WO2013054331A1 - Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) - Google Patents

Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) Download PDF

Info

Publication number
WO2013054331A1
WO2013054331A1 PCT/IL2012/050402 IL2012050402W WO2013054331A1 WO 2013054331 A1 WO2013054331 A1 WO 2013054331A1 IL 2012050402 W IL2012050402 W IL 2012050402W WO 2013054331 A1 WO2013054331 A1 WO 2013054331A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
fragment
monoclonal antibody
set forth
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IL2012/050402
Other languages
French (fr)
Other versions
WO2013054331A8 (en
Inventor
Biotherapeutics Ltd. Ccam
Gal Markel
Tehila Ben Moshe
Yair SAPIR
Ilana MANDEL
Jacob Schachter
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Tel HaShomer Medical Research Infrastructure and Services Ltd
cCAM Biotherapeutics Ltd
Original Assignee
Tel HaShomer Medical Research Infrastructure and Services Ltd
cCAM Biotherapeutics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to RU2014118773A priority Critical patent/RU2650869C2/en
Priority to JP2014535228A priority patent/JP6170926B2/en
Priority to US14/350,970 priority patent/US9771431B2/en
Priority to AU2012322272A priority patent/AU2012322272C1/en
Priority to LTEP12840002.5T priority patent/LT2744829T/en
Priority to EP17200104.2A priority patent/EP3360899B1/en
Priority to PL12840002T priority patent/PL2744829T3/en
Priority to HK15100064.4A priority patent/HK1199646B/en
Priority to KR1020147010511A priority patent/KR102189409B1/en
Priority to BR112014008893-4A priority patent/BR112014008893B1/en
Priority to CA2851762A priority patent/CA2851762C/en
Application filed by Tel HaShomer Medical Research Infrastructure and Services Ltd, cCAM Biotherapeutics Ltd filed Critical Tel HaShomer Medical Research Infrastructure and Services Ltd
Priority to ES12840002.5T priority patent/ES2661488T3/en
Priority to EP12840002.5A priority patent/EP2744829B1/en
Priority to IN873MUN2014 priority patent/IN2014MN00873A/en
Priority to CN201280049869.4A priority patent/CN103987729B/en
Publication of WO2013054331A1 publication Critical patent/WO2013054331A1/en
Priority to IL231931A priority patent/IL231931B/en
Publication of WO2013054331A8 publication Critical patent/WO2013054331A8/en
Anticipated expiration legal-status Critical
Priority to US15/683,087 priority patent/US20170355781A1/en
Priority to US17/037,136 priority patent/US11891453B2/en
Ceased legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39566—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/10—Cellular immunotherapy characterised by the cell type used
    • A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41—Vertebrate antigens
    • A61K40/42—Cancer antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3007—Carcino-embryonic Antigens
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854—Immunoglobulins
    • G01N33/686—Anti-idiotype
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/57—Skin; melanoma
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to therapeutic and diagnostic antibodies, useful in diseases involving Carcinoembryonic Antigen-Related Cell Adhesion Molecule (CEACAM), expression, activation or function.
  • CEACAM Carcinoembryonic Antigen-Related Cell Adhesion Molecule
  • the present invention provides antibodies having specific complementarity determining regions (CDRs) and improved properties over other antibodies which recognize CEACAMl .
  • CEACAMl Carcinoembryonic antigen-related cell adhesion molecule 1
  • BGP biliary glycoprotein
  • CD66a and C-CAM1 are members of the carcinoembryonic antigen family (CEA) that also belongs to the immunoglobulin superfamily.
  • CEACAMl interacts with other known CEACAM proteins, including CD66a (CEACAMl), CD66e (CEACAM6) and CD66e (CEACAM5, CEA) proteins. It is expressed on a wide spectrum of cells, ranging from epithelial cells to those of hemopoietic origin (e.g. immune cells).
