WO2013083799A1 - Mutated lentiviral env proteins and their use as drugs - Google Patents
Mutated lentiviral env proteins and their use as drugs Download PDFInfo
- Publication number
- WO2013083799A1 WO2013083799A1 PCT/EP2012/074835 EP2012074835W WO2013083799A1 WO 2013083799 A1 WO2013083799 A1 WO 2013083799A1 EP 2012074835 W EP2012074835 W EP 2012074835W WO 2013083799 A1 WO2013083799 A1 WO 2013083799A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- mutated
- env protein
- protein
- fragment
- Prior art date
Links
- 102100034353 Integrase Human genes 0.000 title claims abstract description 376
- 108010078428 env Gene Products Proteins 0.000 title claims abstract description 376
- 229940079593 drug Drugs 0.000 title description 3
- 239000003814 drug Substances 0.000 title description 3
- 230000001506 immunosuppresive effect Effects 0.000 claims abstract description 267
- 239000012634 fragment Substances 0.000 claims abstract description 197
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 127
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 54
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 53
- 239000013543 active substance Substances 0.000 claims abstract description 41
- 239000003937 drug carrier Substances 0.000 claims abstract description 17
- 241000282414 Homo sapiens Species 0.000 claims description 215
- 150000001413 amino acids Chemical class 0.000 claims description 158
- 229910052720 vanadium Inorganic materials 0.000 claims description 153
- 229910052740 iodine Inorganic materials 0.000 claims description 147
- 229910052727 yttrium Inorganic materials 0.000 claims description 142
- 229910052698 phosphorus Inorganic materials 0.000 claims description 126
- 229910052757 nitrogen Inorganic materials 0.000 claims description 118
- 230000035772 mutation Effects 0.000 claims description 109
- 229910052700 potassium Inorganic materials 0.000 claims description 109
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 89
- 239000013598 vector Substances 0.000 claims description 65
- 108020004707 nucleic acids Proteins 0.000 claims description 61
- 102000039446 nucleic acids Human genes 0.000 claims description 61
- 150000007523 nucleic acids Chemical class 0.000 claims description 61
- 210000004881 tumor cell Anatomy 0.000 claims description 59
- 101710192141 Protein Nef Proteins 0.000 claims description 47
- 229910052739 hydrogen Inorganic materials 0.000 claims description 42
- 238000000034 method Methods 0.000 claims description 35
- 241000700605 Viruses Species 0.000 claims description 32
- 241000713666 Lentivirus Species 0.000 claims description 28
- 229910052799 carbon Inorganic materials 0.000 claims description 27
- 101710177291 Gag polyprotein Proteins 0.000 claims description 25
- 101710125418 Major capsid protein Proteins 0.000 claims description 25
- 229910052717 sulfur Inorganic materials 0.000 claims description 25
- 229960005486 vaccine Drugs 0.000 claims description 25
- 208000031886 HIV Infections Diseases 0.000 claims description 22
- 230000014509 gene expression Effects 0.000 claims description 19
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 19
- 206010062016 Immunosuppression Diseases 0.000 claims description 17
- 208000015181 infectious disease Diseases 0.000 claims description 16
- 230000028993 immune response Effects 0.000 claims description 13
- 238000011282 treatment Methods 0.000 claims description 11
- 108010089520 pol Gene Products Proteins 0.000 claims description 10
- 201000005505 Measles Diseases 0.000 claims description 6
- 238000005462 in vivo assay Methods 0.000 claims description 6
- 230000002265 prevention Effects 0.000 claims description 5
- 150000001875 compounds Chemical class 0.000 claims description 4
- 241000701022 Cytomegalovirus Species 0.000 claims description 3
- 241000287219 Serinus canaria Species 0.000 claims description 3
- 208000000666 Fowlpox Diseases 0.000 claims description 2
- 230000000840 anti-viral effect Effects 0.000 claims description 2
- 230000004936 stimulating effect Effects 0.000 claims description 2
- 206010046865 Vaccinia virus infection Diseases 0.000 claims 1
- 208000007089 vaccinia Diseases 0.000 claims 1
- 235000001014 amino acid Nutrition 0.000 description 121
- 241000725303 Human immunodeficiency virus Species 0.000 description 61
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 45
- 235000018102 proteins Nutrition 0.000 description 45
- 125000000539 amino acid group Chemical group 0.000 description 42
- 210000004027 cell Anatomy 0.000 description 36
- 102220613805 Angiotensin-converting enzyme 2_Y41R_mutation Human genes 0.000 description 29
- 241000713311 Simian immunodeficiency virus Species 0.000 description 27
- 239000000203 mixture Substances 0.000 description 24
- 238000006467 substitution reaction Methods 0.000 description 23
- 206010028980 Neoplasm Diseases 0.000 description 20
- 238000001727 in vivo Methods 0.000 description 20
- 230000000694 effects Effects 0.000 description 18
- 241001430294 unidentified retrovirus Species 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 17
- 229910052731 fluorine Inorganic materials 0.000 description 15
- 230000003612 virological effect Effects 0.000 description 15
- 101710091045 Envelope protein Proteins 0.000 description 14
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 14
- 102100034349 Integrase Human genes 0.000 description 14
- 101710188315 Protein X Proteins 0.000 description 14
- 210000000170 cell membrane Anatomy 0.000 description 13
- 230000002163 immunogen Effects 0.000 description 13
- 229940122313 Nucleoside reverse transcriptase inhibitor Drugs 0.000 description 12
- 239000013612 plasmid Substances 0.000 description 12
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 12
- 210000000987 immune system Anatomy 0.000 description 11
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 10
- 239000000427 antigen Substances 0.000 description 10
- 108091007433 antigens Proteins 0.000 description 10
- 102000036639 antigens Human genes 0.000 description 10
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 208000030507 AIDS Diseases 0.000 description 9
- 102220606921 Vesicle-fusing ATPase_G49R_mutation Human genes 0.000 description 9
- 102000004190 Enzymes Human genes 0.000 description 8
- 108090000790 Enzymes Proteins 0.000 description 8
- 102220469888 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN_L42R_mutation Human genes 0.000 description 8
- 102220606692 Vesicle-fusing ATPase_K72A_mutation Human genes 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 238000010276 construction Methods 0.000 description 8
- 102220613797 Angiotensin-converting enzyme 2_Y41A_mutation Human genes 0.000 description 7
- 108091035707 Consensus sequence Proteins 0.000 description 7
- 108020004437 Endogenous Retroviruses Proteins 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 229910052796 boron Inorganic materials 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 5
- XQSPYNMVSIKCOC-NTSWFWBYSA-N Emtricitabine Chemical compound C1=C(F)C(N)=NC(=O)N1[C@H]1O[C@@H](CO)SC1 XQSPYNMVSIKCOC-NTSWFWBYSA-N 0.000 description 5
- 102220541643 HLA class II histocompatibility antigen, DQ beta 1 chain_Y41F_mutation Human genes 0.000 description 5
- 102220541624 HLA class II histocompatibility antigen, DQ beta 1 chain_Y41L_mutation Human genes 0.000 description 5
- 241000714177 Murine leukemia virus Species 0.000 description 5
- 230000000890 antigenic effect Effects 0.000 description 5
- JTEGQNOMFQHVDC-NKWVEPMBSA-N lamivudine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 5
- 229940042402 non-nucleoside reverse transcriptase inhibitor Drugs 0.000 description 5
- 239000002726 nonnucleoside reverse transcriptase inhibitor Substances 0.000 description 5
- 230000001177 retroviral effect Effects 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- VCMJCVGFSROFHV-WZGZYPNHSA-N tenofovir disoproxil fumarate Chemical compound OC(=O)\C=C\C(O)=O.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VCMJCVGFSROFHV-WZGZYPNHSA-N 0.000 description 5
