CD at an MOI of 10.
  • Three days post infection the cells were harvested and analysed for EV71 capsid subunit protein expression (FIG. 3 A).
  • the amount of L21 -dependent VPO synthesis increased dramatically (compare lanes 1 (authentic PI expression) vs. lanes 2 (L21 -driven PI expression)). This finding could be observed in Sf9 and in Sf21 cells, respectively (compare FIG. 3B, upper panel (Sf9 cells) vs. lower panel (Sf21 cells). Additional bands of ca. 62 and 55 kDa were detectable with Mab 10F0 (FIG. 3 A, respective lanes land 2, labelled with asterisks).
  • the L21 translation enhancing sequence was then used in the bicistronic BV with PI and 3 CD cassettes in opposite orientations and the bacmid Bi B L21 was constructed with both cassettes opposed to each other but with the L21 leader sequence in 5' to the PI ORF.
  • EV71 capsid protein expression from BVs derived from this construct indicated no further increase in VPO capsid protein synthesis (FIG. 3C, lane 8) compared to the L21 -deficient bicistronic version (FIG. 3C, lane 7). Rather, VPO accumulation seemed to be decreased when fewer equal amounts of cell lysates were analyzed to counteract saturation effects during western blot analysis (FIG.
  • VPO accumulation was increased when using the codon-optimized PI ORF when the cells were co-infected with BV 3CD (FIG. 3D, lane 4: authentic PI versus lanes 5 and 6: codon-optimized PI ORF). Therefore, and because the use of higher MOIs of BV 3 CD during co-infection seemed to be unreasonable for logistic reasons to achieve higher yields of EV 71 capsid subunit protein synthesis, VLP production with the bicistronic BV Bi B with the highest observed VPO yields was pursued.
  • Electron microscopic morphology and shape of EV71 VLPs obtained after BV Bi B-mediated production was indistinguishable from VLPs obtained with the monocistronic prototype BVs yet the occurrence of VLP aggregates was most likely due to the higher production efficiency obtained when using BV Bi B (FIG. 2B).
  • VLPs were then prepared from Sf21 cells using preparative ultracentrifugation (see Methods, supra) and analyzed for yield and purity (FIG. 6).
  • VLPs were then prepared from Sf21 cells using preparative ultracentrifugation (see Methods, supra) and analyzed for yield and purity (FIG. 6).
  • the capsid subunits VPO, VP3 and VP1 the presence of VP2-like proteins was also observed in the VLP fraction (FIG.
  • Recombinant BVs were constructed expressing the PI ORF isolated from a fatal case of EV71 infection during a recent outbreak in the People's Republic of China.
  • the PI ORF was placed under the control of the PHpr (Smith et al, Mol. Cell Biol. 3.12 (1983): 2156-65; Pennock et al, Mol. Cell Biol. 4.3 (1984): 399-406), and the 3 CD protease of BrCr-TR (Arita et al, J. Gen. Virol. 86.Pt 5 (2005): 1391-401) was under the control of the CMV promoter (Boshart et al, Cell 41.2 (1985): 521-30). Using this strategy, VLPs were generated. Then efforts were directed toward further increasing VLP yield by augmenting the rate of translation from EV71 -specific mRNA transcripts in BV-infected insect cells.
  • VPO could be detected in protein lysates from infected Sf9 cells implying that the EV71 BrCr prototype 3CD protease recognizes PI from the Chinese isolate as a substrate. That is not insubstantial because although the amino acids at the boundaries between VPO and VP3 at the first cleavage site and VP3 and VP1 at the second cleavage site are both conserved Gln-Gly residues in the Chinese PI protein, the substrate for picorna virus 3 CD protease (Kean et al., J.Gen. Virol.
  • the amino-terminal residue next to the VP0-VP3 Gln-Gly junction is different in the Chinese strain (Thr) compared to BrCr- TR strain (Ala).
  • the third residue next to the VP3-VP1 Gln-Gly junction in the VP3 protein is a Gly in the Chinese PI and an Ala in the BrCr-TR strain.
  • Such substrate changes could effect or even abolish the cleavage of the Chinese PI into VPO, VP3 and VP1 by the prototype BrCr-TR strain 3 CD protease.
  • the PHpr is known to be active at very late stages in BV infection (Hasnain et al., Gene 190.1 (1997): 113-18) whereas the CMV promoter is, at least in mammalian cells, supposed to be active at very early stages of infection.
  • the CMV promoter has been used in insect cells, its precise time of activity within the BV system has not yet been determined.
  • the present results support that both transgene cassettes can be arranged in the described configuration suggesting at least a partial non-interfering activity of both promoters.
  • the VP2-like proteins apparently consisting of a mix of two approximately equal-sized molecules were generally detectable in lysates of EV71 transgenic BVs when the levels of EV71 protein expression were high, e.g., at late times after infection (labeled with black arrows in FIG. 3). It is likely that the 28 kDa proteins are amino- or carboxy-terminal cleavage products of VPO. However, other possibilities are that, in contrast to the authentic and completely cytoplasmic EV71 replication cycle, a splicing event leading to the synthesis and translation of an mRNA coding for the 28 kDa proteins may occur in BV-infected insect cells.
  • the BrCr-TR 3 CD protease recognizes the Chinese PI VP4-VP2 boundary as a substrate.
  • additional EV71 capsid protein subunits accumulated only when EV71 PI and 3 CD were co-expressed in BV-infected cells.
  • additional lOFO-reactive VP2-specific proteins were detected comparable in size to those observed in the BV-infected insect cells.
  • These additional VP2 capsid proteins do not appear after transient expression of the EV71 BrCr VPO ORF in 293TT cells if the putative VPO cleavage site is mutated.
  • the picornavirus VPO maturation cleavage into VP2 and VP4 may also occur without encapsidation of viral genomic RNA into a preformed capsid and even if only the VPO subunit itself is present in a cell.
  • VLP yield and purity it is difficult, however, to interpret the quality of their VLP yield and purity because in their analysis the VP1 protein (39 kDa) is bigger than the VPO protein (36 kDa), yet VPO (35.2 kDa) should be bigger than VP1 (32.6 kDa), even in the case of the EV71 neu strain used by these investigators (http://www.ncbi.nlm.nih.gov/nuccore/AFl 19795).
  • the EV71 VLPs were harvested from 3xl0 7 Sf21 cells in 60 ml insect cell medium from plastic dishes as starting material three days post infection. Given the sum of the band intensities of VPO, VP1, VP2 and VP3 equals 10 ⁇ g of BSA (FIG. 6) and the relative amount of VLPs that were analyzed by SDS-PAGE, approximately 100 ⁇ g of VLPs were obtained which would be comparable to the yield of 10 mg per 10 9 Sf9 cells (Chung et al, World J. Gastroenterol. 12.6 (2006): 921-27).
  • EV71 VLP production process evaluation done by this group involved the construction of P1/3CD double-transgenic BVs yet with different orientations and submodules compared to the constructs of the present invention plus the stirrer-based large-scale production including several biochemical optimization details like the concentration of dissolved oxygen (Chung et al, Vaccine 28.43 (2010): 6951-57). Interestingly, when adjusting their VLP production process they used the supernatant of infected cells as a starting material altogether leading to very high VLP yields.
  • BV-Mock-infected Sf21 cells were tested for comparable issues putatively affecting VLP production or at least the electron microscopic demonstration of EV71 VLP formation and no evidence was found for any contaminating virus in the cell culture system. Thus, the biochemical optimization of VLP production will lead to production of a safe and efficient vaccine against the recent EV71 outbreaks.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Description