  • CEACAMl has been attributed to many different functions. It was shown that the CEACAMl protein is over expressed in some carcinomas of colon, prostate, as well as other types of cancer. Additional data support the central involvement of CEACAMl in angiogenesis and metastasis. CEACAMl also plays a role in the modulation of innate and adaptive immune responses. For example, CEACAMl was shown to be an inhibitory receptor for activated T cells contained within the human intestinal epithelium (W099/52552 and Morales et al. J. Immunol. 1999, 163, 1363-1370). Additional reports have indicated that CEACAMl engagement either by T Cell Receptor cross-linking with Monoclonal antibodies (mAbs) or by Neisseria gonorrhoeae Opa proteins inhibits T cell activation and proliferation.
  • mAbs Monoclonal antibodies
  • Neisseria gonorrhoeae Opa proteins inhibits T cell activation and proliferation.
  • MM pigment-producing cells
  • MM Metastatic melanoma
  • overexpression of CEACAMl can be correlated with poor prognosis and is detected in the majority of metastatic melanoma cases.
  • CEACAMl is rarely expressed by normal melanocytes, but frequently found on melanoma cells.
  • CEACAMl expression on primary cutaneous melanoma lesions strongly predicts the development of metastatic disease with poor prognosis.
  • increased CEACAMl expression was observed on NK cells derived from some patients with metastatic melanoma compared with healthy donors.
  • CEACAMl may have an important role in virus infections.
  • CEACAMl immunostaining is significantly increased in high-grade squamous intraepithelial lesions (SIL) in comparison with low-grade SIL and normal cervical tissues.
  • SIL squamous intraepithelial lesions
  • CEACAMl upregulation may be related to integration of HPV DNA in high- grade SIL and that CEACAMl may be an important biological marker in SIL and cervical cancer progression.
  • CEACAMl plays an important role in various viral infections.
  • CEACAMl over expression may serve as marker of various viral infections.
  • WO2007/063424 and U.S. Patent Application No. 20070110668 disclose methods for regulating the immune system, and in particular methods for the regulation of a specific immune response, including the regulation of lymphocyte activity. These methods comprise both the negative and positive modulation of CEACAMl protein function.
  • U.S. Patent Application No. 20070071758 teaches methods and compositions for enhancing the efficacy of tumor-infiltrating lymphocyte (TIL) therapy in the treatment of cancer by negatively modulating the activity of the CEACAMl protein, such as for example, by using an immunoglobulin specific for CEACAMl .
  • TIL tumor-infiltrating lymphocyte
  • U.S. Patent Application No. 20080108140 discloses methods of modulating specific immune responses to create a protective immunity in the treatment of autoimmune diseases and diseases requiring the transplantation of tissue. In particular, it relates to the suppression of immune responses in a targeted fashion, by increasing the functional concentration of the CEACAMl protein in the target tissue.
  • U.S. Patent Application No. 20040047858 discloses specific antibodies which are capable of modulating T cell activity via CEACAM1 and uses thereof in treating immune response related diseases (e.g. graft versus host disease, autoimmune diseases, cancers etc.).
  • compositions which bind T cell inhibitory receptor molecules and modulate (i.e. enhance or suppress) T cell activity (e.g. cytotoxicity and proliferation), such as biliary glycoprotein binding agents, and methods of using such compositions such as for treatment of diseases (e.g. an autoimmune disease, immunodeficiency, cancer etc.).
  • diseases e.g. an autoimmune disease, immunodeficiency, cancer etc.
  • WO 2010/125571 discloses a murine monoclonal antibody produced by a specific hybridoma cell.
  • the mAb is highly selective to CEACAM1 and does not cross-react with other members of the CEACAM family.
  • the present invention discloses monoclonal antibodies which recognize a specific set of CEACAM subtypes.
  • the antibodies of the invention show binding to CEACAM 1 and at least one additional subtype selected from CEACAM5 and CEACAM3.
  • the antibodies of the invention are characterized by having unique CDR sequence and framework combinations and by binding to newly identified epitopes within the CEACAM 1 molecule.
  • the unique specificity of the monoclonal antibodies of the present invention broaden their therapeutic utility for treatment and diagnosis of additional types of malignancies and viral infections.
  • the present invention also provides methods for identifying and isolating such antibodies, methods for their production, and therapeutic and diagnostic uses thereof.
  • the monoclonal antibodies according to the present invention have specific combinations of CDRs and possess unique properties and improved specificity and potency over known anti CEACAM 1 antibodies.