- 102220615425 40S ribosomal protein S13_K43R_mutation Human genes 0.000 description 4
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 102220510010 FAS-associated death domain protein_D44R_mutation Human genes 0.000 description 4
- 229940126656 GS-4224 Drugs 0.000 description 4
- 208000037357 HIV infectious disease Diseases 0.000 description 4
- 101000823051 Homo sapiens Amyloid-beta precursor protein Proteins 0.000 description 4
- 102220487760 Isoaspartyl peptidase/L-asparaginase_E39R_mutation Human genes 0.000 description 4
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 4
- 239000003443 antiviral agent Substances 0.000 description 4
- JHIVVAPYMSGYDF-UHFFFAOYSA-N cyclohexanone Chemical compound O=C1CCCCC1 JHIVVAPYMSGYDF-UHFFFAOYSA-N 0.000 description 4
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 4
- 229940072253 epivir Drugs 0.000 description 4
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 230000017105 transposition Effects 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 3
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 102220541925 Neutrophil elastase_L47R_mutation Human genes 0.000 description 3
- 102220495689 Putative uncharacterized protein FLJ43944_R40A_mutation Human genes 0.000 description 3
- 101100366397 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) SPE3 gene Proteins 0.000 description 3
- 102220631849 Stathmin-3_S73A_mutation Human genes 0.000 description 3
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 108010067390 Viral Proteins Proteins 0.000 description 3
- WMHSRBZIJNQHKT-FFKFEZPRSA-N abacavir sulfate Chemical compound OS(O)(=O)=O.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 WMHSRBZIJNQHKT-FFKFEZPRSA-N 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- AXRYRYVKAWYZBR-GASGPIRDSA-N atazanavir Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)[C@@H](O)CN(CC=1C=CC(=CC=1)C=1N=CC=CC=1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)C1=CC=CC=C1 AXRYRYVKAWYZBR-GASGPIRDSA-N 0.000 description 3
- CJBJHOAVZSMMDJ-HEXNFIEUSA-N darunavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1[C@@H]2CCO[C@@H]2OC1)C1=CC=CC=C1 CJBJHOAVZSMMDJ-HEXNFIEUSA-N 0.000 description 3
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 3
- 229940001018 emtriva Drugs 0.000 description 3
- PEASPLKKXBYDKL-FXEVSJAOSA-N enfuvirtide Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(C)=O)[C@@H](C)O)[C@@H](C)CC)C1=CN=CN1 PEASPLKKXBYDKL-FXEVSJAOSA-N 0.000 description 3
- PYGWGZALEOIKDF-UHFFFAOYSA-N etravirine Chemical compound CC1=CC(C#N)=CC(C)=C1OC1=NC(NC=2C=CC(=CC=2)C#N)=NC(N)=C1Br PYGWGZALEOIKDF-UHFFFAOYSA-N 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 230000037452 priming Effects 0.000 description 3
- CZFFBEXEKNGXKS-UHFFFAOYSA-N raltegravir Chemical compound O1C(C)=NN=C1C(=O)NC(C)(C)C1=NC(C(=O)NCC=2C=CC(F)=CC=2)=C(O)C(=O)N1C CZFFBEXEKNGXKS-UHFFFAOYSA-N 0.000 description 3
- 229940064914 retrovir Drugs 0.000 description 3
- 102200041344 rs1553190285 Human genes 0.000 description 3
- 102220290932 rs1555454339 Human genes 0.000 description 3
- 102220029647 rs398123613 Human genes 0.000 description 3
- 102220098796 rs746359399 Human genes 0.000 description 3
- 102200080011 rs755832705 Human genes 0.000 description 3
- QWAXKHKRTORLEM-UGJKXSETSA-N saquinavir Chemical compound C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 QWAXKHKRTORLEM-UGJKXSETSA-N 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 229960001355 tenofovir disoproxil Drugs 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- SUJUHGSWHZTSEU-FYBSXPHGSA-N tipranavir Chemical compound C([C@@]1(CCC)OC(=O)C([C@H](CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)=C(O)C1)CC1=CC=CC=C1 SUJUHGSWHZTSEU-FYBSXPHGSA-N 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 229910052722 tritium Inorganic materials 0.000 description 3
- 229940052255 ziagen Drugs 0.000 description 3
- 108010019625 Atazanavir Sulfate Proteins 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 2
- 108010041986 DNA Vaccines Proteins 0.000 description 2
- 229940021995 DNA vaccine Drugs 0.000 description 2
- 108010032976 Enfuvirtide Proteins 0.000 description 2
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 2
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 2
- 102220580970 Induced myeloid leukemia cell differentiation protein Mcl-1_I50T_mutation Human genes 0.000 description 2
- KJHKTHWMRKYKJE-SUGCFTRWSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O KJHKTHWMRKYKJE-SUGCFTRWSA-N 0.000 description 2
- 241001183012 Modified Vaccinia Ankara virus Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 102220602556 Ubiquitin carboxyl-terminal hydrolase 4_R40E_mutation Human genes 0.000 description 2
- 206010058874 Viraemia Diseases 0.000 description 2
- 102220477147 Y-box-binding protein 1_W65A_mutation Human genes 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- 229960001830 amprenavir Drugs 0.000 description 2
- YMARZQAQMVYCKC-OEMFJLHTSA-N amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000009352 congenital transmission Effects 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 229960005107 darunavir Drugs 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 229910052805 deuterium Inorganic materials 0.000 description 2
- 229960002656 didanosine Drugs 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 108700004025 env Genes Proteins 0.000 description 2
- 101150030339 env gene Proteins 0.000 description 2
- 229960002049 etravirine Drugs 0.000 description 2
- 229960003142 fosamprenavir Drugs 0.000 description 2
- MLBVMOWEQCZNCC-OEMFJLHTSA-N fosamprenavir Chemical compound C([C@@H]([C@H](OP(O)(O)=O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 MLBVMOWEQCZNCC-OEMFJLHTSA-N 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- -1 hydroxide ions Chemical class 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- CBVCZFGXHXORBI-PXQQMZJSSA-N indinavir Chemical compound C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 CBVCZFGXHXORBI-PXQQMZJSSA-N 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- 238000002559 palpation Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 2
- 102220230310 rs1064794367 Human genes 0.000 description 2
- 102220005410 rs34504387 Human genes 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 229940054565 sustiva Drugs 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 229960002555 zidovudine Drugs 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- GSNHKUDZZFZSJB-UHFFFAOYSA-N 4,4-difluoro-n-[3-[3-(3-methyl-5-propan-2-yl-1,2,4-triazol-4-yl)-8-azabicyclo[3.2.1]octan-8-yl]-1-phenylpropyl]cyclohexane-1-carboxamide Chemical compound CC(C)C1=NN=C(C)N1C1CC(N2CCC(NC(=O)C3CCC(F)(F)CC3)C=3C=CC=CC=3)CCC2C1 GSNHKUDZZFZSJB-UHFFFAOYSA-N 0.000 description 1
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 1
- 102220504823 Acetylcholine receptor subunit alpha_S73N_mutation Human genes 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 241001502050 Acis Species 0.000 description 1
- AXRYRYVKAWYZBR-UHFFFAOYSA-N Atazanavir Natural products C=1C=C(C=2N=CC=CC=2)C=CC=1CN(NC(=O)C(NC(=O)OC)C(C)(C)C)CC(O)C(NC(=O)C(NC(=O)OC)C(C)(C)C)CC1=CC=CC=C1 AXRYRYVKAWYZBR-UHFFFAOYSA-N 0.000 description 1
- 229920002498 Beta-glucan Polymers 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 102000036364 Cullin Ring E3 Ligases Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241000132179 Eurotium medium Species 0.000 description 1
- 241000713800 Feline immunodeficiency virus Species 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 229940033330 HIV vaccine Drugs 0.000 description 1
- 102220498322 HLA class II histocompatibility antigen, DR beta 3 chain_R40S_mutation Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000820789 Homo sapiens Syncytin-2 Proteins 0.000 description 1
- 101000883219 Homo sapiens cGMP-gated cation channel alpha-1 Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 102220580937 Induced myeloid leukemia cell differentiation protein Mcl-1_K40R_mutation Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 229920001202 Inulin Polymers 0.000 description 1