BACULOVIRUS-BASED ENTEROVIRUS 71 VLP AS A VACCINE
BACKGROUND
Enterovirus 71 (EV71) is an emerging virus with a severe impact on human health. It is an etiological agent responsible for hand-foot-and-mouth disease (HFMD) in young children and infants. EV71 is a picornavirus (picornaviridae), a virus family that is divided into six genera, among which are the human enteroviruses, rhinoviruses, parechoviruses, aphthoviruses, cardio viruses, and hepato viruses. The genus Enterovirus includes the human virus species of polio viruses and human enterovirus groups A to D. Human enterovirus A consists of 12 serotypes, including coxsackievirus A2, A16 and enterovirus 71.
Enteroviruses cause a wide spectrum of clinical syndromes ranging from mild fever to respiratory infections, meningitis, encephalitis, paralytic poliomyelitis and myocarditis. Life-threatening enteroviral infections may occur, especially in high-risk individuals such as immunocompromised patients, infants and young children. Reminiscent of experiences with poliovirus, EV71 infection may also have severe neurologic adverse effects (Ooi et al, Lancet Neurol. 9.11 (2010): 1097-105; Solomon et al., Lancet Infect.Dis. 10.11 (2010): 778-90). These include aseptic meningitis, brain stem encephalitis, and death.
Enteroviruses are single-stranded RNA viruses. Their genomes comprise approximately 7500 nts. The genomic organization and replication of EV71 follows the enterovirus prototype genome organization (Kirkegaard, Curr. Opin. Genet. Dev. 2.1 (1992): 64-70): a single open reading frame (ORF) encoding a polyprotein is expressed and subsequently cleaved. The PI region of the polyprotein gene encodes the four structural virus capsid subunit proteins VP4, VP2, VP3 and VPl . Cleavage of the PI polyprotein into VPO (VP4+VP2), VP3 and VPl is mediated by the viral 3CD protease, the 3CD part of the viral polyprotein, at the plasma membrane.
The EV71 prototype strain BrCr was first described in 1973 (Schmidt et al, J.Infect.Dis. 129.3 (1974): 304-09). Current outbreaks of the emerging subgenotype C4 mainly affect the population in the People's Republic of China (Tan et al., PLoS. One. 6.9 (2011): e25662 (Electronic submission); Zhang et al, J. Clin. Virol. 44.4 (2009): 262-67; Zhang et al., Virol. J. 7 (2010): 94 (Electronic submission); Zhang et al., PLoS. One. 6.11 (2011): e27895 (Electronic submission)) with children under seven years of age being the main susceptible population (Yu et al, Jpn. J. Infect. Pis. 64.6 (2011): 528-32). Currently, there is no curative treatment available for EV71 infection (Thibaut et al., Biochem. Pharmacol. 83.2 (2012): 185-92; Liang et al, Vaccine 29.52 (2011): 9668-74).
Prophylactic vaccines against EV71 are being developed, although these attempts are either directed against formerly EV71 subgenotypes like the EV71 neu strain (Lin et al, Vaccine 20.19-20 (2002): 2485-93; Chung et al, World J. Gastroenterol. 12.6 (2006): 921-27), or are based on inactivated virus (Riedmann, Hum. Vaccin. 7.8 (2011): 802-05; Liang et al, Vaccine 29.52 (2011):9668-74; Chang et al, Vaccine 30.4 (2012): 703-11) with potential risk factors as occurs in poliovirus vaccines (Arita and Francis, Vaccine 29.48 (2011): 8827-34). Safer approaches are needed for vaccine production that are independent from any infectious virus, such as heterologous viral subunit transgene expression systems using, for example, bacteria, yeast, plants or insect baculo viruses (BVs).
One potential approach for vaccine development is the production of virus-like particles (VLPs) using the BV expression system (van Oers, Adv. Virus Res. 68 (2006) 193-253; Kost et al, Nat. Biotechnol 23.5 (2005) 567-75). Due to the huge coding capacity of BVs large recombinant transgenic insertions can be accomplished. Using one BV containing all heterologous genes of choice greatly simplifies virus handling and has been shown to result in up to a 30-fold higher heterologous protein expression (Berger et al, Nat. Biotechnol. 22.12 (2004): 1583-87), notably in BV-mediated VLP expression systems (Roy et al, Gene 190.1 (1997): 119-29; Bertolotti-Ciarlet et al, Vaccine 21.25-26 (2003): 3885-900).
VLP formation has been accomplished in a BV system with a full-length poliovirus open reading frame (ORF) (Urakawa et al., J.Gen. Virol. 70 (Pt 6) (1989): 1453-63). To produce VLPs of EV71, two components - PI plus 3CD - have been used together for the EV71 neu strain (Hu et al, Biotechnol. Lett. 25.12 (2003): 919-25; Chung et al, (2006), supra; Chung et al, Vaccine 28.43 (2010): 6951-57) in the insect cell/ BV system. Chung et al, ibid, reported a bicistronic BV system for optimal EV71 VLP yield where the PI gene under the control of the polyhedrin promoter (PHpr), and 3 CD under the control of the CMV promoter, are located in a head-to-head promoter configuration. A significant need remains, however, for an efficient system to generate high yields of VLPs of EV71 to develop a protective vaccine, particularly against recent EV71 outbreaks in Asia. Insect cell lines are used as a culture system for the production of vaccines used in human and veterinary medicine. Many recombinant proteins have been expressed in insect cells that are immunogenically, antigenically, and functionally similar to the native proteins. The desired product is an expressed protein that is produced in large amounts and that is as similar to the natural protein as possible, including necessary post-translation processing and modification. Among the post-translational processing steps that have been shown to occur in insect cells are fatty acid acylation, phosphorylation, and glycosylation (Luckow, V. A. 1995. In: Baculoviruses Expression Systems and Biopesticides, Shuler et al, Eds. Wiley-Liss, New York, NY, pages 51-90). Most proteins recovered from insect cell cultures, however, have a lower molecular weight than the native protein because of incomplete post-translational modification. Yields of protein from baculovirus expression vectors in insect cell cultures are reported to be many times higher than those from mammalian cells. Differences in yields of expressed gene products from engineered baculoviruses among cell lines have been reported. Hink and co-workers (Hink et al., Biotechnol Prog. 7 (1991):9— 14), compared the expression of three recombinant proteins in twenty-three different cell lines. For each protein, the yield varied among the cell lines and no single cell line produced the highest yields for all three proteins.
SUMMARY
This summary is provided to introduce a selection of concepts in a simplified form that are further described below in the Detailed Description. This summary is not intended to identify key features of the claimed subject matter, nor is it intended to be used as an aid in determining the scope of the claimed subject matter.
In one aspect the invention provides a vaccine composition of virus-like particles (VLPs) of human enterovirus 71 (EV71) strain EU703812 for preventing human EV71 infection or inhibiting development of EV71 disease manifestations. Such a vaccine may comprise capsid proteins VPO, VP4, VP2, VP3 and VPl, and preferably will be free of infectious genomic EV71 RNA, and substantially free of any RNA. The vaccine of the invention is preferably available in a concentration of 20 to 100 μg per human dose, together with an adjuvant, such as an aluminum salt. The vaccine may be contained in a vessel such as a vial, capsule, syringe, etc. that is suitable for containing a 500 μΐ to 1.0ml human vaccine dose. In yet additional embodiments the invention provides a method for producing a vaccine against EV71 infection or disease, by infecting Spodoptera frugiperda (Sf) cells with a recombinant baculo virus comprising a PI gene of EV71 strain EU703812 and a 3 CD protease gene of prototype EV71 strain BrCr-Tr under control of a CMV promoter in a bicistronic configuration. The infected Sf cells are cultured under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs, which are then harvested and combined with a physiologically acceptable carrier or an adjuvant to produce the vaccine. The PI gene is preferably placed under control of a polyhedrin promoter, and/or the 3CD protease gene is preferably under control of a CMV promoter. Preferably the Sf cells are Sf21. The resulting vaccine is preferably free of infectious genomic EV71 RNA.
In further aspects the present invention provides a method for producing a vaccine against EV71 by obtaining EV71 VLPs from a culture of Sf cells, such as, e.g., Sf21 cells, infected with a recombinant baculovirus. The recombinant baculovirus comprises a PI gene of EV71 strain, which in some instances may be EU703812, and a 3CD protease gene, which in some instances may be from prototype EV71 strain BrCr-Tr, under control of a CMV promoter in a bicistronic configuration. Optionally, a translational enhancer L21 is inserted 5' of the PI gene. The infected Sf cells are cultured under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs. The EV71 VLPs are combined with an adjuvant to produce the vaccine.
In another embodiment the invention provides a method for inhibiting or preventing EV71 infection or inhibiting the development of EV71 disease, by administering an effective amount of an EV71 vaccine that comprises EV71 VLPs of strain EU703812, together with a pharmaceutically acceptable excipient and optionally an adjuvant. The vaccine is administered in an amount sufficient to generate an immune response in the individual that prevents EV71 infection or disease, and may be given in two consecutive doses consisting of a first dose and a second dose, where, for example, the second dose is administered at least about two to six months after the first dose. The adjuvant may be an aluminum salt, such as aluminum hydroxide. The EV71 VLPs may comprise capsid proteins VPO, VP3 and VPl or VP4, VP2, VP3 and VPl and are free of genomic EV71 RNA. DESCRIPTION OF THE DRAWINGS
The foregoing aspects and many of the attendant advantages of this invention will become more readily appreciated as the same become better understood by reference to the following detailed description, when taken in conjunction with the accompanying drawings, wherein:
FIG. 1 shows the genome structures of recombinant EV71 -transgenic BVs. A: Monocistronic BVs. Upper left: BV PI, upper right: BV 3CD, lower left: BV L21 PI, lower right: BV PI codop. B: Bicistronic BVs. Upper left: BV Bi A, lower: BV Bi B, right: BV Bi B L21. Figure legend: T: Transposon recognition sequence, P: Polyhedrin promoter PHpr, PI : EV71 PI polyprotein ORF, A: poly A signal light gray: SV40, dark gray: BGH), C: CMV promoter, 3CD: EV71 protease 3CD ORF, L: L21 translation enhancer and PI codop: codon-optimized EV71 polyprotein ORF. For reasons of clarity the Gentamicin resistance cassette used for selection of recombinant bacmids in bacteria present in all constructs between the left transposon recognition sequence and the PHpr as well as the constant parts of the respective 5' UTRs of the transgene cassettes are not shown. Vector genomes are not drawn to scale.
FIGURE 2 shows the electron microscopic detection of EV71 VLPs. A. Sf9 cells were co-infected with BV PI and BV 3CD. Following purification steps, VLPs of 30 to 40 nm in size were detected using electron microscopic analysis (indicated by a white arrow for one VLP). The particle labeled with a black arrow might be a BV capsid particle or an immature VLP form. Bar size 200 nm. B. Electron microscopic detection of EV71 VLPs in Sf21 cells after infection with BV Bi B. The white arrow indicates VLP aggregates, putatively forming due to the high expression efficiency when using BV Bi B. Bar size 50 nm.
FIGURE 3 A: Faster processing of EV71 capsid transgenic proteins in Sf21 cells compared to Sf9 cells and higher EV 71 capsid protein yield through the L21 translational enhancer. Equal amounts of protein were analyzed with the monoclonal antibody (Mab) 10F0. Lane 1 : cells infected with BV PI, lane 2: cells infected with BV PI L21. In these two experiments the cells were co-infected with BV 3 CD (multiplicity of infection (MOI) 10). Lane 3: cells infected with BV 3 CD only (MOI 10), lane 4: uninfected cells. Upper panel: Sf9 cells, lower panel: Sf21 cells. The EV71 PI and VP0 proteins are indicated. Putative additional intermediate EV71 -specific cleavage products are indicated with asterisks. FIGURE 3B: Superior EV71 capsid protein expression levels from bicistronic BVs in insect cells with the transgene cassettes in opposite orientations. Sf21 cells were infected with BV Bi A (lane 1) and BV Bi B (lane 2) at respective MOIs of 10. Three days post infection cell lysates were harvested. After electrophoretic separation of equal amounts of cellular proteins followed by western blot transfer, EV71 capsid protein expression was detected with the Mab 10F0. Lane 3: uninfected cells.