  • the present invention provides a monoclonal antibody which recognizes CEACAM 1, or an antibody fragment thereof comprising at least an antigen- binding portion thereof, having heavy-chain CDRs comprising sequences set forth in SEQ ID NOs: 1, 2 and 3, and light-chain CDRs comprising sequences set forth in SEQ ID NOs: 4, 5 and 6, and analogs and derivatives thereof.
  • a monoclonal antibody or antibody fragment which recognizes CEACAM1 having a heavy-chain CDR1 comprising a sequence set forth in SEQ ID NO: 1, a heavy-chain CDR2 comprising a sequence set forth in SEQ ID NO: 2 a heavy-chain CDR3 comprising a sequence set forth in SEQ ID NO: 3, a light-chain CDR1 comprising a sequence set forth in SEQ ID NO: 4, a light-chain CDR2 comprising a sequence set forth in SEQ ID NO: 5 and a light-chain CDR3 comprising a sequence set forth in SEQ ID NO:6, and analogs and derivatives thereof.
  • CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 7, 8 and 9.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 13, 14 and 15.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion comprising light chain CDRs having the sequences set forth in SEQ ID NOs: 10, 11 and 12.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs having the sequences set forth in SEQ ID NOs: 16, 17 and 18.
  • a monoclonal antibody having CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
  • a monoclonal antibody having CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
  • Analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the antigen-binding portion of the reference sequence are also within the scope of the present invention.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the antigen-binding portion of the reference sequence are provided.
  • the antibody comprises a heavy chain variable domain sequence having a sequence set forth in SEQ ID NO: 26: QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYW GQGTSVTVSS, or an analog or derivative thereof having at least 97% sequence identity with the heavy chain sequence.
  • the antibody comprises a light chain variable domain sequence having a sequence set forth in SEQ ID NO: 28:
  • the antibody or fragment thereof comprises a heavy chain variable domain having a sequence set forth in SEQ ID NO: 26 and a light chain variable domain having a sequence set forth in SEQ ID NO: 28, or an analog or derivative thereof having at least 97% sequence identity with the antibody or fragment sequence.
  • the present invention encompasses monoclonal antibodies isolated from hybridoma cells or other biological systems, as well as monoclonal antibodies produced recombinantly or synthetically.
  • a monoclonal antibody according to the present invention may contain a constant region from any mammalian species, including but not limited to mouse, rat and human.
  • a monoclonal antibody according to the present invention includes a chimeric antibody, a humanized antibody, a fully human antibody, a xenogeneic antibody, and an antibody fragment comprising at least the antigen-binding portion of an antibody.
  • the antibody fragment is selected from the group consisting of: Fab, Fab', F(ab') 2 , Fd, Fd', Fv, dAb, isolated CDR region, single chain antibody, "diabodies", and "linear antibodies”.
  • the present invention provides a monoclonal antibody, or an antibody fragment comprising:
  • a framework sequence selected from the group consisting of: mouse IgG2a, mouse IgG2b, mouse IgG3, human IgGl, human IgG2, human IgG3; and
  • the monoclonal antibody or fragment thereof binds with an affinity of at least about 5xlO "7 M to at least two CEACAM subtypes. According to other embodiments, the monoclonal antibody or fragment thereof binds with an affinity of at least about 10 "8 M to CEACAMl .
  • the monoclonal antibody is a chimeric monoclonal antibody.
  • the chimeric antibody comprises human-derived constant regions.
  • the human constant regions of the chimeric antibody are selected from the group consisting of: human IgGl, human IgG2, and human IgG3
  • a chimeric or humanized monoclonal antibody which recognizes CEACAMl comprising the six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or the six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 95% sequence identity with said CDR sequences, and a constant region subclass selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO "7 M to at least two CEACAM subtypes.
  • the chimeric or humanized monoclonal antibody or fragment thereof comprises a constant region subclass of human IgGl subtype.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a heavy chain sequence set forth in SEQ ID NO: 30.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a light chain sequence set forth in SEQ ID NO: 31.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion having a heavy chain sequence set forth in SEQ ID NO: 30, and light chain sequence set forth in SEQ ID NO: 31.