- OFFWOVJBSQMVPI-RMLGOCCBSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O.N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 OFFWOVJBSQMVPI-RMLGOCCBSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 108010028921 Lipopeptides Proteins 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- HACHPVCYFLSKSB-UMJDSZQGSA-N ManNAz-DBCO-Pam3CSK4 Chemical compound CCCCCCCCCCCCCCCC(N[C@H](CSCC(COC(CCCCCCCCCCCCCCC)=O)OC(CCCCCCCCCCCCCCC)=O)C(N[C@H](CO)C(N[C@H](CCCCN)C(N[C@H](CCCCN)C(N[C@H](CCCCN)C(N[C@H](CCCCN)C(NCCC(N(C1)C2=CC=CC=C2C2N(C(N[C@H]([C@H](C3)O)[C@H]([C@@H]([C@@H](CO)O)O)O[C@@]3(C(O)=O)O)=O)N=NC2C2=C1C=CC=C2)=O)=O)=O)=O)=O)=O)=O)=O HACHPVCYFLSKSB-UMJDSZQGSA-N 0.000 description 1
- 241000713821 Mason-Pfizer monkey virus Species 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 102220631847 Stathmin-3_S73D_mutation Human genes 0.000 description 1
- 102100021742 Syncytin-2 Human genes 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- SUJUHGSWHZTSEU-UHFFFAOYSA-N Tipranavir Natural products C1C(O)=C(C(CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)C(=O)OC1(CCC)CCC1=CC=CC=C1 SUJUHGSWHZTSEU-UHFFFAOYSA-N 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- UGWQMIXVUBLMAH-IVVFTGHFSA-N [(1s,4r)-4-[2-amino-6-(cyclopropylamino)purin-9-yl]cyclopent-2-en-1-yl]methanol;4-amino-1-[(2r,5s)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 UGWQMIXVUBLMAH-IVVFTGHFSA-N 0.000 description 1
- ZVLWUMPAHCEZAW-KRNLDFAISA-N [(2r)-3-[2-[[(2s)-2-[[(4r)-4-[[(2s)-2-[[(2r)-2-[(2r,3r,4r,5r)-2-acetamido-4,5,6-trihydroxy-1-oxohexan-3-yl]oxypropanoyl]amino]propanoyl]amino]-5-amino-5-oxopentanoyl]amino]propanoyl]amino]ethoxy-hydroxyphosphoryl]oxy-2-hexadecanoyloxypropyl] hexadecanoate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O)C(N)=O ZVLWUMPAHCEZAW-KRNLDFAISA-N 0.000 description 1
- GLWHPRRGGYLLRV-XLPZGREQSA-N [[(2s,3s,5r)-3-azido-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](N=[N+]=[N-])C1 GLWHPRRGGYLLRV-XLPZGREQSA-N 0.000 description 1
- 229960004748 abacavir Drugs 0.000 description 1
- MCGSCOLBFJQGHM-SCZZXKLOSA-N abacavir Chemical compound C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 MCGSCOLBFJQGHM-SCZZXKLOSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 229940124522 antiretrovirals Drugs 0.000 description 1
- 239000003903 antiretrovirus agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 229940030139 aptivus Drugs 0.000 description 1
- 229960003277 atazanavir Drugs 0.000 description 1
- 229940068561 atripla Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 102100038623 cGMP-gated cation channel alpha-1 Human genes 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229940014461 combivir Drugs 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229940088900 crixivan Drugs 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- 229950005647 eldexomer Drugs 0.000 description 1
- 229960000366 emtricitabine Drugs 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 229960002062 enfuvirtide Drugs 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- LLYJISDUHFXOHK-GOCONZMPSA-N ferroptocide Chemical compound C[C@@H]1CC[C@@]23C[C@@H](C(=O)[C@]2([C@@]1([C@@H](C[C@H]([C@@H]3C)C4=CCN5C(=O)N(C(=O)N5C4)C6=CC=CC=C6)OC(=O)CCl)C)O)O LLYJISDUHFXOHK-GOCONZMPSA-N 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229940125777 fusion inhibitor Drugs 0.000 description 1
- 229940099052 fuzeon Drugs 0.000 description 1
- 108010027225 gag-pol Fusion Proteins Proteins 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- XDCYNQWCVILZRA-MHABTSDKSA-N hiv30 Chemical group C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H]1C(N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)NCCCCCNC(=O)CC1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(N)=O)[C@@H](C)CC)=O)[C@@H](C)O)NC(=O)CCC(O)=O)C1=CC=C(O)C=C1 XDCYNQWCVILZRA-MHABTSDKSA-N 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 229960001936 indinavir Drugs 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940124524 integrase inhibitor Drugs 0.000 description 1
- 239000002850 integrase inhibitor Substances 0.000 description 1
- 229940115474 intelence Drugs 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 229940029339 inulin Drugs 0.000 description 1
- JYJIGFIDKWBXDU-MNNPPOADSA-N inulin Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)OC[C@]1(OC[C@]2(OC[C@]3(OC[C@]4(OC[C@]5(OC[C@]6(OC[C@]7(OC[C@]8(OC[C@]9(OC[C@]%10(OC[C@]%11(OC[C@]%12(OC[C@]%13(OC[C@]%14(OC[C@]%15(OC[C@]%16(OC[C@]%17(OC[C@]%18(OC[C@]%19(OC[C@]%20(OC[C@]%21(OC[C@]%22(OC[C@]%23(OC[C@]%24(OC[C@]%25(OC[C@]%26(OC[C@]%27(OC[C@]%28(OC[C@]%29(OC[C@]%30(OC[C@]%31(OC[C@]%32(OC[C@]%33(OC[C@]%34(OC[C@]%35(OC[C@]%36(O[C@@H]%37[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O%37)O)[C@H]([C@H](O)[C@@H](CO)O%36)O)[C@H]([C@H](O)[C@@H](CO)O%35)O)[C@H]([C@H](O)[C@@H](CO)O%34)O)[C@H]([C@H](O)[C@@H](CO)O%33)O)[C@H]([C@H](O)[C@@H](CO)O%32)O)[C@H]([C@H](O)[C@@H](CO)O%31)O)[C@H]([C@H](O)[C@@H](CO)O%30)O)[C@H]([C@H](O)[C@@H](CO)O%29)O)[C@H]([C@H](O)[C@@H](CO)O%28)O)[C@H]([C@H](O)[C@@H](CO)O%27)O)[C@H]([C@H](O)[C@@H](CO)O%26)O)[C@H]([C@H](O)[C@@H](CO)O%25)O)[C@H]([C@H](O)[C@@H](CO)O%24)O)[C@H]([C@H](O)[C@@H](CO)O%23)O)[C@H]([C@H](O)[C@@H](CO)O%22)O)[C@H]([C@H](O)[C@@H](CO)O%21)O)[C@H]([C@H](O)[C@@H](CO)O%20)O)[C@H]([C@H](O)[C@@H](CO)O%19)O)[C@H]([C@H](O)[C@@H](CO)O%18)O)[C@H]([C@H](O)[C@@H](CO)O%17)O)[C@H]([C@H](O)[C@@H](CO)O%16)O)[C@H]([C@H](O)[C@@H](CO)O%15)O)[C@H]([C@H](O)[C@@H](CO)O%14)O)[C@H]([C@H](O)[C@@H](CO)O%13)O)[C@H]([C@H](O)[C@@H](CO)O%12)O)[C@H]([C@H](O)[C@@H](CO)O%11)O)[C@H]([C@H](O)[C@@H](CO)O%10)O)[C@H]([C@H](O)[C@@H](CO)O9)O)[C@H]([C@H](O)[C@@H](CO)O8)O)[C@H]([C@H](O)[C@@H](CO)O7)O)[C@H]([C@H](O)[C@@H](CO)O6)O)[C@H]([C@H](O)[C@@H](CO)O5)O)[C@H]([C@H](O)[C@@H](CO)O4)O)[C@H]([C@H](O)[C@@H](CO)O3)O)[C@H]([C@H](O)[C@@H](CO)O2)O)[C@@H](O)[C@H](O)[C@@H](CO)O1 JYJIGFIDKWBXDU-MNNPPOADSA-N 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229940088976 invirase Drugs 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229940111682 isentress Drugs 0.000 description 1
- 229940112586 kaletra Drugs 0.000 description 1
- 229960001627 lamivudine Drugs 0.000 description 1
- 150000002632 lipids Chemical group 0.000 description 1
- 238000012768 mass vaccination Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 108020004084 membrane receptors Proteins 0.000 description 1
- 125000005341 metaphosphate group Chemical group 0.000 description 1
- 108700007621 mifamurtide Proteins 0.000 description 1
- 229960005225 mifamurtide Drugs 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960000884 nelfinavir Drugs 0.000 description 1
- 229940072250 norvir Drugs 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 229940068586 prezista Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 229960004742 raltegravir Drugs 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 229940063627 rescriptor Drugs 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229940107904 reyataz Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 229960001852 saquinavir Drugs 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 125000004079 stearyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 229960004556 tenofovir Drugs 0.000 description 1
- SGOIRFVFHAKUTI-ZCFIWIBFSA-N tenofovir (anhydrous) Chemical compound N1=CN=C2N(C[C@@H](C)OCP(O)(O)=O)C=NC2=C1N SGOIRFVFHAKUTI-ZCFIWIBFSA-N 0.000 description 1
- 229960000838 tipranavir Drugs 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 238000005829 trimerization reaction Methods 0.000 description 1
- 229940111527 trizivir Drugs 0.000 description 1
- 229940008349 truvada Drugs 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229940023080 viracept Drugs 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 229940098802 viramune Drugs 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 229940087450 zerit Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/21—Retroviridae, e.g. equine infectious anemia virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to mutated lentiviral ENV proteins and their use as drugs.