FIGURE 3C: Higher EV71 capsid protein expression in Sf21 cells through the L21 leader sequence in the monocistronic BV infection system but not in the bicistronic configuration. Lane 1 : Sf21 cells infected with BV PI (MOI 10), lane 2: Sf21 cells infected with BV PI L21 (MOI 10), lane 3: Sf21 cells co-infected with BV PI (MOI 10) and BV 3 CD (MOI 10), lane 4: Sf21 cells co-infected with BV PI L21 (MOI 10) and BV 3 CD (MOI 10), lane 5: Sf21 cells co-infected with BV PI (MOI 10) and BV 3 CD (MOI 1), lane 6: SF21 cells co-infected with BV PI L21 (MOI 10) and BV 3 CD (MOI 1), lane 7: Sf21 cells infected with BV Bi B (MOI 10), lane 7: Sf21 cells infected with BV Bi B L21 (MOI 10), lane 9: uninfected cells. The EV71 PI and VPO proteins are indicated. Putative additional EV71 -specific intermediate cleavage products are indicated with asterisks. CI . Impaired EV71 VPO accumulation with L21 in 5' to the PI ORF in the bicistronic configuration is detected when fewer amounts of protein are analyzed compared to C for the BV Bi B and BV Bi B L21 infection experiments. Lane 1 : Uninfected Sf21 cells, lane 2: BV 3CD-infected cells, lane 3: BV Bi B-infected cells, lane 4: BV Bi B L21 infected cells. Equal amounts of protein were loaded in lanes 3 and 4.
FIGURE 3D: Sf21 cells were infected with BV PI (lanes 1 and 4) or two independent BV stocks with codon-optimized PI ORF (lanes 2, 3, 5 and 6) at an MOI of 10 either in the absence (lanes 1 to 3) or presence of BV 3CD (MOI 10, lanes 4 to 6). Three days post infection cell lysates were harvested. Lane 7: BV 3CD-infected cells, lane 8: uninfected cells.
FIGURE 4: EV71 BrCr VPO processing into VP2 in 293TT cells in the absence of viral proteases and inhibition of processing in two VPO alanine mutants. 293TT cells were transfected with plasmids expressing the wt VPO ORF (lane 1) or two VPO ORF versions with alanine residues instead of the authentic amino acids at the putative VP4-VP2 cleavage position (lanes 2 and 3). Cell lysates were harvested at day 2 post transfection and subjected to Western blot analysis applying Mab 10F0. Lane 4: Lysate from untransfected 293TT cells, lane 5: lysate from EV71 BrCr-infected 293TT cells.
FIGURE 5: BV Bi B infection kinetic in insect cells reveals highest EV71 capsid protein yield five days after infection. Cell lysates harvested at different times post infection were Western blot analyzed with Mab 10F0.
FIGURE 6: Purity of EV71 VLPs. Sf21 cells were infected with BV Bi B (MOI 10) and harvested three days post infection. The lysate was subjected to separation on a discontinuous sucrose gradient. The opaque band occurring in the lower part of the 30% sucrose fraction was harvested and dialyzed in a Vivaspin 500 column and separated on 12% Tris/Bis gels. Lane 1 : 10 ug BSA, lane 2: 1 ug BSA, lane 3: EV71 VLPs. Left part: proteins visualized with Gel Code Blue. Right part: Western Blot with MAb 10F0. Origins of detectable bands are given. Note that in this gel system VP0 and VP1 run as a doublet. The triplet consisting of the bands A, B and C is discussed in the Example section.
DESCRIPTION OF EMBODIMENTS
The present invention provides a means to produce a safe and effective vaccine to quickly respond to EV71 outbreaks, such as occurred recently in the People's Republic of China and elsewhere in Asia. According to this invention, the EV71 PI gene derived from a recent fatal case in China, and the 3 CD protease from the BrCr-TR prototype strain, are co-expressed by a baculovirus (BV) / insect cell system. The EV71 PI ORF is placed under control of a promoter, such as, for example, the BV polyhedrin promoter (PHpr) (Smith et al, Mol. Cell Biol. 3.12 (1983): 2156-65; Pennock et al, Mol. Cell Biol. 4.3 (1984): 399-406). The 3 CD protease of the prototype strain BrCr-TR (Arita et al, J. Gen. Virol. 86. Pt 5 (2005): 1391-401) is placed under the control of a different promoter, such as, by way of example, the cytomegalovirus (CMV) promoter (Boshart et al, Cell 41.2 (1985): 521-30). Using such a strategy as described herein, VLPs of EV71 capsid proteins are generated. The invention thus provides a highly efficient means to produce VLPs that can be used to formulate a protective vaccine against EV71 outbreaks.
To increase VLP yield, the invention augments the rate of translation from
EV71 -specific mRNA transcripts in BV -infected insect cells. The translational enhancer sequence L21 is inserted into 5' of the PI ORF and leads to a much higher amount of processed PI subunits. EV71 capsid protein expression was not found to be augmented by using a codon-optimized approach, in contrast to codon-optimization in other BV-systems that led to increased production of the respective heterologous transgene (Angov, Biotechnol. J. 6.6 (2011): 650-59; Zhang et al, Biochem. Biophvs. Res. Commun. 227.3 (1996): 707-11). However, the use of Sf21 cells was found to be superior to Sf9 cells, and thus useful in producing EV71 VLP on a large scale.
In the bicistronic systems both the same gene cassettes - albeit with different EV71 ORFs and other slight modifications like the polyadenylation signals used - were either in a sense configuration with the PI cassette positioned in 5' to the 3 CD cassette, or in antisense orientation with adjacent polyadenylation cassettes. Proper proteolytic PI processing was observed with both versions, implying functional expression of PI and 3CD, i.e., the positions and orientations of the transgene cassettes in both constructs allowed BV-mediated transgene production in insect cells. Thus the invention supports that both transgene cassettes can be arranged in the described configuration suggesting at least a partial non-interfering activity of both promoters, and a qualitative superiority in protein expression with the opposite orientations.
Contradictory to picornavirus dogma that VPO processing into VP2 and VP4 requires viral RNA encapsidation, the VPO cleavage into VP2 and VP4 may also occur without encapsidation of viral genomic RNA into a preformed capsid, and even if only the VPO subunit itself is present in a cell. It is likely that the final proteolytic VPO processing step into VP2 and VP4 observed in lysates of infected insect cells and in 3CD-deficient 293TT cells after expression of VPO leads to mature VLPs containing processed VP2 and VP4 even in the absence of encapsidated viral genomic RNA. At least a certain percentage of EV71 VLPs would more resemble fully processed infectious viral capsids.
In the present invention, VLPs derived from the supernatant of infected Sf21 cells were not observed with VP2, implying that in particles released from infected insect cells the final maturation VPO cleavage into VP2 and VP4 would not occur. This indicates a qualitative difference between supernatant-derived VLPs and cell-associated, for which a partial maturation was observed of VPO into VP2 and VP4. The shape of a fully matured VLP would more closely resemble an infectious viral particle and therefore trigger a protective vaccine-based immune response more efficiently and more specifically to viral capsid domains suggesting a qualitative difference in protective immunity depending on whether the VLP source is either infected insect cells or the cell supernatant. VLPs and Vaccine Use
As used in herein, "virus-like particles" or "VLPs" refers to virus particles of EV71 that self-assemble into intact virus structures comprised of capsid proteins such as EV71 capsid proteins. VLPs are morphologically and antigenically similar to authentic virions, but do not contain genetic information sufficient to replicate and thus are non-infectious. VLPs are produced in suitable host cells (i.e., insect host cells) wherein upon isolation and further purification under suitable conditions they are purified as intact VLPs. As disclosed herein, "mutation" includes substitutions, transversions, transitions, transpositions, reversions, deletions, insertions, or other events that may have improved desired activity, or a decreased undesirable activity of the gene. Mutation encompasses null mutations in natural virus isolates or in synthesized genes that may change the primary amino acid sequences of the expressed protein but do not affect self-assembly of capsid proteins, and antigenicity or immunogenicity of VLPs or chimeric VLPs. Virus-like particles typically self assemble in the cell and remain intracellular; therefore isolation of these particles requires processes of cell disruption and protein solubilization with the accompanying risks of VLP disruption, proteolysis and contamination of the end product. In some cases infected cells extracellularly express viral capsid proteins that self assemble into VLPs.
The invention thus provides a vaccine comprising VLPs produced according to the methods described herein. The vaccine or medicament is preferably used for protection against and/or treatment of an EV71 related disease. Said vaccine or medicament can be administered to an individual at risk of said disease, preferably in combination with a suitable adjuvant and/or carrier, before an EV71 infection has taken place. Such immunization provides a degree of protection against subsequent infection and disease symptoms. The VLP produced according to the invention may in some instances be administered as a medicament after an EV71 infection. The medicament will at least in part counteract EV71 infection. A medicament comprising a VLP molecule of the invention can of course be combined with one or more other medicaments, such as inflammation inhibitors. In one embodiment several medicaments or vaccine preparations are separately administered to an individual. However, a VLP vaccine or medicament molecule of the invention can also be combined with another pharmaceutically active compound in one pharmaceutical or vaccine preparation. VLPs of the invention can be made by disassembly and reassembly techniques. For example, as described in McCarthy et al, 1998 J. Virology 72(1):33-41, employing the disassembly and reassembly of recombinant human papilloma virus VLPs purified from insect cells to obtain a homogeneous preparation of VLPs. US Pat. 6,245,568 also describes a general disassembly/reassembly process for making HPV VLPs that can be employed in the context of preparing VLPs of the present invention.
VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
Optionally the vaccine can also be formulated or co-administered with VLPs of other strains of EV71, or with other, non-EV71 antigens. Suitably these non-EV71 antigens can provide protection against other diseases that typically affect the targeted patient population of infants and young children. For example, the vaccine may provide protection against both EV71 and rotavirus.
In one embodiment the vaccine is provided in a liquid vaccine formulation, although the vaccine can be lyophilized and reconstituted prior to administration.
The vaccine described herein can be formulated to comprise an adjuvant or a mixture of adjuvants, in combination with the VLPs. The VLPs can be used in combination with aluminum, and can be adsorbed or partially adsorbed onto aluminum adjuvant. Other adjuvants which can be used are adjuvants which stimulate a Thl type response such as lipopolysaccharides, for example a non-toxic derivative of lipid A, such as monophosphoryl lipid A or more particularly 3-0-desacyl-4'-monophoshoryl lipid A (3D-MPL). Suitably the adjuvant is an aluminum salt, preferably in combination with a lipopolysaccharide such as 3D-MPL. Thus, in one embodiment the adjuvant is aluminum hydroxide, or the combination of aluminum hydroxide with 3D-MPL.
When VLPs of the invention are adsorbed onto aluminum containing adjuvants, the VLPs can be adsorbed to the aluminum adjuvant prior to mixing of the VLPs to form the final vaccine product. The vaccine can also comprise aluminum or an aluminum compound.
The vaccine described herein can be administered by any of a variety of routes such as oral, topical, subcutaneous, musosal, intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository. Oral, intramuscular and intradermal deliveries are preferred. The EV71 vaccine prepared as described herein can be tested using standard techniques, for example in standard preclinical models, to confirm that the vaccine is sufficiently immunogenic.
For the vaccines described herein, in one embodiment a vaccine is used for the vaccination of children aged from 6 months and older, e.g., such as 6 months to 4 years. However, children above 4 years old can also be vaccinated. Similarly the vaccine can be administered to older age groups such as 8 to 12 years and older or women of childbearing age.
In one embodiment, the vaccine of the present invention is administered in one, two or three doses wherein each dose of the vaccine comprises EV71 VLPs in a concentration of greater than about 10 μg up to about 1 mg, more typically from about 15 to 20 μg up to 500 μg, more often 20 μg up to about 100 or 200 μg per dose. In one embodiment, the vaccine is administered in two or three doses wherein each dose of the vaccine comprises EV71 VLPs in a concentration of greater than 20 μg, for example, 30 μg of VLP, or 40 μg of VLP, or 60 μg of VLP, together with an adjuvant.
Administration of the vaccine can follow any appropriate dosing schedule, e.g., a 2-dose schedule, for example a 0, 1 month schedule, a 0, 2 month schedule, a 0, 3 month schedule, a 0, 4 month schedule, a 0, 5 month schedule or a 0, 6 month schedule. For example the second dose is administered between 2 weeks and 8 months after administration of the first dose, for example between 1 and 6 months after the first dose or between 3 and 8 months after the first dose. Thus the second dose may be administered for example one month or two months or three months or four months or five months or six months after the first dose.