  • a monoclonal antibody which recognizes CEACAMl is provided produced from DNA sequences of the heavy and light chains contained in a plasmid deposited on September 28, 2011 under ATCC Accession Number PTA-12130.
  • Monoclonal antibodies of the present invention exhibit according to some embodiments specific binding to more than one CEACAM subtype. According to some embodiments, the monoclonal antibody binds at least two different CEACAM subtypes. According to some specific embodiments the monoclonal antibody binds to CEACAMl and at least one of CEACAM3 and CEACAM5. According to a particular embodiment the monoclonal antibody binds to CEACAMl and CEACAM5. According to another particular embodiment the monoclonal antibody binds to CEACAMl and CEACAM3. According to yet other embodiments, a monoclonal antibody according to the present invention binds to CEACAM subtypes 1, 3 and 5.
  • a monoclonal antibody according to the present invention does not bind to CEACAM4 and CEACAM6.
  • the present invention provides a monoclonal antibody which recognizes CEACAMl, or a fragment thereof comprising at least the antigen-binding portion, which is capable of binding the same epitope on the CEACAMl molecule to which a monoclonal antibody to CEACAMl having a heavy chain sequence set forth in SEQ ID NO: 26 or SEQ ID NO: 30 and a light chain sequence set forth as SEQ ID NO: 28 or SEQ ID NO: 31, binds.
  • the monoclonal antibody is reactive with a epitope within residues 17-29 and 68-79 of human CEACAMl having the sequences VLLLVHNLPQQLF (SEQ ID NO:32) and YPNASLLIQNVT (SEQ ID NO:33) respectively.
  • the epitope on the CEACAMl molecule to which the monoclonal antibody binds is an epitope comprising amino acid residues within the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and YPNASLLIQNVT (SEQ ID NO: 33).
  • the monoclonal antibody according to the invention binds an epitope comprising at least four amino acids of the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
  • the monoclonal antibody according to the invention binds an epitope within sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
  • the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the six CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11 and 12 binds.
  • the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17 and 18 binds. According to a particular embodiment, the monoclonal antibody or fragment thereof binds to the same epitope which is bound by an antibody produced from DNA sequences deposited on September 28, 201 1 under ATCC Accession Number PTA-12130.
  • the present invention provides, according to yet another aspect, an isolated peptide sequence of 6-20 amino acids comprising at least three amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32) and at least three amino acids from the sequence YPNASLLIQNVT (SEQ ID NO: 33). Analogs and derivatives of said peptide, having at least 85%, 90%, 95% or 98%> homology with the parent sequence are also within the scope of the present invention.
  • the isolated peptide comprises at least six amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
  • the isolated peptide comprises the amino acids of the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
  • nucleic acid molecules encoding an antibody or antibody fragment according to the invention, having affinity and specificity for CEACAM1.
  • an isolated polynucleotide sequence encoding an antibody which recognizes CEACAM1 or an antibody fragment thereof is disclosed.
  • the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 25 or analog thereof having at least 90% sequence identity with said DNA sequence. According to other embodiments, the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 27 or analog thereof having at least 90%> sequence identity with said DNA sequence.
  • Plasmids comprising at least one polynucleotide sequence encoding a monoclonal antibody or fragment thereof according to the invention are also disclosed, as well as host cells comprising these plasmids.
  • plasmid comprising polynucleotide sequences set forth in SEQ ID NOs: 25 and 27, deposited on September 28, 201 1 under ATCC Accession Number PTA-12130, is disclosed.
  • the present invention is related to a pharmaceutical composition useful for preventing, attenuating or treating a disease or disorder associated with CEACAM1 , CEACAM3 or CEACAM5 expression, activation or function.
  • a pharmaceutical composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody which recognizes CEACAMl, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding to CEACAMl with a binding affinity of at least 10 ⁇ 8 kD.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 10 ⁇ 8 kD to CEACAMl and with affinity of at least about 5xlO ⁇ 7 M to at least one of CEACAM3 and CEACAM5.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 5x10 ⁇ 7 kD to CEACAMl, CEACAM3 and CEACAM5.
  • CEACAMl, CEACAM3 and/or CEACAM5 expression, activation or function is a cell proliferative disease or disorder.