- Lentivirus is a genus of slow viruses of the Retroviridae family, characterized by a long incubation period. Lentiviruses can deliver a significant amount of genetic information into the DNA of the host cell and have the unique ability among retroviruses of being able to replicate in non-dividing cells, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
- Human immunodeficiency virus (HIV) is according to WHO one of the most serious health crisis the world faces today. AIDS has killed more than 25 million people since 1981. In the most severely affected countries, the average life expectancy is now declining to 49 years of age - 13 years less than in the absence of AIDS.
- HIV-1 and HIV-2 that infect humans. They belong to a group of retroviruses called Lentiviruses and a virus similar to HIV has been found in African monkeys. Retroviruses transfer their genes from a producer cell to a target cell as a genomic RNA transcript, which is reverse-transcribed after infection and integrated into the DNA genome of the target cell.
- the replication process for HIV-1 has an error rate of about one per 10,000 base pairs. Since the entire viral genome is just under 10,000 base pairs, it is estimated that on average one error is introduced into the HIV-1 genome at each viral replication cycle.
- This high mutation rate contributes to extensive variability of the viruses inside any one person and an even wider variability across populations.
- the M (for major) variant is by far the most prevalent world wide. Within the M variant are clades A, B. C, D, E, F. G H. I, J and K, with clades A through E representing the vast majority of infections globally. Clades A, C and D are dominant in Africa, while clade B is the most prevalent in Europe, North and South America and Southeast Asia. Clades E and C are dominant in Asia. These clades differ by as much as 35%. Another variant is clade O, which is observed in Cameroun isolates of HIV-1.
- the high mutation rate is one of the mechanisms that allow the virus to escape from control by drug therapies. These new viruses represent resistant strains.
- the high mutation rate also allows the virus to escape the patient's immune system by altering the structures that are recognized by immune components.
- An added consequence of this extensive variability is that the virus can also escape from control by vaccines, and therefore makes it difficult to find vaccines based on envelope proteins which are effective.
- the virus produces proteins having immunosuppressive properties, allowing to escape the patient's immune system survey.
- cell expressing such proteins become "invisible" to the immune system.
- the international application WO 2005/095,442 discloses mutations in the immunosuppressive domains of endogenous retroviruses (ERV) or onco retroviruses, such as HTLV or FeLV, ENV proteins.
- ERV endogenous retroviruses
- onco retroviruses such as HTLV or FeLV
- ENV proteins HTLV or FeLV
- the international application WO 2005/095, 442 never mentions or suggests that the mutations made in the immunosuppressive domain of ERV- or onco retroviruses ENV proteins can be transposable to lentiviral ENV proteins.
- amino acid residues of the consensus sequence are selected from the groups of residues consisting of: X(l): L, S, R, P, F, A, V, M, and I; and
- X(7) A, S, T, V, L, G, F, D, M, and E;
- X(l 1) Y, L, F, H, C, I, T, M, and N;
- X(12) L, I, V, M, Q, P, T, Y, and A;
- X(17) L, F, I, R, V, P, S, M, and H, and
- X(32) A, N, T, S, D, R, FQ, P, I, E, V, M, L, K, H, C, and B;
- X(35) W, R, G, L, M, and P
- X(36) N, S, D, B, K, E, R, Q, M, and G
- X(37) S, T, A, N, D, V, I, E, Y, K, L, R, G, P, M, F, W, H, Q, B, and C;
- X(42) K, R, N, D, S, T, G, E, I, V, Y, Q, P, H, A, W, M, and C, and
- X(43) S, T, N, K, I, R, D, E, P, L, A, W, G, M, H, Y, F, V, and C,
- X(44) L, Y, Q, F, E, H, S, V, K, M, T, I, W, N, D, R, P, A, and G;
- X(45) D, E, N, S, T, K, G, L, A, Q, H, I, Y, B, R, V, P, M, F, W, Z, and C;
- X(46) E, D, Q, Y, K, N, T, S, A, W, H, M, R, I, G, L, V, Z, F, B, and P ;
- X(48) W, I, T, N, D, E, L, G, S, Y, R, V, K, H, A, Q, M, and F;
- X(50) N, D, T, K, S, H, L, G, E, W, I, Q, M, R, B, Y, P, and A;
- This consensus sequence contains 50 amino acids, in which the specific amino acids in position 10, 19, 24, 34 and 40 are defined as affecting the immunogenic properties of a HIV-1 envelope polypeptide, and the 45 remaining positions are randomly defined including the most common amino acids of wild-type HIV ENV proteins.
- WO 2010/022,740 is a transposition from endogenous retroviruses (ERV) or onco retroviruses to lentivirus on the basis of the teaching of WO 2005/095,442 (Inventors : Renard, Mangeney & Heidmann), but said transposition is inappropriate in the case of lentivirus, as shown by the Inventor of the present invention.
- ERP endogenous retroviruses
- WO 2005/095,442 Inventors : Renard, Mangeney & Heidmann
- Dr Heidmann is an Inventor in WO 2005/095,442 and in the present invention.
- the effects of the mutations described in WO 2005/095,442 were also tested in lentivirus by the Inventor of the present invention, but no effect was observed when the mutations identified in endogenous retroviruses or onco retroviruses were transposed into ENV protein of lentivirus.
- WO 2010/022,740 teaches that such mutations can be effective using any amino acid residue. This teaching is in contradiction with the present invention, showing that the immunosuppressive properties of HIV- 1 ENV protein are only affected by specific mutations that are defined not only by their position, but also by the nature of the substituted amino acid residues.
- WO 2010/022,740 discloses experimental results for only one specific mutation within the immunosuppressive domain of HIV ENV protein, as defined by the 50 amino acids consensus sequence.
- the mutation a substitution by R as the only one exemplified in the international application WO 2010/022,740, occurs at the amino acid in position 19, which again is equivalent to the position disclosed in the international application WO 2005/095,442 if one simply aligns ENV sequences (see Fig 3 in WO 2010/022,740, which is a copy of Figure 3 in Benit et al. 2001, Journal of Virology, Vol. 75, No. 23, p.l 1709-11719) (Of note not only the position of the amino acid, but also the nature of the substitution (by arginine) is similar to the one described in WO 2005/095,442).
- WO 2010/022,740 discloses that said mutated HIV ENV protein inhibits proliferation of PBMC ex vivo, but such ex vivo result has no in vivo predictive value.
- WO 2010/022,740 never discloses or suggests that mutants are efficient in vivo, i.e. that cell expressing mutants are detected by the immune system.
- WO 2010/022,740 raises the same technical problem as the present invention, but does not offer an appropriate technical solution.
- This prior art reveals the difficulties to overcome the identification of the effective mutations affecting the immunosuppressive properties of the lentiviral ENV proteins.
- One aim of the invention is to provide new mutated ENV proteins devoid of immunosuppressive properties.
- Another aim of the invention is to provide a new pharmaceutical composition efficient for treating lentiviral infection.
- Another aim of the invention is to provide an efficient vaccine.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising as active substance : a) an isolated mutated human or simian lentiviral ENV protein having substantially no immunosuppressive activity,
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein having at least 70% identity, preferably at least 80% identity, to one sequence chosen from the group consisting of SEQ ID NO : 216, SEQ ID NO : 420 and SEQ ID NO : 421,
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X a is A, F, G, L, R or deleted
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y, or
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is A, F, G, R or deleted, or
- X a is A, F, G, L, R or deleted
- Xb is A, F, G, R or deleted
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, F, G, L, R or deleted
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y, or
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is A, F, G, R or deleted, or
- X a is A, F, G, L, R or deleted
- Xb is A, F, G, R or deleted, in association with a pharmaceutically acceptable carrier, said substantial absence of immunosuppressive activity of the above mentioned mutated human or simian lentiviral ENV protein or of the above defined fragment being liable to be assessed by the fact that in an in vivo assay involving engrafted tumor cells rejection,
- tumor cells being transduced either so as to express said mutated ENV protein or said fragment ("mutated ENV tumor cells"), or said tumor cells being transduced so as to express said wild type ENV protein or a fragment thereof ("wild type ENV tumor cells”),
- tumor cells being not transduced
- immunosuppression index of said mutated ENV protein or of said fragment ( ated env ) / immunosuppression index of wild type ENV protein (i w iid type env ) is less than 0.5
- imutated env being defined by : (maximum area reached by mutated ENV tumor cells - maximum area reached by normal tumor cells) / (maximum area reached by normal tumor cells), and
- iwiid type env being defined by : (maximum area reached by wild type ENV tumor cells - maximum area reached by normal tumor cells) / (maximum area reached by normal tumor cells).
- the present application is based on the unexpected observation made by the Inventors that some specific amino acids of the immunosuppressive domain of a lentiviral ENV protein can be mutated conferring to said lentiviral ENV protein essentially no immunosuppressive properties, or no immunosuppressive properties, while retaining its antigenicity, the three- dimentional structure of the immunosuppressive domain, and its expression at the plasma membrane.