In one embodiment the second dose of vaccine is administered more than two months after the first dose, for example 3 or more months, or 4 or more months, or 5 or more months, or 6 or more months after the first dose, where in each case there can be an upper limit of 8 to 12 months after the first dose. The vaccine, use or method can employ EV71 VLPs, each in an amount greater than 10 to 20 μg per human dose, for example 30 μg per dose or greater than 30 μg per dose, for example 40 μg per dose or 60 μg per dose or 80 μg per dose. The amount of EV71 VLPs per dose can be the same or different.
The term "vaccine" as used herein refers to a composition that comprises an immunogenic component capable of provoking an immune response in an individual, such as a human, wherein the composition may be formulated to optionally contain an adjuvant. A vaccine for EV71 suitably elicits at least a partial protective immune response against infection, or persistent infection, more preferably a complete protective immune response against infection. By the term "human dose" is meant a dose which is in a volume suitable for human use and may be contained in a single dosage unit container, such as a vial, syringe or other suitable vessel. Generally this is a liquid between 0.3 and 1.5 ml in volume. In one embodiment, a human dose is 0.5 ml. In a further embodiment, a human dose is higher than 0.5 ml, for example 0.6, 0.7, 0.8, 0.9 or 1 ml. In a further embodiment, a human dose is between 1 ml and 1.5 ml.
Baculovirus Expression Systems
A preferred expression vector of the invention is a baculovirus vector. For baculovirus vectors and baculovirus DNA, as well as insect cell culture procedures, see, for example, O'Reilly et al., Baculovirus Expression Vectors: A Laboratory Manual, Oxford University Press, New York, 1994, incorporated herein by reference in its entirety. The baculovirus vector construct of the invention preferably contains additional elements, such as an origin of replication, one or more selectable markers allowing amplification in the alternative hosts, such as E. coli and insect cells. Insect host cells include, for example, Lepidopteran cells, and particularly preferred are Spodoptera frugiperda, Bombyx mori, Heliothis virescens, Heliothis zea, Mamestra brassicas, Estigmene acrea or Trichoplusia insect cells. Non- limiting examples of insect cell lines include, for example, Sf21, Sf9, High Five (BT1-TN-5B1-4), BT1-Ea88, Tn-368, mb0507, Tn mg-1, and Tn Ap2, among others.
In certain embodiments, there are provided baculovirus vectors that contain cis-acting control regions effective for expression in a host operatively linked to the polynucleotide to be expressed. Appropriate trans-acting factors are either supplied by the host, supplied by a complementing vector or supplied by the vector itself upon introduction into the host.
Host cells are genetically transformed to incorporate EV71 PI and 3 CD protease polynucleotides and express polypeptides of the present invention. The recombinant vectors containing a polynucleotide of interest are introduced into the host cell by any of a number of appropriate means, including infection (where the vector is an infectious agent, such as a viral or baculovirus genome), transduction, transfection, transformation, electroporation, microprojectile bombardment, lipofection, or combinations thereof. A preferred method of genetic transformation of the host cells, according to the invention described herein, is infection.
The polynucleotides are introduced alone or with other polynucleotides. Such other polynucleotides are introduced independently, co-introduced or introduced joined to the polynucleotides of the invention. Thus, for instance, a polynucleotide (i.e., PI gene) is transfected into host cells with another, separate polynucleotide (i.e., X2 or fusion X2 genes) using standard techniques for co-transfection and selection. In another embodiment, the polynucleotides encoding PI capsid protein and the polynucleotides encoding X2 protein or an L2 fusion protein are present on two mutually compatible baculovirus expression vectors which are each under the control of their own promoter.
The present application claims the benefit of U.S. application 61/615175, filed March 23, 2012, which is incorporated by reference herein in its entirety.
EXAMPLES
METHODS
Cloning Procedures
All PCR-based cloning procedures were carried out using Platinum Taq polymerase (Invitrogen, Carlsbad, CA). All primers were purchased from Integrated DNA Technologies Inc. (IDT, Coralville, IA). Restriction enzymes and DNA modifying enzymes were purchased either from Invitrogen or New England Biolabs (NEB, Ipswich, MA), respectively.
The EV71 3CD protease/polymerase ORF was amplified from pEV71 (BrCr-TR) containing the sequence for the prototype EV71 strain BrCr-TR ((Arita et al., J.Gen. Virol. 86.Pt 5 (2005): 1391-1401)) using primers 3CD Start: [SEQ ID NO:l] 5*-GGCGCGGCCGCATGGGGCCCAGCTTAGACTTCGCCTTGTCT-3* and i-3CD Stop: [SEQ ID NO:2] 5*-CGCCTCGAGTTAAAATAACTCCAGCCAATTTCTTCTC AAGT-3', respectively, for 40 cycles at 30" at 95°C, 30" at 50°C and 5* at 72°C. The 1961 bp 3 CD fragment was digested with NotI and Xhol and inserted into pl6mSV40ori LI (a modified version of plasmid pl6LlrLOCUSm) digested with NotI and Sail thus generating pl6m SV40ori 3CD. A 2603 bp Notl-Sall DNA fragment from pl6m SV40ori PI was cloned into NotI -Xhol digested pFastBacl (Invitrogen). A 2174 bp Notl-SphI fragment from l6mSV40ori3CD encoding for the EV71 3 CD ORF was inserted into pFastBacl digested with Notl and Sphl leading to pFastBac 3CD.
Two synthetic genes encoding PI - either derived from a recent EV71 isolate from the People's Republic of China's province Fuyang (Zhang et al., Virol. J. 7 (2010): 94 (Electronic submission) (http://www.ncbi.nlm.nih.gOv/nuccore/EU703812. l), and the second one encoding the same amino acid sequence but codon-optimized for BV/insect cells (Nakamura et al, Nucleic Acids Res. 28.1 (2000): 292) were purchased from IDT.
The respective nucleotide sequences (set forth below) for the PI ORF were equipped with [SEQ ID NO:3] 5*-GCGGCCGCTCTAGACC-3* as 5*-untranslated region (UTR) and [SEQ ID NO:4] 5*-TCGACAAGCTT-3* as 3*-UTR, respectively. The cloned authentic PI ORF was inserted as a Notl-Sall fragment into Notl-Xhol digested pFastBac 1 leading to pPl NS. The codon-optimized PI ORF was cloned in the same way leading to pPl codop.
For the construction of a bicistronic BV with EV71 PI controlled by PHpr and the 3 CD protease under the control of the CMV promoter a 2710 bp PCR fragment encoding the CMV promoter plus EV71 3 CD protease and the bovine growth hormone (BGH) poly-adenylation signal (Hampson et al, Proc.Natl.Acad.Sci.U.S.A 84.9 (1987): 2673-77) was amplified from pl6mSV40ori3CD with primers Avrll sense [SEQ ID NO:5] (5 '-GGCCT AGGGT ATT AGTC ATCGCTATT ACC A-3 ') and Avrll anti [SEQ ID NO:6] (5*-GGCCTAGGTCCCCAGCATGCCTGCTATTGT-3*). After digestion with Avrll the PCR fragment was inserted into Avrll-digested pPl NS. Because of the cloning strategy two versions with different 3 CD transgene insert orientations were obtained. Both recombinant variants, termed pBi A and pBi B, respectively, were used for further analysis. For positioning the L21 translational enhancer sequence (Sano et al., FEBS Lett. 532.1-2 (2002): 143-46) upstream of the PI ORF, a 996 bp PCR fragment was generated using primers PCR L21s [SEQ ID NO:7] (5*-CTCTAGAAGCTTCCTAAAAAACCGCCACCATGGGTTCGCAAGTGTCTA-3*) and i-VPO RF [SEQ ID NO:8] (5*-GCGTGACTGCCTGCCTAAGACC-3*) with pPl NS as template. After digestion with Xbal and Pmll, the PCR fragment encoding for the optimized translation initiation sequence upstream of the PI ORF was inserted into Xbal- Pmll-digested pPlNS leading to pPl L21. A bicistronic BV expression plasmid with the CMV-promoted 3 CD ORF and the PHpr-driven Chinese PI ORF with the improved translation initiation sequence L21 positioned in 5' to the PI ORF was cloned by inserting a 3319 bp BsrGI-Kpnl fragment from pPl L21 into the BsrGI-Kpnl digested pBi B. The sequence integrity of all PCR-amplified cloning fragments was verified in the final basic plasmid clones.
Recombinant EV71 Subunit Bacmid Cloning
Production of recombinant bacmids containing EV71 subunits PI from the
Chinese subgenotype and 3 CD (Br-Cr-TR) was carried out using the BAC-to-BAC expression system (Invitrogen) according to the manufacturer's instructions using plasmids pPl NS, pFastBac 3CD, pPl L21, pPl codop, pBi A, pBi B and pBi B L21, respectively, to generate the bacmids BAC PI NS, BAC 3CD, BAC PI L21, BAC PI codop, BAC Bi A, BAC Bi B and BAC Bi B L21. Bacmids were purified using a commercially available nucleic acid isolation kit (Invitrogen). A PCR-based colony screening was carried out to identify EV71 subunit-positive bacmids with combinations of primers M13Forward or M13Reverse and EV71 gene-specific primers, respectively.
Cell Culture, Transfections and BV Titrations
Spodoptera frugiperda (Sf) 9 insect cells (Vaughn et al, In Vitro 13.4 (1977):
213-17), Sf21 cells (Vaughn et al, id.) and the SF Easy Titer cell line ((Hopkins et al, Biotechniques 47.3 (2009): 785-88)) were cultivated in SF-900II SFM medium (Invitrogen) with 10% FBS (Gemini Bio-Products, West Sacramento, CA) and antibiotics at 30°C in a humidified atmosphere. Cellfectin II (Invitrogen) was used to transfect recombinant bacmid DNA into insect cells according to the manufacturer's instructions. Recombinant EV71 -transgenic BV stocks were prepared from infected cell supematants by filtrating through 0.22 μιη filters and titrated using the SF Easy Titer cell line according to the authors' instruction.
Protein Analysis
Infected or control (Mock) infected insect cells were harvested from tissue culture dishes and pelleted (5 min at 8000 rpm). After resuspending in PBS they were subjected to one freeze/thaw cycle (liquid N2). Insoluble debris was pelleted from the protein lysates in an Eppendorf centrifuge at 8000 rpm for 5 minutes at room temperature. Protein concentrations of lysates were measured with a Nanodrop analyzer (Fisher Scientific, Rockford, IL).
Lysates were electrophoretically separated on 12% Tris/Bis protein gels (Invitrogen) and transferred to nitrocellulose membranes (Micron Separations, Inc, Westborough, MA). For comparative analyses and comparing loaded protein amounts, membranes were stained with Ponceau red (Invitrogen) to corroborate the transfer of equal amounts of whole protein. EV71 protein expression was detected using the anti-EV71 monoclonal antibody (Mab) 10F0 (Abeam, San Fransisco, CA) at 1 : 10000 in PBS with 5% dry milk powder at 4°C overnight. After washing with 0.5% Tween in PBS, specifically bound antibody was detected using a horse radish peroxidase (HRP)-labeled goat anti-mouse (1 :20000) antibody (Jackson ImmunoResearch Laboratories, West Grove, PA) and the Lumi Light detection kit (F. Hoffmann-LaRoche Ltd., Basel, Switzerland) with KODAK X-OMAT Blue films. Occasionally, signals on western blot films were analyzed with the ImageJ software program (http://imagej.nih.gov/ij/).
VLP Preparation by Ultracentrifugation and Electron Microscopic Detection EV71 VLPs were purified from the lysate of infected cells by physico-chemical steps as follows: The cells were harvested from tissue culture dishes and pelleted (1500 rpm, 5 min). The supernatant was removed, and the cell pellet was resuspended in PBS. After one freeze/thaw cycle in liquid N2 insoluble debris was pelleted (8000 rpm, 5 min, Eppendorf centrifuge). The supernatant was loaded on a discontinuous sucrose gradient (15%, 30%> and 65%>) and fractionated by ultracentrifugation (SW55TI rotor, 15000 rpm, 3 hrs, 4°C). For each sucrose concentration two fractions (upper and lower) were harvested. Aliquots of each fraction were subjected to Western Blot analysis using Mab 10F0. The fraction containing the highest detectable amount of VP0 was concentrated and dialyzed using Vivaspin 500 columns (MW cutoff 100 kDa, Sartorius Stedim Inc., Bohemia, NY). Aliquots were fixed with 3% uranyl acetate followed by negative staining. EV71 VLPs were detected by electron microscopy using a JEOL 1230 transmission electron microscope. Alternatively, aliquots were separated by SDS-PAGE and stained with GelCode blue reagent (a coomassie G-250 stain; Pierce Biotechnology, Rockford, II) with BSA standards (NEB) or subjected to Western Blot analysis using Mab 10F0.
Results
The viral 3 CD protease ORF derived from the EV71 prototype strain BrCr was expressed using PHpr (FIG. 1, BV 3CD). Sf cells were co-infected with BV PI and BV 3 CD, and cell lysates were analyzed with a commercially available monoclonal antibody (see above) recognizing the EV71 capsid protein PI and its subunits VP0 and VP2. Using this antibody, VP0 was detected in the lysate of infected cells, indicating that the prototype BrCr strain 3CD protease recognizes PI as a substrate. The lysate of these cells was further subjected to ultracentrifugation and further VLP purification steps. EV71 VLPs were then detected using electron microscopic techniques (FIG. 2A).