  • the cell proliferative disease or disorder is cancer.
  • the cancer associated with over-expression of CEACAM5 is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
  • CRC colorectal
  • NSC pancreatic non-small cell lung cancer
  • the cancers associated with over expression of CEACAMl are melanoma, pancreatic cancer, all types of lung cancers and myeloma.
  • the pharmaceutical composition according to the present invention may be administered as a stand alone treatment or in addition to a treatment with any other therapeutic agent.
  • antibodies according to the present invention are administered to a subject in need thereof as part of a treatment regimen in conjunction with at least one anti-cancer agent.
  • the pharmaceutical composition according to the present invention may be administered together with the other agent or separately.
  • the present invention provides diagnostic compositions useful for detecting at least one CEACAM subtype selected from the group consisting if: CEACAMl, CEACAM3 and CEACAM5, in a subject.
  • a diagnostic composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody having affinity of at least about 5x10 ⁇ 7 M to CEACAMl, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and an optional carrier or excipient.
  • the present invention is related to a method of preventing, attenuating or treating a disease or disorder associated with expression, activation or function of CEACAM, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of an antibody to CEACAM; and a pharmaceutically acceptable carrier.
  • the disease or disorder is a cell proliferative disease or disorder.
  • the cell proliferative disease or disorder is cancer.
  • the monoclonal antibody, or fragment thereof has an affinity of at least about 10 "8 M to CEACAM 1 and the cancer is melanoma.
  • the monoclonal antibody, or fragment thereof has an affinity of at least about 5xlO ⁇ 7 M to CEACAM5 and the cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic, non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, myeloma and uterine.
  • CRC colorectal
  • NSC non-small cell lung cancer
  • the disease or disorder associated with over expression of CEACAM 1 is a viral infection.
  • the viral infection is caused by a virus selected from the group consisting of: DNA viruses, such as but not limited to cytomegalovirus (CMV), adenovirus, hepatitis virus and human papillomavirus (HPV); and RNA viruses such as but not limited to influenza virus and human immuno-deficiency virus (HIV).
  • DNA viruses such as but not limited to cytomegalovirus (CMV), adenovirus, hepatitis virus and human papillomavirus (HPV); and RNA viruses such as but not limited to influenza virus and human immuno-deficiency virus (HIV).
  • a method of immunomodulation comprising contacting a CEACAM-expressing lymphocyte with the antibody or antibody fragment.
  • a method of inhibiting migration of a CEACAM expressing tumor cell comprising contacting the CEACAM expressing tumor cell with the antibody or antibody fragment, thereby inhibiting migration of a CEACAM expressing tumor cell.
  • the tumor cell comprises a melanoma tumor cell.
  • a method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the antibody or antibody fragment, thereby treating the cancer in the subject.
  • a method of inhibiting CEACAM homotypic or heterotypic protein-protein interaction comprising contacting a CEACAMl -expressing lymphocyte with the antibody or antibody fragment, thereby inhibiting CEACAMl homotypic or heterotypic protein-protein interaction.
  • the isolated antibody or antibody fragment is attached to a cytotoxic moiety.
  • the cytotoxic moiety comprises a cytotoxin, a chemokine, a chemotherapeutic composition, a pro-apoptotic, an interferon, a radioactive moiety, or combinations thereof.
  • the antibody or antibody fragment is attached to an identifiable moiety.
  • cells of the cancer are characterized by over expression of CEACAMl as compared to unaffected cells.
  • the method of treating cancer further comprises administering to the subject lymphocytes.
  • the lymphocytes comprise T cells or NK cells. According to some embodiments, the lymphocytes express CEACAMl . According to other embodiments, the CEACAMl -expressing lymphocyte is a Tumor Infiltrating Lymphocyte (TIL). According to other embodiments, the CEACAMl -expressing lymphocyte is a cytotoxic T cell.
  • TIL Tumor Infiltrating Lymphocyte
  • the antibody of the present invention can be used to block CEACAM on either or both immune effector cells (CEACAM expressing lymphocytes e.g., tumor infiltrating cells, T cells or NK cells) and target cells (e.g., CEACAM expressing pathological cells such as cancer cells).