- the mutated lentiviral ENV protein according to the invention does not alter the infectivity of a virus expressing it.
- the "mutated simian or human lentiviral ENV proteins” means that the ENV proteins derive from the expression of an env gene of a lentivirus of human or simian.
- Lentiviruses according to the invention encompassed by the invention are HIV-1 and 2 and Simian immunodeficiency virus (SIV).
- SIV Simian immunodeficiency virus
- the "mutated ENV protein" as defined in the invention, encompasses two meanings.
- the said "mutated ENV protein” is the unnatural result of the intervention of human beings. According to the second meaning, the mutated ENV protein also encompasses naturally occurring variants for which up to now the non immunosuppressive properties remain unknown.
- This second meaning takes into consideration the natural variability of HIV and SIV variants inside a same infected individual, wherein the said "mutated ENV protein" might be non immunosuppressive but its property is undetectable because an HIV infected patient always carries many HIV variants, the majority of which is immunosuppressive.
- the three following proteins correspond to wild type sequences of the ENV protein of HIV-1, HIV-2 and SIV respectively. In the invention, they are considered as reference sequences of wild type ENV proteins.
- Variant in the invention encompasses SIV, HIV-1 and HIV-2 ENV proteins.
- Variants of the HIV-1 mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the wild type amino acid sequence of the HIV-1 ENV protein, and comprises the mutations as described above, and harbour no immunosuppressive activity.
- Variants of the HIV-2 mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the wild type amino acid sequence of the HIV-2 ENV protein, and comprises the mutations as described above, and harbour no immunosuppressive activity.
- Variants of the SIV mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the wild type amino acid sequence of the SIV ENV protein, and comprises the mutations as described above, and harbour no immunosuppressive activity.
- the three following proteins correspond to three mutated sequences of the ENV protein of HIV- 1, HIV-2 and SIV respectively. In the invention, they are considered as reference sequences of the mutated ENV proteins.
- SEQ ID NO : 216 corresponds to the SEQ ID NO : 417 in which the amino acid residue Y in position 5 (X a ) of the sequence A-[I/V]-E-[K/R]-X a -Xb-X-D-Q has been substituted by R.
- SEQ ID NO : 420 corresponds to the SEQ ID NO : 418 in which the amino acid residue Y in position 5 (X a ) of the sequence A-[I/V]-E-[K/R]-X a -X b -X-D-Q has been substituted by R.
- SEQ ID NO : 421 corresponds to the SEQ ID NO : 419 in which the amino acid residue Y in position 5 (X a ) of the sequence A-[I/V]-E-[K/R]-X a -X b -X-D-Q has been substituted by R.
- the invention also encompasses the variants of the ' 'mutated simian or human lentiviral ENV protein", harbouring the above mentioned mutations, and conferring a lack of immunosuppressive properties to said variant.
- Variants of the HIV-1 mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the reference mutated sequence of HIV-1 ENV protein (SEQ ID NO : 216), and comprises the mutations as described above, and harbour no immunosuppressive activity.
- Variants of the HIV-2 mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the reference mutated sequence of the HIV-2 ENV protein (SEQ ID NO : 420), and comprises the mutations as described above, and harbour no immunosuppressive activity.
- Variants of the SIV mutated ENV proteins according to the invention have at least 70%, preferably at least 80%, more preferably at least 90% of identity with the reference mutated sequence of the SIV ENV protein (SEQ ID NO : 421), and comprises the mutations as described above, and harbour no immunosuppressive activity.
- immunosuppressive domain (ISU) of the lentivirus according to the invention can be delimited by the sequence SEQ ID NO: 6,
- SEQ ID NO: 6 corresponds to the non mutated ISU domain.
- SEQ ID NO: 6 comprises SEQ ID NO: 1.
- HIV-1 ENV protein comprises the amino acid sequence AVERYLKDQ (SEQ ID NO: 7)
- HIV-2 ENV protein comprises the amino acid sequence AIEKYLKDQ (SEQ ID NO: 8)
- SIV ENV protein comprises the amino acid sequence SEQ ID NO: 7 or 8.
- the ISU domain looses its immunosuppressive properties.
- the underlined amino acids are the essential amino acids.
- the ISU domain as defined by SEQ ID NO: 6, is the minimal essential domain of the ENV protein according to the invention which harbours an immunosuppressive activity.
- the localization of an ISU domain can be determined in all ENV proteins of viruses as described in Benit et al. 2001, Journal of Virology, Vol. 75, No. 23, p.11709-11719.
- the ISU domain is defined by its structure and its localization, irrespective of the fact that it possesses or not an immunosuppressive activity.
- the ISU domain refers to a specific domain in which a mutation can affect the immunosuppressive property of the ENV protein.
- the immunosuppressive property of the ENV protein is preferably measured using in vivo procedures, which are representative of the physiological environment.
- the immunosuppressive properties of the mutated ENV proteins according to the invention are measured according to an in vivo procedure to assay the immunosuppressive activity of a ENV protein disclosed previously [Mangeney and Heidmann Proc Natl Acad Sci USA 1998;95: 14920-14925; Mangeney et al. Proc Natl Acad Sci USA, 2007, 104(51):20534- 91
- this in vivo procedure is performed using ENV proteins, or fragment thereof, which are not associated to another component or carrier proteins, such as BSA.
- tumour cell lines such as MCA 205 or C18.1 cell lines by known transfection methods.
- the tumour cells expressing the protein to be tested are then injected especially subcutaneous (s.c.) injection to a host, generally mice. Following said injection, the establishment of tumour or, to the contrary, its rejection, is determined and the tumour area is measured. Tumor establishment was determined by palpation and tumor area (mm 2 ) was determined by measuring perpendicular tumor diameters.
- the above defined ratio relative to the immunosuppressive index can be less than 0.2, and can even have a negative value (see Figures 2 and 3).
- In vitro assay could be carried out, using high doses of synthetic peptides but they are indirect and less convincing, since the expression "immunosuppressive" is relevant when applied to animals possessing a complete immune system and not to cell lines.
- An additional difficulty for the functional characterization of an ISU domain relies on the fact that the ISU carried by the retroviral ENV proteins is a highly structured proteic domain, with trimer formation within the complete ENV proteins (Caffrey M., Biochimica et Biophysica Acta, 1536:116-122, 2001; Caffrey et al, The EMBO Journal, Vol. 17, No. 16, p.4572-4584, 1998).
- Such structures are not naturally formed with ISU peptides of limited length, and this is most probably why most studies carried out with peptides provide irrelevant results and/or are dependent on specific coupling of the peptides to carrier proteins (such as BSA, e.g. Denner et al, Current Science, AIDS 1994, 8:1063- 1072).
- the ENV proteins according to the invention are mutated. This mutation is made in vitro. Thus, the mutated ENV proteins according to the invention are isolated, and does not correspond to naturally occurring counterpart.
- the lentiviral mutated ENV proteins are substantially devoid of immunosuppressive properties.
- the mutated ENV proteins according to the invention have no, or have reduced immunosuppressive properties with respect to the natural non mutated ENV protein from a virus of the same species.
- a mutated HIV ENV protein according to the invention has reduced immunosuppressive properties with respect to the wild type HIV ENV protein.
- the terms "substantially devoid of immunosuppressive properties” means that the mutated ENV proteins according to the invention have an immunosuppressive index less than about 0.2 [Mangeney and Heidmann Proc Natl Acad Sci USA 1998;95: 14920-14925; Mangeney et al. Proc Natl Acad Sci USA, 2007, l04(51):20534-9
- structures responsible for antigenicity relates to structures of the protein which are liable to interact with components of the immune system such as antibodies or membrane receptors of immune cells, in particular T cells.
- the mutation(s) within the immunosuppressive domain of the lentiviral ENV proteins is (are) sufficient to decrease the immunosuppressive activity of the mutated lentiviral ENV protein with respect to the corresponding wild type ENV.
- another amino acid be also mutated because it ensures that the structure of the mutated ENV protein is essentially conserved with respect to the corresponding wild type ENV protein.
- the mutated lentiviral ENV protein has substantially retained the structure, especially the antigenic structure, e.g., immunogenic determinants, of the original determined lentiviral ENV protein, i.e. the wild type non mutated lentiviral ENV protein.
- the mutated ENV protein involved in the present invention has an average length of about 700 to about 950 amino acids.
- the invention encompasses fragments of the mutated ENV protein as defined above, provided that said fragment:
- - preferably, comprises the extracellular parts of the ENV protein
- the fragment of the mutated ENV protein of the invention can comprise about 40, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650 or 700 amino acids. These values are given only in an illustrative way, as the man skilled in the art will understand that the fragment can comprise any number of amino acids comprised between 40 and 700.