Next, production of EV71 capsid subunit proteins was optimized in the insect cell / BV system. First, to increase the amount of PI protein as a substrate for EV71 VLPs the translational enhancer sequence L21 was inserted into the PI transgene cassette (FIG. 1, BV PI L21). The impact of L21 on PI synthesis was determined by measuring the VPO subunit levels in infected cells in a monocistronic co-infection system with the PI variants and 3 CD on separate BVs, both EV71 transgenes being controlled by PHpr. Sf9 and Sf21 cells were infected with BV PI EU and BV PI L21 respectively, at an MOI of 10 and co-infected with BV 3CD at an MOI of 10. Three days post infection the cells were harvested and analysed for EV71 capsid subunit protein expression (FIG. 3 A). The amount of L21 -dependent VPO synthesis increased dramatically (compare lanes 1 (authentic PI expression) vs. lanes 2 (L21 -driven PI expression)). This finding could be observed in Sf9 and in Sf21 cells, respectively (compare FIG. 3B, upper panel (Sf9 cells) vs. lower panel (Sf21 cells). Additional bands of ca. 62 and 55 kDa were detectable with Mab 10F0 (FIG. 3 A, respective lanes land 2, labelled with asterisks).
Next, the quantitative VPO expression using the bicistronic BVs Bi A and BV Bi B with PI expression driven by the PHpr and 3 CD expression controlled by the CMV promoter (FIG. 1, BV Bi A and BV Bi B) was compared. Sf21 cells were infected with viruses at MOIs of 10 and harvested two days post infection. Interestingly, much higher VPO expression was found with the Bi B configuration with the transgene cassettes in opposite transcriptional orientation (FIG. 3B, lane 2) whereas from the Bi A configuration with the transgene cassettes in a sense transcriptional orientation the amount of EV71 capsid subunit proteins was lower by approximately a factor of 7 (FIG. 3B, lane 1).
Furthermore, apart from the dominant 35.2 kDa VPO capsid protein subunit also observed was an additional ca. 28 kDa EV71 -specific capsid protein band apparently consisting of two almost equal-sized proteins in BV Bi B-infected cells (see FIG. 3A, lane 2, labeled with a red asterisk), comparable in size to EV71 VP2. These proteins were also detectable in lysates of BV Bi A-infected cells if the western blot was subjected to a longer EV71 protein expression detection time. Such a VP2-like band was also observed when the EV71 BrCr VPO ORF was transiently expressed in 3CD-deficient 293TT cells (FIG. 4, lane 1). Of note, these additional VP2 capsid proteins did not appear after transient VPO expression when the putative VPO cleavage site was mutated (FIG. 4, lanes 2 and 3).
The L21 translation enhancing sequence was then used in the bicistronic BV with PI and 3 CD cassettes in opposite orientations and the bacmid Bi B L21 was constructed with both cassettes opposed to each other but with the L21 leader sequence in 5' to the PI ORF. However, when directly compared, EV71 capsid protein expression from BVs derived from this construct indicated no further increase in VPO capsid protein synthesis (FIG. 3C, lane 8) compared to the L21 -deficient bicistronic version (FIG. 3C, lane 7). Rather, VPO accumulation seemed to be decreased when fewer equal amounts of cell lysates were analyzed to counteract saturation effects during western blot analysis (FIG. 3D, compare lanes 3 (BV Bi B) and 4 (BV Bi B L21)). However increased VPO production was observed in the bicistronic configuration (FIG. 3C, lane 7) compared to the monocistronic BV infection approach even with L21 being present in front of the PI ORF (FIG. 3C, lane 4). In this approach, 3CD expression was accomplished by co-infecting the cells with BV 3CD at an MOI of 10. Again, additional EV71 -specific capsid proteins of ca. 6 and 55 kDa plus a 45 kDa band (labelled with asterisks) were observed. Also detected was increased VPO accumulation when MOIs of 10 were used for BV 3CD instead of an MOI of 1 (compare FIG. 3C, lane 3 (BV 3CD MOI 10) versus lane 5 (BV 3 CD MOI 1) for the authentic PI, and lane 4 (BV 3 CD MOI 10) versus lane 6 (BV 3 CD MOI 1) for L21-P1).
Increased PI synthesis was attempted from an ORF having been codon-optimized for BV/insect cell expression (FIG. 1, BV PI codop). However when the impact of using a codon-optimized version of the PI ORF in BV-infected insect cells was investigated, a decisive increase in PI steady state expression levels in cells infected with BVs with the authentic PI ORF (FIG. 3 D, lane 1) was not observed when compared cells having been infected with two independently generated BV stocks with a codon-optimized PI ORF (FIG. 3 D, lanes 2 and 3). Nor was increased VPO accumulation observed when using the codon-optimized PI ORF when the cells were co-infected with BV 3CD (FIG. 3D, lane 4: authentic PI versus lanes 5 and 6: codon-optimized PI ORF). Therefore, and because the use of higher MOIs of BV 3 CD during co-infection seemed to be unreasonable for logistic reasons to achieve higher yields of EV 71 capsid subunit protein synthesis, VLP production with the bicistronic BV Bi B with the highest observed VPO yields was pursued. Electron microscopic morphology and shape of EV71 VLPs obtained after BV Bi B-mediated production was indistinguishable from VLPs obtained with the monocistronic prototype BVs yet the occurrence of VLP aggregates was most likely due to the higher production efficiency obtained when using BV Bi B (FIG. 2B).
For large scale preparation the time of the highest VLP yield was sought more precisely. For that Sf21 cells were infected with BV Bi B (MOI 10) and cells harvested over six days. When analyzing equal amounts of protein from infected cells the highest amount of EV71 VPO capsid subunit was detected at day five post infection (FIG. 5). VLPs were then prepared from Sf21 cells using preparative ultracentrifugation (see Methods, supra) and analyzed for yield and purity (FIG. 6). In addition to the capsid subunits VPO, VP3 and VP1 the presence of VP2-like proteins was also observed in the VLP fraction (FIG. 6, left and right parts) plus additional bands reminiscent of the proteins having been detected by Western Blot earlier in the cell lysates. Additionally, PI and VP2-like proteins could be detected using Mab 10F0 (FIG. 6, right part). Furthermore, a protein band triplet was detected after protein gel staining (FIG. 6, left part, "A B C") with one of these three bands most likely being unprocessed VP0-VP3 proteins (FIG. 6, right part, "VP0+VP3").
Discussion
Recombinant BVs were constructed expressing the PI ORF isolated from a fatal case of EV71 infection during a recent outbreak in the People's Republic of China. The PI ORF was placed under the control of the PHpr (Smith et al, Mol. Cell Biol. 3.12 (1983): 2156-65; Pennock et al, Mol. Cell Biol. 4.3 (1984): 399-406), and the 3 CD protease of BrCr-TR (Arita et al, J. Gen. Virol. 86.Pt 5 (2005): 1391-401) was under the control of the CMV promoter (Boshart et al, Cell 41.2 (1985): 521-30). Using this strategy, VLPs were generated. Then efforts were directed toward further increasing VLP yield by augmenting the rate of translation from EV71 -specific mRNA transcripts in BV-infected insect cells.
Following a hypothesis that high levels of PI ORF protein would lead to high amounts of VLPs, the enhancer sequence L21 was inserted 5' of the ORF. It was also investigated whether EV71 capsid protein expression could be improved by codon-optimization, which has in other BV-systems led to increased production of the respective heterologous transgene (Angov, Biotechnol. J. 6.6 (2011): 650-59; Zhang et al, Biochem. Biophys. Res. Commun. 227.3 (1996): 707-11). The BV with the highest observed VPO capsid subunit yields in small-scale experiments were used to produce EV71 VLPs.
After co-expression of EV71 recombinant BVs PI and 3 CD, VPO could be detected in protein lysates from infected Sf9 cells implying that the EV71 BrCr prototype 3CD protease recognizes PI from the Chinese isolate as a substrate. That is not insubstantial because although the amino acids at the boundaries between VPO and VP3 at the first cleavage site and VP3 and VP1 at the second cleavage site are both conserved Gln-Gly residues in the Chinese PI protein, the substrate for picorna virus 3 CD protease (Kean et al., J.Gen. Virol. 71 ( Pt 11) (1990): 2553-63), the amino-terminal residue next to the VP0-VP3 Gln-Gly junction is different in the Chinese strain (Thr) compared to BrCr- TR strain (Ala). Also, the third residue next to the VP3-VP1 Gln-Gly junction in the VP3 protein is a Gly in the Chinese PI and an Ala in the BrCr-TR strain. Such substrate changes could effect or even abolish the cleavage of the Chinese PI into VPO, VP3 and VP1 by the prototype BrCr-TR strain 3 CD protease.
Electron microscopic analysis clearly showed the presence of EV71 VLPs of 30 to
40 nm in size and icosahedral shape in EV71 -transgenic BV-infected insect cells. Encouraged by this finding, efforts towards a BV-based EV71 vaccine were directed to optimize EV71 transgene expression by genetic approaches. Constructs were made to express the PI variant from recent EV71 outbreaks in China. In the bicistronic systems both the same gene cassettes were either in a sense configuration with the PI cassette positioned in 5' to the 3CD cassette, or in antisense orientation with adjacent polyadenylation cassettes. Nevertheless, proper proteolytic PI processing was observed with both versions, implying functional expression of PI and 3CD, i.e., the positions and orientations of the transgene cassettes in both constructs allowed BV-mediated transgene production in insect cells. The complex genome organization of BV provides examples of comparable viral gene arrangements (Ayres et al., Virology 202.2 (1994): 586-605; Kool and Vlak, Arch.Virol. 130.1-2 (1993): 1-16). Furthermore, there might be time differences in PHpr and CMV promoter activity when used in the BV context. The PHpr is known to be active at very late stages in BV infection (Hasnain et al., Gene 190.1 (1997): 113-18) whereas the CMV promoter is, at least in mammalian cells, supposed to be active at very early stages of infection. Although the CMV promoter has been used in insect cells, its precise time of activity within the BV system has not yet been determined. The present results support that both transgene cassettes can be arranged in the described configuration suggesting at least a partial non-interfering activity of both promoters. The qualitative superiority in protein expression with the opposite orientations may be attributable to putative local genomic promoter interference, where a greater distance between both promoters allows a more independent expression of both transgene cassettes, although this is offered only by way of possible explanation of an underlying mechanism related to the invention and is not intended as a limitation on the invention.
The picornavirus literature indicates that VPO processing into VP2 and VP4 requires viral R A encapsidation (Palmenberg, Annu. Rev. Microbiol. 44 (1990): 603-23; Krausslich et al., Biochimie 70.1 (1988): 119-30). In addition to the dominant 35 kDa VPO capsid protein subunit, further Mab lOFO-reactive, ca. 28 kDa EV71 -specific capsid proteins were observed in BV-infected cells comparable in size to EV71 VP2. The VP2-like proteins apparently consisting of a mix of two approximately equal-sized molecules were generally detectable in lysates of EV71 transgenic BVs when the levels of EV71 protein expression were high, e.g., at late times after infection (labeled with black arrows in FIG. 3). It is likely that the 28 kDa proteins are amino- or carboxy-terminal cleavage products of VPO. However, other possibilities are that, in contrast to the authentic and completely cytoplasmic EV71 replication cycle, a splicing event leading to the synthesis and translation of an mRNA coding for the 28 kDa proteins may occur in BV-infected insect cells. Alternatively, it is possible that the BrCr-TR 3 CD protease recognizes the Chinese PI VP4-VP2 boundary as a substrate. Such additional EV71 capsid protein subunits accumulated only when EV71 PI and 3 CD were co-expressed in BV-infected cells. However, in a transient 3CD-deficient 293TT expression system such additional lOFO-reactive VP2-specific proteins were detected comparable in size to those observed in the BV-infected insect cells. These additional VP2 capsid proteins do not appear after transient expression of the EV71 BrCr VPO ORF in 293TT cells if the putative VPO cleavage site is mutated. Thus, the picornavirus VPO maturation cleavage into VP2 and VP4 may also occur without encapsidation of viral genomic RNA into a preformed capsid and even if only the VPO subunit itself is present in a cell.
Additional lOFO-reactive proteins were detectable in lysates of BV-infected cells