  • immune effector cells CEACAM expressing lymphocytes e.g., tumor infiltrating cells, T cells or NK cells
  • target cells e.g., CEACAM expressing pathological cells such as cancer cells.
  • cancer cells which are candidates for this therapy include, but are not limited to, melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cells.
  • a method of rendering a CEACAM expressing tumor cell susceptible to immunomodulation comprising contacting the CEACAM expressing tumor cell (e.g., melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary or endometrial cell) with the antibody or antibody fragment described above, thereby rendering the CEACAM expressing tumor cell susceptible to immunomodulation.
  • the CEACAM expressing tumor cell e.g., melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary or endometrial cell
  • the present invention also envisages a method of immunomodulation (e.g., inhibiting CEACAM 1 homotypic or heterotypic protein-protein interaction), by contacting a CEACAM 1 -expressing lymphocyte with the antibody or antibody fragment described herein.
  • a method of immunomodulation e.g., inhibiting CEACAM 1 homotypic or heterotypic protein-protein interaction
  • the therapeutic or preventive methods of the present teachings can be effected ex- vivo (e.g., used in T cell based adoptive immunotherapy) or in-vivo.
  • Antibodies of some embodiments of the invention can have anti cancer activity which is independent from its immunomodulatory activity described above.
  • the present invention provides a method for increasing the duration or progression of response or survival of a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody which recognizes CEACAM and an anti-neoplastic composition, wherein said anti-neoplastic composition comprises at least one chemotherapeutic agent, whereby the co-administration of the antibody and the anti-neoplastic composition effectively increases the duration or progression of response or survival.
  • the present invention provides a method for treating a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody to CEACAM and an anti-neoplastic composition whereby coadministration of the antibody to CEACAM and the anti-neoplastic composition effectively increases the response incidence in the group of subjects.
  • antibodies of the present invention can also be used in diagnostic applications.
  • a method for diagnosing a cancer in a subject in need thereof comprising contacting a biological sample derived from the subject (in-vivo, in vitro or ex-vivo) with the antibody or antibody fragment described herein, wherein a complex formation beyond a predetermined threshold is indicative of the cancer in the subject.
  • cells of the cancer are characterized by over expression of CEACAM as compared to unaffected cells.
  • the diagnosed cancer is selected from the group consisting of: melanoma, pancreatic cancer, lung cancer and myeloma.
  • the measured protein is CEACAM5 and the diagnosed cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
  • CRC colorectal
  • NSC pancreatic non-small cell lung cancer
  • the method of the invention is affected under conditions sufficient to form an immunocomplex; such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods to optimize such conditions are known to those skilled in the art, and examples are disclosed herein.
  • immunocomplex refers to a complex which comprises the antibody of the invention and the CEACAM. Determining a presence or level of the immunocomplex of the invention may be direct or by detecting an identifiable (detectable) moiety which may be attached to the antibody.
  • the level of the immunocomplex in the tested cell (e.g., a cell of a subject in need thereof) is compared to a predetermined threshold.
  • a predetermined threshold may be determined based on a known reference level and/or a level in a control cell or serum.
  • the control cell can be obtained from a control, healthy subject (e.g., a subject not suffering from the cancer) or from the same subject prior to disease initiation or following treatment.
  • the control subject is of the same species e.g. human, preferably matched with the same age, weight, sex etc. as the subject in need thereof.
  • a method for detecting or quantifying the presence of CEACAM in is provided.
  • the present invention also provides methods for diagnosing conditions associated with CEACAM expression using antibodies which recognizes CEACAM. Diagnostic methods according to the invention may be performed according to specific embodiments, in-vitro or ex-vivo.
  • the antibodies according to the present invention may be also used to configure screening methods.
  • an ELISA assay can be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art.
  • a method for detecting or quantifying the presence of CEACAM comprising the steps of: i. incubating a biological sample with an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion;
  • the biological sample is a body fluid of a mammalian subject.
  • the mammalian subject is human.
  • the antibodies of the present invention may be also used in screening assays for assessing the CEACAM levels in patients and for prediction of the effectiveness of treatment.