- the fragments according to the invention are such that, while retaining the antigenic structure of the full length mutated ENV protein, and thus of the wild type ENV protein, they have lost major antigenic regions that are responsible for antigenicity in another region than the region corresponding to the immunosuppressive domain.
- the invention also relates to a pharmaceutical composition wherein the active substance is an isolated non naturally occurring mutated human or simian lentiviral ENV protein having substantially no immunosuppressive activity, as above defined, or fragments thereof.
- the invention relates to a pharmaceutical composition as defined above comprising as active substance :
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, F, G, L or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is A, F, G or R, or
- X a is A, F, G, L or R
- Xb is A, F, G or R, or
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid, and either
- X a is A, F, G, L or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is A, F, G or R
- X a is A, F, G, L or R
- Xb is A, F, G or R, in association with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition as defined above comprising as active substance :
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, F, G, L or R, and X b is L, I, V, M or P, or
- X a is Y, I, H, C or T
- Xb is A, F, G or R, or
- X a is A, F, G, L or R
- Xb is A, F, G or R
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid, and either
- X a is A, F, G, L or R, and X b is L, I, V, M or P, or
- X a is Y, I, H, C or T
- Xb is A, F, G or R, or
- X a is A, F, G, L or R
- Xb is A, F, G or R, in association with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition as defined above comprising as active substance :
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is F, G or R
- X a is F or L
- Xb is F, G or R
- X a is A, G or R, and Xb is F, G or R, or
- said fragment comprising at least 40 amino acids, said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y, or
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y, and X b is F, G or R,
- X a is F or L
- Xb is F, G or R
- X a is A, G or R, and Xb is F, G, R, in association with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition as defined above comprising as active substance :
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R, and X b is L, I, V, M or P,
- X a is Y, I, H, C or T, and Xb is F, G or R,
- X a is F or L
- Xb is F, G or R
- X a is A, G or R, and Xb is F, G or R, or
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R, and X b is L, I, V, M or P,
- X a is Y, I, H, C or T, and Xb is F, G or R,
- X a is F or L
- Xb is F, G or R
- X a is A, G or R, and Xb is F, G or R, in association with a pharmaceutically acceptable carrier.
- the invention also relates to a pharmaceutical composition as defined above comprising as active substance : a) an isolated mutated human or simian lentiviral ENV protein having substantially no immunosuppressive activity,
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y, or
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y, and X b is F, G or R, or
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y, or
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y, and X b is F, G or R, in association with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition as defined above, comprising as active substance : a) an isolated mutated human or simian lentiviral ENV protein having substantially no immunosuppressive activity,
- said mutated human or simian lentiviral ENV protein resulting from mutation of the transmembrane (TM) subunit of a wild type human or simian lentiviral ENV protein
- said mutated human or simian lentiviral ENV protein comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R, and X b is L, I, V, M or P,
- X a is Y, I, H, C or T
- Xb is F, G or R, or
- said fragment comprising at least 40 amino acids
- said fragment comprising a mutated immunosuppressive domain (ISU) containing the following amino acid sequence:
- X represents any amino acid
- X a is A, G, or R, and X b is L, I, V, M or P,
- X a is Y, I, H, C or T
- Xb is F, G or R, in association with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition as defined above, wherein
- X a is R
- X b is C, D, E, H, I, K, L, M, N, P, Q, S, T, V, W or Y
- X a is C, D, E, H, I, K, M, N, P, Q, S, T, V, W or Y
- X b is R, or
- the invention relates to a pharmaceutical composition as defined above, wherein said isolated mutated human or simian lentiviral ENV protein or said fragment of said isolated mutated human or simian lentiviral ENV protein comprises one of the following amino acid sequences :
- A-V-E-R-X a -X b -X-DQ (SEQ ID NO: 425).
- the invention relates to a pharmaceutical composition as defined above, wherein the resulting immunosuppressive domain, contained in the mutated lentiviral protein, comprises the amino acid sequence of the list consisting of: SEQ ID NO :9 to SEQ ID NO :37.
- SEQ ID NO : 9 to SEQ ID NO :37 encompass SEQ ID NO : 9, SEQ ID NO : 10, SEQ ID NO : l l , SEQ ID NO : 12, SEQ ID NO : 13, SEQ ID NO : 14, SEQ ID NO : 15, SEQ ID NO : 16, SEQ ID NO : 17, SEQ ID NO : 18, SEQ ID NO : 19, SEQ ID NO : 20, SEQ ID NO : 21, SEQ ID NO : 22, SEQ ID NO : 23, SEQ ID NO : 24, SEQ ID NO : 25, SEQ ID NO : 26, SEQ ID NO : 27, SEQ ID NO : 28, SEQ ID NO : 29, SEQ ID NO : 30, SEQ ID NO : 31, SEQ ID NO : 32, SEQ ID NO : 33, SEQ ID NO : 34, SEQ ID NO : 35, SEQ ID NO : 36 and SEQ ID NO : 37.
- AVERARKD SEQ ID NO : 21 AVERLFKD SEQ ID NO : 31
- AVERFFKD SEQ ID NO : 23 AVERLRKD SEQ ID NO : 33
- AVERGFKD SEQ ID NO : 27 AVERRRKD SEQ ID NO : 37
- the invention relates to a pharmaceutical composition as defined above, wherein the resulting immunosuppressive domain, contained in the mutated lentiviral protein, comprises the amino acid sequence of the list consisting of: SEQ ID NO :38 to SEQ ID NO :66.
- SEQ ID NO : 38 to SEQ ID NO :66 encompass SEQ ID NO : 38, SEQ ID NO : 39, SEQ ID NO : 40, SEQ ID NO : 41 , SEQ ID NO : 42, SEQ ID NO : 43, SEQ ID NO : 44, SEQ ID NO : 45, SEQ ID NO : 46, SEQ ID NO : 47, SEQ ID NO : 48, SEQ ID NO : 49, SEQ ID NO : 50, SEQ ID NO : 51, SEQ ID NO : 52, SEQ ID NO : 53, SEQ ID NO : 54, SEQ ID NO : 55, SEQ ID NO : 56, SEQ ID NO : 57, SEQ ID NO : 58, SEQ ID NO : 59, SEQ ID NO : 60, SEQ ID NO : 61, SEQ ID NO : 62, SEQ ID NO : 63, SEQ ID NO : 64, SEQ ID NO : 65 and SEQ ID NO : 60
- AIEKALKD SEQ ID NO : 38 AIEKYFKD SEQ ID NO : 44
- AIEKFLKD SEQ ID NO : 39 AIEKYGKD SEQ ID NO : 45
- AIEKGLKD SEQ ID NO : 40 AIEKYRKD SEQ ID NO : 46
- AIEKLLKD SEQ ID NO : 41 AIEKAAKD SEQ ID NO : 47
- AIEKRLKD SEQ ID NO : 42 AIEKAFKD SEQ ID NO : 48
- AIEKARKD SEQ ID NO : 50 AIEKLAKD SEQ ID NO : 59
- AIEKFAKD SEQ ID NO : 51 AIEKLFKD SEQ ID NO : 60
- AIEKFFKD SEQ ID NO : 52 AIEKLGKD SEQ ID NO : 61
- AIEKFGKD SEQ ID NO : 53 AIEKLRKD SEQ ID NO : 62
- AIEKFRKD SEQ ID NO : 54 AIEKRAKD SEQ ID NO : 63
- AIEKGAKD SEQ ID NO : 55 AIEKRFKD SEQ ID NO : 64
- the invention relates to a pharmaceutical composition as defined above, wherein the resulting immunosuppressive domain, contained in the mutated lentiviral protein, comprises the amino acid sequence of the list consisting of: SEQ ID NO : 67 to SEQ ID NO : 95.
- SEQ ID NO : 67 to SEQ ID NO :95 encompass SEQ ID NO : 67, SEQ ID NO : 68, SEQ ID NO : 69, SEQ ID NO : 70, SEQ ID NO : 71, SEQ ID NO : 72, SEQ ID NO : 73, SEQ ID NO : 74, SEQ ID NO : 75, SEQ ID NO : 76, SEQ ID NO : 77, SEQ ID NO : 78, SEQ ID NO : 79, SEQ ID NO : 80, SEQ ID NO : 81, SEQ ID NO : 82, SEQ ID NO : 83, SEQ ID NO : 84, SEQ ID NO : 85, SEQ ID NO : 86, SEQ ID NO : 87, SEQ ID NO : 88, SEQ ID NO : 89, SEQ ID NO : 90, SEQ ID NO : 91, SEQ ID NO : 92, SEQ ID NO 92, SEQ
- AIERAGKD SEQ ID NO : 78
- AIERYAKD SEQ ID NO : 72 AIERFAKD SEQ ID NO : 80
- AIERYRKD SEQ ID NO : 75 AIERFGKD SEQ ID NO : 82 AIERFRKD SEQ ID NO : 83 AIERLGKD SEQ ID NO : 90
- the previous ENV proteins having their ISU comprising the above sequence are devoid of immunosuppressive properties.