(FIG. 3, labeled with asterisks). According to their molecular weights these might be either VP0-VP3 (61.8 kDa) or VP2-VP3 (54.4 kDa) molecules which have not been fully processed. Such intermediate products were also detected in fractions of VLP preparations after ultracentrifugation implying that such incompletely processed molecules are part of immature VLPs. Apparently, only one of the bands of the observed triplet in the VLP preparation reacted with Mab 10F0 making it likely that one of the other bands might be unprocessed VP3-VP1. Alternatively, because there are several AUGs in the PI ORF, cryptic translation initiation from within the PI coding sequence in infected insect cells might lead to the synthesis of smaller EV71 capsid proteins. The observed bands are more likely incompletely processed PI products because comparable bands have been observed in poliovirus vaccines derived from inactivated attenuated virus (Bakker et al., Vaccine 29.41 (2011): 7188-96). Interestingly, the aforementioned VP2-sized protein was also detected in EV71 VLP preparations. That makes it likely that the final proteolytic VPO processing step into VP2 and VP4 observed in lysates of infected insect cells and in 3CD-deficient 293TT cells after expression of VPO also leads to mature VLPs containing processed VP2 and VP4 even in the absence of encapsidated viral genomic R A. At least a certain percentage of EV71 VLPs would therefore even more resemble fully processed infectious viral capsids. The shape of a fully matured VLP would more closely resemble an infectious viral particle and could therefore trigger a protective vaccine-based immune response more efficiently and more specifically to viral capsid protein domains suggesting a qualitative difference in protective immunity depending on the amount of fully processed mature EV71 VLPs.
For poliovirus it has been shown that the final maturation VPO cleavage step stabilizes the virion (Hellen and Wimmer, Virology 187.2 (1992): 391-97), implying that mature EV71 VLPs with VPO processed into VP4 and VP4 might lead to more stable molecules when produced as a vaccine. Chung et al, World J. Gastroenterol. 12.6 (2006): 921-927, did not report additional immature VLP-specific bands nor did they detect VP2 in their VLP fabrication when infected Sf9 cells were the basis for their VLP production. However, they used the PI gene derived from the neu strain, and they had additional purification steps for obtaining EV71 VLPs. It is difficult, however, to interpret the quality of their VLP yield and purity because in their analysis the VP1 protein (39 kDa) is bigger than the VPO protein (36 kDa), yet VPO (35.2 kDa) should be bigger than VP1 (32.6 kDa), even in the case of the EV71 neu strain used by these investigators (http://www.ncbi.nlm.nih.gov/nuccore/AFl 19795).
The overall purity observed for the EV71 VLPs seems reasonably high (FIG. 6, left part, lane 3) given the fact that purification included only one ultracentrifugation step followed by dialysis. The additional bands that were observed may disappear when applying further purification steps. However, in light of the presence of additional bands in the poliovirus vaccine (Bakker et al., Vaccine 29.41 (2011): 7188-96), which has been very highly purified, this seems unlikely. The additional EV71 -specific bands were also observed in all fractions containing VPO to VP3 implying that they are co-migrating with VLPs independent from whether sucrose-based or iodixanol-based separation methods were applied. Thus it is very likely that these bands indicate the presence of immature EV71 VLPs.
The EV71 VLPs were harvested from 3xl07 Sf21 cells in 60 ml insect cell medium from plastic dishes as starting material three days post infection. Given the sum of the band intensities of VPO, VP1, VP2 and VP3 equals 10 μg of BSA (FIG. 6) and the relative amount of VLPs that were analyzed by SDS-PAGE, approximately 100 μg of VLPs were obtained which would be comparable to the yield of 10 mg per 109 Sf9 cells (Chung et al, World J. Gastroenterol. 12.6 (2006): 921-27). EV71 VLP production process evaluation done by this group involved the construction of P1/3CD double-transgenic BVs yet with different orientations and submodules compared to the constructs of the present invention plus the stirrer-based large-scale production including several biochemical optimization details like the concentration of dissolved oxygen (Chung et al, Vaccine 28.43 (2010): 6951-57). Interestingly, when adjusting their VLP production process they used the supernatant of infected cells as a starting material altogether leading to very high VLP yields.
Different codon usage has been described in the case of the BV polyhedrin gene which is expressed very late during the infection cycle from PHpr and to very high amounts. Ranjan and Hasnain, Indian J. Biochem. Biophys. 32.6 (1995): 424-28. That implies a different quality of translational metabolism at late infection stages in baculovirus-infected insect cells. As PHpr was used in the present invention to control EV71 PI capsid polyprotein expression, a codon-optimized PI ORF was synthesized and analysed whether usage of this PI ORF would lead to higher amounts of VLP production. However, the results indicated that at least for EV71 PI, codon-optimization does not lead to an increased transgene expression. In contrast, however, a very small insertion of 20 additional nucleotides coding for the L21 translation enhancing sequence into 5' of the PI ORF led to a much higher amount of processed PI subunits, indicating that this element would facilitate exploitation of EV71 VLP production on an industrial scale. Sf21 cells turned out to be superior to Sf9 cells for future large-scale EV71 VLP production because of a faster transgene processing. EV71 VLP production in High Five insect cells was not examined because of the latent insect alphanodavirus infection in these cells leading to particles comparable in size and shape to the EV71 VLPs (Li et al., J. Virol. 81.20 (2007): 10890-96). Additionally, BV infection increases nodavirus production in High Five cells. In this light it is difficult to interpret the electron microscopic EV71 VLP data with this cell line (Chung et al., Vaccine 28.43 (2010): 6951-57) and other attempts to use High Five as producer cell line for VLPs (Krammer et al, Mol. Biotechnol. 45.3 (2010): 226-34).
BV-Mock-infected Sf21 cells were tested for comparable issues putatively affecting VLP production or at least the electron microscopic demonstration of EV71 VLP formation and no evidence was found for any contaminating virus in the cell culture system. Thus, the biochemical optimization of VLP production will lead to production of a safe and efficient vaccine against the recent EV71 outbreaks.
Sequences of the synthetic PI genes:
1. Natural PI ORF of EV71 VLP PI JED AG
[SEQ ID NO:9]
5 ' -
ATGGGTTCGCAAGTGTCTACACAGCGCTCCGGTTCTCACGAAAACTCAAACTCAGCCACT GAGGGTTCTACCATAAACTACACCACCATTAATTACTACAAAGACTCCTATGCTGCCACA GCAGGCAAACAGAGTCTCAAGCAGGATCCAGACAAGTTTGCAAATCCTGTTAAAGACATC TTCACTGAAATGGCAGCGCCACTGAAGTCCCCATCCGCTGAGGCATGTGGATACAGTGAT CGAGTGGCGCAATTAACTATTGGCAACTCCACCATCACCACGCAAGAAGCGGCTAATATC ATAGTCGGTTATGGTGAGTGGCCTTCCTACTGCTCAGATTCTGACGCTACAGCAGTGGAT AAACCAACGCGCCCGGATGTTTCAGTGAACAGGTTTTACACATTGGACACTAAATTGTGG GAGAAATCGTCCAAGGGATGGTACTGGAAGTTCCCGGATGTGTTAACTGAAACTGGGGTT TTTGGGCAAAATGCACAATTCCACTACCTCTACCGATCAGGGTTCTGCATCCACGTGCAG TGCAATGCCAGTAAATTCCACCAAGGAGCACTCCTAGTCGCTGTCCTACCAGAGTATGTC ATTGGGACAGTGGCAGGCGGTACAGGGACGGAAGATACCCACCCCCCTTACAAGCAGACT CAACCCGGCGCCGATGGCTTCGAGTTGCAACACCCGTACGTGCTTGATGCTGGCATCCCA ATATCACAGTTAACAGTGTGCCCACACCAGTGGATTAATTTGAGGACCAACAACTGTGCT ACAATAATAGTGCCATACATTAACGCACTGCCTTTTGATTCTGCCTTGAACCATTGCAAC TTTGGCCTGTTGGTTGTGCCTATTAGCCCACTAGACTACGACCAAGGAGCGACGCCAGTA ATCCCTATAACTATCACATTGGCCCCAATGTGTTCTGAATTCGCAGGTCTTAGGCAGGCA GTCACGCAAGGGTTCCCCACCGAGCTAAAACCTGGCACAAATCAATTTTTAACCACCGAT GATGGCGTTTCAGCACCTATTCTACCGAACTTCCACCCCACCCCGTGTATCCACATACCT GGTGAAGTTAGGAACTTGCTAGAGTTATGCCAGGTGGAGACCATTCTGGAGGTTAACAAT GTGCCCACGAATGCCACTAGCTTAATGGAGAGACTGCGCTTCCCGGTCTCAGCACAAGCA GGGAAAGGTGAGCTGTGTGCGGTGTTTAGAGCCGATCCTGGGCGAAATGGACCATGGCAA TCCACCTTACTGGGTCAGTTGTGCGGGTACTACACCCAATGGTCAGGATCATTGGAAGTC ACCTTCATGTTTACTGGATCCTTCATGGCTACCGGCAAGATGCTCATAGCCTATACACCG CCAGGAGGTCCTCTGCCCAAGGACCGGGCGACCGCCATGTTGGGCACGCACGTCATCTGG GATTTTGGGCTGCAATCGTCTGTTACCCTTGTAATACCATGGATCAGCAACACTCATTAT AGAGCACATGCCCGAGATGGAGTGTTTGACTACTACACCACAGGGTTAGTCAGTATATGG TATCAGACAAATTACGTGGTTCCAATCGGTGCGCCCAACACAGCCTATATAATAGCACTA GCGGCAGCCCAAAAGAACTTCACTATGAAATTGTGCAAGGATGCTAGTGATATCCTGCAG ACGGGCACCATCCAGGGAGATAGGGTGGCAGATGTAATTGAAAGTTCCATAGGAGATAGC GTGAGCAGAGCCCTCACTCACGCTCTACCAGCACCCACAGGCCAGAACACACAGGTGAGC AGTCATCGACTGGATACAGGCAAGGTTCCAGCACTCCAAGCTGCTGAAATTGGAGCATCA TCAAATGCTAGTGACGAGAGCATGATTGAGACACGCTGTGTTCTTAACTCGCACAGTACA GCTGAGACCACTCTTGATAGTTTCTTCAGCAGGGCGGGATTAGTTGGAGAGATAGATCTC CCTCTTAAGGGCACAACTAACCCAAATGGTTATGCCAACTGGGACATAGACATAACAGGT TACGCGCAAATGCGTAGAAAGGTAGAGCTATTCACCTACATGCGCTTTGATGCAGAGTTC ACTTTTGTTGCGTGCACACCCACCGGGGAAGTTGTCCCACAATTGCTCCAATATATGTTT GTGCCACCTGGAGCCCCTAAGCCAGATTCTAGGGAATCCCTTGCATGGCAAACCGCCACT AACCCCTCAGTTTTTGTCAAGCTGTCAGACCCTCCAGCGCAGGTTTCAGTGCCATTCATG TCACCTGCGAGTGCTTATCAATGGTTTTATGACGGATATCCCACATTCGGAGAACACAAA CAGGAGAAAGATCTTGAATACGGGGCATGTCCTAATAACATGATGGGCACGTTCTCAGTG CGGACTGTGGGGACCTCCAAGTCTAAGTACCCTTTAGTGGTTAGGATTTACATGAGGATG AAGCACGTCAGGGCGTGGATACCTCGCCCGATGCGTAACCAGAACTACCTATTCAAAGCC AACCCAAATTATGCTGGCAACTCCATTAAGCCAACTGGTGCCAGTCGCACAGCGATCACC ACTCTTTAG-3 ' coding for the following amino acid sequence:
[SEQ ID NO: 10]
NH2-
MGSQVSTQRSGSHENSNSATEGSTINYTTINYYKDSYAATAGKQSLKQDPDKFANPVKDI FTEMAAPLKSPSAEACGYSDRVAQLTIGNSTITTQEAANI IVGYGEWPSYCSDSDATAVD
KPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQ CNASKFHQGALLVAVLPEYVIGTVAGGTGTEDTHPPYKQTQPGADGFELQHPYVLDAGIP ISQLTVCPHQWI LRTNNCATI IVPYINALPFDSALNHCNFGLLWPI SPLDYDQGATPV IPITITLAPMCSEFAGLRQAVTQGFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIP GEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQ STLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIW DFGLQSSVTLVI PWISNTHYRAHARDGVFDYYTTGLVS IWYQTNYVVPIGAPNTAYI IAL AAAQKNFTMKLCKDASDILQTGTIQGDRVADVIESS IGDSVSRALTHALPAPTGQNTQVS SHRLDTGKVPALQAAEIGASSNASDESMIETRCVLNSHSTAETTLDSFFSRAGLVGEIDL PLKGTTNPNGYANWDI DITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEWPQLLQYMF
VPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHK QEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLWRIYMRMKHVRAWIPRPMRNQNYLFKA NPNYAGNS IKPTGASRTAITTL-COOH
2. Codon-optimized for insect Sf9 cells and BV expression
[SEQ ID NO: 1 1]
5 ' - ATGGGATCCCAGGTGAGTACACAGCGCTCCGGATCCCACGAAAATAGCAACTCCGCAACA GAGGGATCTACTATAAACTATACGACCATCAACTACTATAAGGACTCATACGCCGCAACA GCAGGTAAACAATCCTTGAAGCAGGATCCTGACAAGTTCGCGAATCCTGTTAAGGATATA TTCACCGAAATGGCGGCTCCGCTGAAGTCGCCCTCCGCTGAAGCTTGCGGTTATAGTGAT CGTGTAGCGCAATTGACCATTGGCAACTCTACCATCACAACACAGGAAGCCGCAAACATC ATCGTGGGATACGGAGAGTGGCCCTCGTATTGCTCTGACTCTGACGCTACTGCGGTTGAC AAGCCAACTCGTCCAGACGTTTCGGTGAACAGGTTCTACACCTTGGATACCAAGCTCTGG GAGAAGAGCAGCAAAGGTTGGTACTGGAAGTTTCCTGATGTCCTGACAGAAACTGGTGTT TTCGGACAGAACGCCCAGTTTCACTACCTGTATCGTTCCGGCTTTTGTATCCATGTGCAG TGCAACGCATCAAAGTTCCACCAGGGAGCTCTTTTGGTGGCCGTATTGCCCGAGTACGTG ATCGGTACCGTTGCAGGCGGTACAGGAACCGAGGACACGCACCCGCCCTACAAACAAACG CAACCAGGAGCGGACGGTTTCGAACTTCAACACCCCTACGTTCTCGATGCTGGCATTCCT ATCTCACAGCTGACCGTTTGCCCACACCAATGGATCAACCTCCGCACTAACAACTGCGCT ACTATTATTGTCCCTTACATTAACGCACTCCCTTTTGACAGTGCCCTCAACCACTGTAAC TTCGGATTGCTTGTGGTCCCTATATCCCCCCTGGACTACGACCAGGGTGCAACTCCAGTG ATCCCTATTACGATCACCCTCGCCCCGATGTGTTCTGAGTTTGCAGGCCTTCGCCAGGCG GTGACGCAGGGCTTCCCTACGGAGTTGAAGCCCGGCACCAACCAGTTCCTTACGACGGAC GACGGTGTTTCTGCACCCATTCTTCCAAACTTTCATCCCACTCCATGCATCCATATACCT GGAGAAGTTCGTAACTTGCTGGAGCTGTGCCAGGTTGAAACGATCCTCGAGGTCAATAAC GTCCCAACTAACGCCACCAGCTTGATGGAAAGACTCAGATTCCCAGTGAGCGCCCAGGCG GGAAAGGGAGAGCTGTGCGCTGTGTTTCGCGCTGACCCTGGACGCAACGGTCCATGGCAA AGCACGCTCTTGGGTCAGTTGTGCGGTTACTATACTCAATGGTCAGGATCTCTGGAAGTC ACTTTCATGTTCACTGGCAGTTTCATGGCAACTGGTAAAATGCTGATTGCTTACACACCC CCAGGCGGACCTCTGCCAAAGGACCGTGCTACGGCCATGCTGGGCACTCACGTGATTTGG GATTTCGGTCTCCAATCATCTGTTACGTTGGTGATTCCTTGGATCTCCAACACGCACTAT CGCGCCCATGCACGCGACGGTGTGTTTGATTATTATACGACCGGCCTGGTTTCAATCTGG TACCAGACCAACTATGTTGTTCCGATAGGCGCCCCAAATACGGCGTATATCATTGCCCTG GCCGCTGCTCAAAAGAATTTCACCATGAAGCTGTGCAAGGATGCGAGCGACATCCTGCAG ACCGGTACTATCCAGGGAGACAGGGTGGCTGACGTAATCGAGAGTTCTATAGGTGACTCA GTTTCACGCGCTCTCACGCACGCGCTTCCTGCTCCTACCGGCCAAAACACACAAGTGAGC TCTCATAGGCTGGACACCGGCAAGGTCCCCGCTCTGCAGGCTGCAGAGATCGGCGCCTCT TCGAACGCATCGGATGAATCTATGATCGAAACACGTTGCGTGCTTAACTCGCACTCAACA GCAGAGACTACGCTCGACTCCTTCTTCTCGAGGGCGGGTTTGGTTGGAGAGATTGACCTC CCATTGAAGGGTACGACAAACCCCAACGGCTACGCGAACTGGGATATTGACATAACCGGT TACGCCCAAATGAGAAGGAAAGTCGAGTTGTTCACATACATGAGGTTTGATGCTGAGTTT ACTTTCGTGGCTTGCACGCCCACCGGTGAAGTCGTGCCACAGCTCCTCCAATATATGTTT GTCCCGCCCGGTGCCCCGAAGCCCGATTCCCGCGAATCCCTGGCTTGGCAAACCGCTACG AACCCCTCGGTCTTTGTGAAACTCTCCGACCCTCCTGCGCAAGTGTCAGTGCCTTTTATG AGTCCTGCCAGTGCTTATCAGTGGTTCTACGATGGTTACCCGACTTTCGGCGAGCACAAG CAAGAGAAAGATCTCGAATACGGAGCTTGTCCAAACAACATGATGGGTACATTCTCCGTA AGGACCGTGGGAACGTCGAAGTCGAAGTATCCTCTTGTCGTCCGCATCTATATGAGAATG AAACACGTTCGCGCTTGGATTCCGCGTCCCATGCGTAATCAAAATTACCTGTTCAAAGCC AACCCCAACTACGCTGGTAACTCAATAAAGCCCACAGGTGCAAGTCGCACCGCAATTACT ACCTTGTAG-3 '
While illustrative embodiments have been illustrated and described, it will be appreciated that various changes can be made therein without departing from the spirit and scope of the invention.

Claims

CLAIMS The embodiments of the invention in which an exclusive property or privilege is claimed are defined as follows:
1. A vaccine for the prevention of human EV71 disease or infection, which vaccine comprises VLPs of EV71 strain EU703812.
2. The vaccine according to Claim 1, wherein the EV71 strain EU703812 VLPs comprise capsid proteins VPO, VP4, VP2, VP3 and VP1.
3. The vaccine according to Claim 2, wherein the vaccine is free of infectious genomic EV71 RNA.
4. The vaccine according to Claim 3, wherein the vaccine is substantially free of any RNA.
5. The vaccine according to Claim 1, in a concentration of 20 to 100 μg per human dose, together with an adjuvant.
6. The vaccine according to Claim 1, wherein the adjuvant comprises an aluminum salt.
7. A method for preventing human EV71 related disease or infection, the method comprising administering to an individual a vaccine according to Claim 1.
8. A method for preventing human EV71 related disease or infection, the method comprising administering to an individual at least two consecutive doses of a vaccine according to Claim 1.
9. A vessel containing a 500 μΐ to 1.0ml human vaccine dose of the vaccine according to Claim 1.
10. A method for producing a vaccine against EV71 infection or disease, the method comprising:
infecting Spodoptera frugiperda (Sf) cells with a recombinant baculovirus comprising a PI gene of EV71 strain EU703812 and a 3 CD protease gene of prototype EV71 strain BrCr-Tr under control of a CMV promoter in a bicistronic configuration, culturing said infected Sf cells under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs,
harvesting the EV71 VLPs from the culture, and
combining the EV71 VLPs with an adjuvant to produce said vaccine.
11. The method for producing a vaccine according to Claim 10, wherein the PI gene is under control of a polyhedrin promoter.
12. The method for producing a vaccine according to Claim 10, wherein the 3 CD protease gene is under control of a CMV promoter.
13. The method for producing a vaccine according to Claim 10, wherein the PI gene is under control of a polyhedrin promoter and the 3 CD protease gene is under control of a CMV promoter.
14. The method for producing a vaccine according to Claim 10, wherein the Sf cells are Sf21.
15. The method for producing a vaccine according to Claim 10, wherein the vaccine is free of infectious genomic EV71 R A.
16. A method for producing a vaccine against EV71, the method comprising: obtaining EV71 VLPs from a culture of Sf cells infected with a recombinant baculo virus comprising a PI gene of EV71 strain EU703812 and a 3 CD protease gene of prototype EV71 strain BrCr-Tr under control of a CMV promoter in a bicistronic configuration, said infected Sf cells having been cultured under conditions which permitted expression of the EV71 genes and assembly of EV71 VLPs, and
combining the EV71 VLPs with an adjuvant to produce said vaccine against
EV71.
17. A method for producing EV71 VLPs, the method comprising:
infecting a Spodoptera frugiperda (Sf) cell with a recombinant baculovirus which comprises a PI gene of EV71 and a 3CD protease gene of EV71 under control of a CMV promoter in a bicistronic configuration, and
culturing said infected Sf cells under conditions which permit expression of the EV71 genes and assembly of EV71 VLPs.
18. The method according to Claim 17, wherein the PI gene is from EV71 strain EU703812.
19. The method according to Claim 17, wherein the 3CD protease gene is from EV71 strain BrCr.
20. The method according to Claim 17, wherein translational enhancer L21 is inserted 5 ' of the PI gene.
21. The method according to Claim 17, wherein the Sf strain is Sf21.
22. A method for preventing human enterovirus 71 (EV71) related disease or infection, the method comprising administering to an individual an effective amount of a EV71 vaccine comprising EV71 virus-like particles (VLPs) of strain EU703812 together with a pharmaceutically acceptable excipient in an amount sufficient to generate an immune response in the individual that prevents EV71 infection or disease.
23. The method of Claim 22, wherein the EV71 vaccine is administered in two consecutive doses consisting of a first dose and a second dose.
24. The method according to Claim 23, wherein the second dose is administered at least two months after the first dose.
25. The method according to Claim 24, wherein the second dose is administered approximately six months after the first dose.
26. The method according to Claim 22, wherein the EV71 vaccine further comprises an adjuvant.
27. The method according to Claim 26, wherein the adjuvant comprises an aluminum salt.
28. The method according to Claim 27, wherein the aluminum salt is aluminum hydroxide.
28. The method according to Claim 22, wherein the EV71 VLPs comprise capsid proteins VPO, VP3 and VPl or VP4, VP2, VP3 and VPl and are free of genomic EV71 RNA.
29. The method according to Claim 22, wherein only EV71 strain EU703812 is present in the vaccine.
30. The method according to Claim 22, wherein the vaccine is for the prevention of human EV71 disease in a child age twelve or younger.
PCT/US2013/033543 2012-03-23 2013-03-22 Baculovirus-based enterovirus 71 vlp as a vaccine Ceased WO2013142809A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/387,159 US20150044257A1 (en) 2012-03-23 2013-03-22 Baculovirus-based enterovirus 71 vlp as a vaccine