- any ENV protein of human or simian lentivirus having in their ISU an amino acid sequence comprising of the sequences SEQ ID NO: 9 to 95, is devoid of immunosuppressive properties.
- a simian or human lentiviral ENV protein comprising, within its ISU domain, an amino acid sequence selected from SEQ ID NO: 9 to 95 is devoid of immunosuppressive properties.
- the invention relates to a pharmaceutical composition as defined above, wherein said isolated mutated human or simian lentiviral ENV protein or said fragment of said isolated mutated human or simian lentiviral ENV protein comprises one of the amino acid sequences :
- the invention relates to a pharmaceutical composition as defined above, wherein said isolated mutated human or simian lentiviral ENV protein or said fragment of said isolated mutated human or simian lentiviral ENV protein comprises one of the amino acid sequences :
- the fragments of the mutated ENV proteins according to the invention comprise or consist of the following sequences: SEQ ID NO: 67 to 211.
- fragments are also devoid of immunosuppressive properties. However, these fragments retain the structure and the antigenicity of the corresponding immunosuppressive domain that is not mutated, i.e. the wild type immunosuppressive domain.
- the fragments of the mutated ENV proteins according to the invention comprise or consist of the following sequences: SEQ ID NO: 96 to 211.
- the invention relates to a pharmaceutical composition as defined above, wherein said isolated mutated human or simian lentiviral ENV protein or said fragment of said isolated mutated human or simian lentiviral ENV protein comprises one of the amino acid sequences : SEQ ID NO : 96, 98, 100, 102 to 108, 110 to 1 16, 1 18 to 125, 127, 129, 131 to 137, 139 to 145, 147 to 154, 156, 158, 160 to 166, 168 to 174, 176 to 183, 185, 187, 189 to 195, 197 to 203, 205 to 211.
- the invention relates to the pharmaceutical composition as defined above, wherein said mutated protein consists of one of the following sequences SEQ ID NO : 212 to 269
- MRVKEKYQHLWRWGWKWGTMLLGILMICSATEKLWVTVY SEQ ID NO : 215 YGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDP NPQEVVLVNVTENFNMWK DMVEQMHEDIISLWDQSLKPC VKLTPLCVSLKCTDLGNATNTNSSNTNSSSGEMMMEKGEIK NCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYTLTSCNTS
- VKLTPLC VSLKCTDLGNATNTNS SNTNS S SGEMMMEKGEIK
- VKLTPLC VSLKCTDLGNATNTNS SNTNS S SGEMMMEKGEIK
- VKLTPLC VSLKCTDLGNATNTNS SNTNS S SGEMMMEKGEIK
- MRVKEKYQHLWRWGWKWGTMLLGILMICSATEKLWVTVY SEQ ID NO : 231 YGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDP NPQEVVLVNVTENFNMWK DMVEQMHEDIISLWDQSLKPC VKLTPLCVSLKCTDLGNATNTNSSNTNSSSGEMMMEKGEIK NCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYTLTSCNTS
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- AIDS & HIV (AREA)
- Tropical Medicine & Parasitology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (15)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2014127521A RU2654673C2 (ru) | 2011-12-07 | 2012-12-07 | Мутантные лентивирусные белки env и их применение в качестве лекарственных средств |
IN4927CHN2014 IN2014CN04927A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) | 2011-12-07 | 2012-12-07 | |
KR1020147018840A KR102059918B1 (ko) | 2011-12-07 | 2012-12-07 | 돌연변이형 렌티바이러스 env 단백질 및 이의 약물로서의 용도 |
CN201280060076.2A CN104169295B (zh) | 2011-12-07 | 2012-12-07 | 突变的慢病毒env蛋白及其用作药物的用途 |
JP2014545294A JP6415324B2 (ja) | 2011-12-07 | 2012-12-07 | レンチウイルスの変異envタンパク質及び薬物としてのその使用 |
CA2856180A CA2856180C (en) | 2011-12-07 | 2012-12-07 | Mutated lentiviral env proteins and their use as drugs |
EP12806388.0A EP2788372B1 (en) | 2011-12-07 | 2012-12-07 | Mutated lentiviral env proteins and their use as drugs |
US14/363,095 US9682137B2 (en) | 2011-12-07 | 2012-12-07 | Mutant human and simian immunodeficiency virus ENV proteins with reduced immunosuppressive properties |
BR112014013704-8A BR112014013704B1 (pt) | 2011-12-07 | 2012-12-07 | Composição farmacêutica e método para se obter a substância ativa da mesma |
ES12806388T ES2748864T3 (es) | 2011-12-07 | 2012-12-07 | Proteínas ENV lentivíricas mutadas y su uso como fármacos |
DK12806388.0T DK2788372T3 (da) | 2011-12-07 | 2012-12-07 | Muterede lentivirus-ENV-proteiner og anvendelse deraf som lægemidler |
MX2014006744A MX350689B (es) | 2011-12-07 | 2012-12-07 | Proteinas env lentivirales mutadas y su uso como farmacos. |
AU2012350258A AU2012350258B2 (en) | 2011-12-07 | 2012-12-07 | Mutated lentiviral ENV proteins and their use as drugs |
ZA2014/03617A ZA201403617B (en) | 2011-12-07 | 2014-05-19 | Mutated lentiviral env proteins and their use as drugs |
IL232926A IL232926B (en) | 2011-12-07 | 2014-06-02 | Mutated lentiviral env proteins and their use as drugs |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP11306625 | 2011-12-07 | ||
EP11306625.2 | 2011-12-07 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2013083799A1 true WO2013083799A1 (en) | 2013-06-13 |
Family
ID=47435901
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2012/074835 WO2013083799A1 (en) | 2011-12-07 | 2012-12-07 | Mutated lentiviral env proteins and their use as drugs |
Country Status (16)
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022152818A1 (en) | 2021-01-13 | 2022-07-21 | Viroxis | Measles-hiv or measles-htlv vaccine |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111630060B (zh) * | 2017-09-01 | 2024-01-23 | 盈珀治疗有限公司 | 用于在疾病的预防和/或治疗中使用的疫苗 |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005012502A2 (en) * | 2003-03-28 | 2005-02-10 | Idm Pharma, Inc. | Methods of identifying optimal variants of peptide epitopes |
WO2005095442A1 (en) | 2004-03-30 | 2005-10-13 | Institut Gustave Roussy | Polypeptide sequence involved in the modulation of the immunosuppresive effect of viral proteins |
WO2006018289A1 (en) | 2004-08-17 | 2006-02-23 | Institut Gustave Roussy | Mutated hiv nef for modulating immunity |
WO2010022740A2 (en) | 2008-08-28 | 2010-03-04 | Aarhus Universitet | Hiv-1 envelope polypeptides for hiv vaccine |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1201750A1 (en) * | 2000-10-26 | 2002-05-02 | Genopoietic | Synthetic viruses and uses thereof |
RU2426788C1 (ru) * | 2010-03-01 | 2011-08-20 | Федеральное государственное учреждение науки "Центральный научно-исследовательский институт эпидемиологии" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФГУН ЦНИИЭ Роспотребнадзора) | Генетические конструкции для антивич-терапии |
-
2012
- 2012-12-07 CA CA2856180A patent/CA2856180C/en active Active
- 2012-12-07 IN IN4927CHN2014 patent/IN2014CN04927A/en unknown
- 2012-12-07 MX MX2014006744A patent/MX350689B/es active IP Right Grant
- 2012-12-07 US US14/363,095 patent/US9682137B2/en not_active Expired - Fee Related
- 2012-12-07 ES ES12806388T patent/ES2748864T3/es active Active
- 2012-12-07 RU RU2014127521A patent/RU2654673C2/ru active
- 2012-12-07 KR KR1020147018840A patent/KR102059918B1/ko active Active
- 2012-12-07 CN CN201280060076.2A patent/CN104169295B/zh active Active
- 2012-12-07 WO PCT/EP2012/074835 patent/WO2013083799A1/en active Application Filing
- 2012-12-07 AU AU2012350258A patent/AU2012350258B2/en not_active Ceased
- 2012-12-07 BR BR112014013704-8A patent/BR112014013704B1/pt active IP Right Grant