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261615175P 2012-03-23 2012-03-23
US61/615,175 2012-03-23

Publications (1)

Publication Number Publication Date
WO2013142809A1 true WO2013142809A1 (en) 2013-09-26

Family

ID=49223374

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/033543 Ceased WO2013142809A1 (en) 2012-03-23 2013-03-22 Baculovirus-based enterovirus 71 vlp as a vaccine

Country Status (2)

Country Link
US (1) US20150044257A1 (en)
WO (1) WO2013142809A1 (en)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015167710A1 (en) * 2014-04-29 2015-11-05 National Health Research Institutes Adenoviral vector-based vaccine against enterovirus infection
CN105259347A (en) * 2015-08-13 2016-01-20 杭州雅盛生物科技有限公司 Enterovirus 71 detection method and detection kit
WO2016073929A1 (en) * 2014-11-07 2016-05-12 Takeda Vaccines, Inc. Hand, foot, and mouth vaccines and methods of manufacture and use thereof
CN105675878A (en) * 2014-12-08 2016-06-15 苏州偲聚生物材料有限公司 Kit and diagnosis method being capable of diagnosing human enterovirus 71 type infection
CN105802923A (en) * 2016-04-14 2016-07-27 中国科学院生物物理研究所 Recombinant poliomyelitis virus-like particles and preparation method and application thereof
CN108169484A (en) * 2017-12-20 2018-06-15 广州瑞辉生物科技股份有限公司 EV71 virus antigen polypeptides and its IgM antibody detection kit
US10233429B2 (en) 2014-11-07 2019-03-19 Takeda Vaccines, Inc. Hand, foot, and mouth vaccines and methods of manufacture and use thereof
CN109666691A (en) * 2018-12-05 2019-04-23 上海泽润生物科技有限公司 EV71 vaccine preparation method and the vaccine prepared by this method
WO2022187698A1 (en) * 2021-03-05 2022-09-09 Modernatx, Inc. Vlp enteroviral vaccines

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2018517405A (en) * 2015-05-04 2018-07-05 エピバックス インコーポレーテッド Influenza A / Shanghai / 2/2013 modified H7 hemagglutinin glycoprotein of H7 sequence
CA3001725C (en) 2015-05-04 2021-06-15 Epivax, Inc. Modified h7 hemaglutinin glycoprotein of the influenza a/shanghai/2/2013 h7 sequence
CN107400662B (en) * 2016-05-20 2022-01-28 中国科学院上海巴斯德研究所 Novel virus-like particle derived from enterovirus 71 and application thereof
WO2019163781A1 (en) * 2018-02-20 2019-08-29 一般財団法人阪大微生物病研究会 Enterovirus vaccine
WO2020067027A1 (en) * 2018-09-28 2020-04-02 一般財団法人阪大微生物病研究会 Construction of cho cell line expressing vlp
CN115010813B (en) * 2022-05-19 2024-04-05 桂林医学院 Enterovirus 71 virus-like particle, and preparation method and application thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060257859A1 (en) * 2005-05-11 2006-11-16 Tse-Wen Chang Recombinant enterovirus 71 neutralizing antibodies and applications thereof
US20110179508A1 (en) * 2008-11-19 2011-07-21 National Chung Hsing University Enterovirus type 71 protein and method for production

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060257859A1 (en) * 2005-05-11 2006-11-16 Tse-Wen Chang Recombinant enterovirus 71 neutralizing antibodies and applications thereof
US20110179508A1 (en) * 2008-11-19 2011-07-21 National Chung Hsing University Enterovirus type 71 protein and method for production

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CHUNG, C.-Y. ET AL.: "Enterovirus 71 virus-like particle vaccine: Improved production conditions for enhanced yield", VACCINE, vol. 28, 2010, pages 6951 - 6957, XP027392042 *
CHUNG, Y.-C. ET AL.: "Expression, purification and characterization of enterovirus-71 virus-like particles", WORLD JOURNAL OF GASTROENTEROLOGY, vol. 12, no. 6, 2006, pages 921 - 927 *
HU, Y.-C. ET AL.: "Formation of enterovirus-like particle aggregates by recombinant baculoviruses co-expressing Pl and 3CD in insect cells", BIOTECHNOLOGY LETTERS, vol. 25, 2003, pages 919 - 925, XP008119794, DOI: doi:10.1023/A:1024071514438 *
ZHANG, Y. ET AL.: "An emerging recombinant human enterovirus 71 responsible for the 2008 outbreak of hand foot and mouth disease in Fuyang city of China", VIROLOGY JOURNAL, vol. 7, no. 94, 2010 *

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170056491A1 (en) * 2014-04-29 2017-03-02 National Health Research Institutes Adenoviral vector-based vaccine against enterovirus infection
TWI686475B (en) * 2014-04-29 2020-03-01 財團法人國家衛生研究院 Adenoviral vector-based vaccine against enterovirus infection
WO2015167710A1 (en) * 2014-04-29 2015-11-05 National Health Research Institutes Adenoviral vector-based vaccine against enterovirus infection
US10004796B2 (en) * 2014-04-29 2018-06-26 National Health Research Institutes Adenoviral vector-based vaccine against enterovirus infection
CN106794239A (en) * 2014-04-29 2017-05-31 财团法人卫生研究院 Adenovirus vector-based vaccines against enterovirus infection
US10233429B2 (en) 2014-11-07 2019-03-19 Takeda Vaccines, Inc. Hand, foot, and mouth vaccines and methods of manufacture and use thereof
WO2016073929A1 (en) * 2014-11-07 2016-05-12 Takeda Vaccines, Inc. Hand, foot, and mouth vaccines and methods of manufacture and use thereof
US10806782B2 (en) 2014-11-07 2020-10-20 Takeda Vaccines, Inc. Hand, foot, and mouth vaccines and methods of manufacture and use thereof
CN105675878A (en) * 2014-12-08 2016-06-15 苏州偲聚生物材料有限公司 Kit and diagnosis method being capable of diagnosing human enterovirus 71 type infection
CN105259347A (en) * 2015-08-13 2016-01-20 杭州雅盛生物科技有限公司 Enterovirus 71 detection method and detection kit
CN105802923A (en) * 2016-04-14 2016-07-27 中国科学院生物物理研究所 Recombinant poliomyelitis virus-like particles and preparation method and application thereof
CN108169484A (en) * 2017-12-20 2018-06-15 广州瑞辉生物科技股份有限公司 EV71 virus antigen polypeptides and its IgM antibody detection kit
CN109666691A (en) * 2018-12-05 2019-04-23 上海泽润生物科技有限公司 EV71 vaccine preparation method and the vaccine prepared by this method
WO2022187698A1 (en) * 2021-03-05 2022-09-09 Modernatx, Inc. Vlp enteroviral vaccines

Also Published As

Publication number Publication date
US20150044257A1 (en) 2015-02-12

Similar Documents

Publication Publication Date Title
US20150044257A1 (en) Baculovirus-based enterovirus 71 vlp as a vaccine
Porta et al. Efficient production of foot-and-mouth disease virus empty capsids in insect cells following down regulation of 3C protease activity
Guo et al. Foot-and-mouth disease virus-like particles produced by a SUMO fusion protein system in Escherichia coli induce potent protective immune responses in guinea pigs, swine and cattle
EP3290050B1 (en) Vaccines directed against human enteroviruses
CN111263642B (en) Preparation method of a pharmaceutical composition containing immunogenic CHIKV-DELTA5NSP3
JP7412002B2 (en) alphavirus replicon particle
CN104480143A (en) Vector for expressing protein of poliovirus sample particles and method for preparing poliovirus sample particles
CN109182380B (en) Preparation method and application of baculovirus-expressed classical swine fever E2 subunit vaccine
JP2025521082A (en) Stable prefusion HMPV fusion proteins
KR20230008707A (en) Vaccine composition for treatment of coronavirus
CN113896773B (en) Recombinant FCV antigen and feline calicivirus genetic engineering subunit vaccine
US20190224304A1 (en) Chimeric enterovirus virus-like particles
Luo et al. Chimeric enterovirus 71 virus-like particle displaying conserved coxsackievirus A16 epitopes elicits potent immune responses and protects mice against lethal EV71 and CA16 infection
US20190247488A1 (en) Expression cassettes and methods for obtaining enterovirus virus-like particles
Liu et al. An enterovirus A71 virus-like particle with replaced loops confers partial cross-protection in mice
US20240358816A1 (en) Fmdv virus-like particle with stabilizing mutation
EP4232082A1 (en) Baculovirus expression vector
WO2022084426A1 (en) Baculovirus expression vector
JP2023511823A (en) Method for producing hepatitis A virus and hepatitis A virus produced by said method
US20240374706A1 (en) Fmdv virus-like particle with double stabilizing mutation
Zhao Research and Development of HFMD Vaccines
CN120329394A (en) Virus-like particles of poliovirus type 2 and uses thereof
CN120271718A (en) Recombinant antigen for Zika/dengue virus, vaccine composition and application thereof
EP4702152A1 (en) Temperature-sensitive baculovirus expression vector system for the production of baculovirus virion-free biopharmaceuticals
CN120383661A (en) Preparation of poliovirus type 1 heat-stable virus-like particles and study of their immunogenicity

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13764603

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 13764603

Country of ref document: EP

Kind code of ref document: A1