- 2012-12-07 EP EP12806388.0A patent/EP2788372B1/en active Active
- 2012-12-07 DK DK12806388.0T patent/DK2788372T3/da active
- 2012-12-07 JP JP2014545294A patent/JP6415324B2/ja not_active Expired - Fee Related
-
2014
- 2014-05-19 ZA ZA2014/03617A patent/ZA201403617B/en unknown
- 2014-06-02 IL IL232926A patent/IL232926B/en active IP Right Grant
-
2018
- 2018-06-04 JP JP2018107061A patent/JP2018150370A/ja active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005012502A2 (en) * | 2003-03-28 | 2005-02-10 | Idm Pharma, Inc. | Methods of identifying optimal variants of peptide epitopes |
WO2005095442A1 (en) | 2004-03-30 | 2005-10-13 | Institut Gustave Roussy | Polypeptide sequence involved in the modulation of the immunosuppresive effect of viral proteins |
WO2006018289A1 (en) | 2004-08-17 | 2006-02-23 | Institut Gustave Roussy | Mutated hiv nef for modulating immunity |
WO2010022740A2 (en) | 2008-08-28 | 2010-03-04 | Aarhus Universitet | Hiv-1 envelope polypeptides for hiv vaccine |
Non-Patent Citations (17)
Title |
---|
BELLIER ET AL.: "DNA vaccines expressing retrovirus-like particles are efficient immunogens to induce neutralizing antibodies", VACCINE, vol. 27, no. 42, 2009, pages 5772 - 80, XP026583854, DOI: doi:10.1016/j.vaccine.2009.07.059 |
BENIT ET AL., JOURNAL OF VIROLOGY, vol. 75, no. 23, 2001, pages 11 709 - 11 719 |
CAFFREY ET AL., THE EMBO JOURNAL, vol. 17, no. 16, 1998, pages 4572 - 4584 |
CAFFREY M., BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1536, 2001, pages 116 - 122 |
DATABASE UniProt [Online] 15 June 2010 (2010-06-15), "SubName: Full=Cell division protein FtsY; PPREVPTEPT TRLAKLRNRL AKSNNAMGRG LLALLSRDTL DEATWEEIED TLIVADLGVD", XP002675455, retrieved from EBI accession no. UNIPROT:D4YP64 Database accession no. D4YP64 * |
DATABASE UniProt [Online] 19 October 2011 (2011-10-19), "SubName: Full=Envelope glycoprotein; Flags: Fragment;", XP002675454, retrieved from EBI accession no. UNIPROT:G1JQN5 Database accession no. G1JQN5 * |
DENNER ET AL., CURRENT SCIENCE, AIDS, vol. 8, 1994, pages 1063 - 1072 |
DENNER J ET AL: "THE IMMUNOSUPPRESSIVE PEPTIDE OF HIV-1: FUNCTIONAL DOMAINS AND IMMUNE RESPONSE IN AIDS PATIENTS", AIDS, PHILADELPHIA,PA, US, vol. 8, no. 8, 1 August 1994 (1994-08-01), pages 1063 - 1072, XP000647542 * |
GUERBOIS ET AL., VIROLOGY, vol. 388, 2009, pages 191 - 203 |
MANGENEY ET AL., PROC NATL ACAD SCI USA, vol. 104, no. 51, 2007, pages 20534 - 9 |
MANGENEY M ET AL: "Placental syncytins: Genetic disjunction between the fusogenic and immunosuppressive activity of retroviral envelope proteins", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 104, no. 51, 18 December 2007 (2007-12-18), pages 20534 - 20539, XP002633415, ISSN: 0027-8424, [retrieved on 20071212], DOI: 10.1073/PNAS.0707873105 * |
MANGENEY M ET AL: "Tumor cells expressing a retroviral envelope escape immune rejection in vivo", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 95, no. 25, 1 December 1998 (1998-12-01), pages 14920 - 14925, XP002298109, ISSN: 0027-8424, DOI: 10.1073/PNAS.95.25.14920 * |
MANGENEY; HEIDMANN, PROC NATL ACAD SCI USA, vol. 95, 1998, pages 14920 - 14925 |
POULET ET AL., VETERINARY RECORD, vol. 153, no. 5, 2003, pages 141 - 145 |
SCHLECHT-LOUF ET AL., PROC NATL ACAD SCI U S A., vol. 107, no. 8, 2010, pages 3782 - 7, XP002675453 * |
SCHLECHT-LOUF ET AL., PROC NATL ACAD SCI USA., vol. 107, no. 8, 2010, pages 3782 - 7 |
VACCARI ET AL., EXPERT REVIEW OF VACCINES, vol. 9, no. 9, 2010, pages 997 - 1005 |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022152818A1 (en) | 2021-01-13 | 2022-07-21 | Viroxis | Measles-hiv or measles-htlv vaccine |
Also Published As
Publication number | Publication date |
---|---|
BR112014013704B1 (pt) | 2023-01-31 |
EP2788372A1 (en) | 2014-10-15 |
IL232926B (en) | 2019-01-31 |
CA2856180A1 (en) | 2013-06-13 |
RU2014127521A (ru) | 2016-02-10 |
BR112014013704A2 (pt) | 2021-02-17 |
JP2018150370A (ja) | 2018-09-27 |
KR20140116091A (ko) | 2014-10-01 |
IL232926A0 (en) | 2014-07-31 |
AU2012350258A1 (en) | 2014-06-05 |
AU2012350258A8 (en) | 2014-07-17 |
CA2856180C (en) | 2022-09-06 |
CN104169295B (zh) | 2020-07-28 |
DK2788372T3 (da) | 2019-10-14 |
RU2654673C2 (ru) | 2018-05-21 |
MX350689B (es) | 2017-09-13 |
JP6415324B2 (ja) | 2018-10-31 |
CN104169295A (zh) | 2014-11-26 |
ZA201403617B (en) | 2015-07-29 |
JP2015505836A (ja) | 2015-02-26 |
US9682137B2 (en) | 2017-06-20 |
IN2014CN04927A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) | 2015-09-18 |
US20140294880A1 (en) | 2014-10-02 |
KR102059918B1 (ko) | 2020-02-11 |
MX2014006744A (es) | 2014-12-08 |
EP2788372B1 (en) | 2019-07-10 |
AU2012350258B2 (en) | 2017-03-02 |
ES2748864T3 (es) | 2020-03-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7993651B2 (en) | Chimeric human immunodeficiency virus (HIV) immunogens comprising GAG P24-P17 fused to multiple cytotoxic T lymphocyte (CTL) epitopes | |
AU2018283811B2 (en) | Poxvirus vectors encoding HIV antigens, and methods of use thereof | |
Girard et al. | Vaccine-induced protection of chimpanzees against infection by a heterologous human immunodeficiency virus type 1 | |
AU2003298912B2 (en) | Polyvalent, primary HIV-1 glycoprotein DNA vaccines and vaccination methods | |
CA3204201A1 (en) | Measles-hiv or measles-htlv vaccine | |
US9682137B2 (en) | Mutant human and simian immunodeficiency virus ENV proteins with reduced immunosuppressive properties | |
EP3004143B1 (en) | Mutated non-primate lentiviral env proteins and their use as drugs | |
US9636396B2 (en) | Mutant human and simian immunodeficiency virus ENV proteins with reduced immunosuppressive properties | |
WO2015009946A1 (en) | Method of increasing immune response to hiv antigens | |
US20130337009A1 (en) | Chimeric dna vaccine compositions and methods of use | |
US20170107260A1 (en) | Mosaic hiv-1 sequences and uses thereof | |
Warner et al. | Human immunodeficiency virus immunotherapy using a retroviral vector |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12806388 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2856180 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 232926 Country of ref document: IL |
|
ENP | Entry into the national phase |
Ref document number: 2012350258 Country of ref document: AU Date of ref document: 20121207 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14363095 Country of ref document: US Ref document number: MX/A/2014/006744 Country of ref document: MX |
|
ENP | Entry into the national phase |
Ref document number: 2014545294 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 20147018840 Country of ref document: KR Kind code of ref document: A Ref document number: 2014127521 Country of ref document: RU Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112014013704 Country of ref document: BR |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112014013704 Country of ref document: BR Free format text: COM BASE NA RESOLUCAO 81/2013, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, DECLARACAO DE LISTAGEM DE SEQUENCIA ASSINADA, NOS MOLDES DA RESOLUCAO NO 187 DE 27/04/2017, REFERENTE AO CONTEUDO APRESENTADO NA PETICAO NO 860140089110 DE 05/06/2014. |
|
ENP | Entry into the national phase |
Ref document number: 112014013704 Country of ref document: BR Kind code of ref document: A2 Effective date: 20140605 |