  • the screening assays with the antibodies of the present invention may allow determination of the levels of CEACAM and therefore prediction of treatment outcome and planning of an appropriate treatment regimen.
  • the level of at least one of CEACAM 1, CEACAM3 and CEACAM5 is assessed. According to a particular embodiment the level of CEACAM 1 is assessed.
  • the antibody or antibody fragment is attached to an identifiable moiety.
  • the identifiable moiety can be a member of a binding pair, which is identifiable via its interaction with an additional member of the binding pair and a label which is directly visualized.
  • the member of the binding pair is an antigen which is identified by a corresponding labeled antibody.
  • the label is a fluorescent protein or an enzyme producing a colorimetric reaction.
  • Another aspect of the present invention relates to the use of an antibody to CEACAM or an antibody fragment thereof, for diagnosis or treatment of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
  • the cell proliferative disease is melanoma.
  • the cell proliferative disease or disorder is a cancer selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non- small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, uterine, and myeloma.
  • CRC colorectal
  • NSC pancreatic non- small cell lung cancer
  • breast thyroid
  • stomach ovarian
  • uterine myeloma
  • the present invention provides use of an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion, for preparation of a medicament for treatment of a disorder or disease associated with expression or activation of, including but not limited to cancer and viral infection.
  • the invention also relates to use of an antibody to CEACAM or an antibody fragment thereof, for the manufacture of a diagnostic composition for the diagnosis of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
  • CEACAM 1 Essentially all of the uses known or envisioned in the prior art for CEACAM 1, CEACAM3 and CEACAM5 antibodies can be accomplished with the antibodies of the present invention which are shown to posses improved affinity toward these proteins and superior inhibitory and in indirect immunomodulatory effects on CEACAM 1 bearing cells. These uses include diagnostic, prophylactic and therapeutic techniques.
  • Figure 1 is an SDS-PAGE image showing light and heavy chains of the chimeric antibody CM10.
  • Figure 2 shows specific binding curve of CM 10 to purified hCEACAMl .
  • Figure 3 demonstrates specific binding of CM 10 to CEACAM 1 as detected by Flow Cytometry analysis.
  • Figure 4 confirms that CM 10 blocks CEACAM 1 -CEACAM 1 interaction between cells.
  • Mouse IL-2 secretion of effectors cells (BW/221 cells expressing CEACAM 1) incubated in the presence of various CM 10 concentrations, was measured by ELISA.
  • Figure 5 shows CM 10 enhancement of the specific killing activity of CEACAMl -positive melanoma cells.
  • FIG. 6 demonstrates that CM 10 stimulates the killing activity of tumor-infiltrating lymphocyte (TILs).
  • TILs tumor-infiltrating lymphocyte
  • Figure 7 demonstrates that CM 10 enhances the killing activity of NK cells on CEACAMl positive melanoma cell lines.
  • CM 10 immunomodulatory effect inhibits tumor growth in- vivo. Arrows indicate time of administration (CM10 cyrcles, TIL triangles, CM10 and TIL open squares).
  • Figure 9 is a schematic presentation of CM 10 immunomodulatory mode of action.
  • Figure 10 represents CEACAMl binding intensity level in tumors as determined by anti CEACAMl antibody.
  • Figure 11 shows quantification of CM 10 molecules bound per cell.
  • Figure 12 confirms that CM 10 has no effect on PBMC Proliferation. Results represent average proliferation rates from three donors for each treatment.
  • Figure 13 presents FACS analysis of binding between CM 10 to CEACAM family proteins.
  • CEACAMl, 5, 6 and 8 were expressed by 721.221 cells, and CEACAM3 and 4 by HEK293T cells.
  • Figure 14 represents results of complement-dependent cytotoxicity (CDC) assay in melanoma cell lines.
  • Fig 15 demonstrates that CM 10 enhances granzyme B secretion of TIL in the presence of CEACAMl and HLA-A2 positive melanoma cells.
  • Fig 16 shows that CM 10 blocks CEACAM 1-CE AC AM5 interactions.
  • Fig 17 presents CM10 enhancement of HLA restricted T cell killing.
  • Fig 18 demonstrates the immunomodulatory activity of CM 10 inhibits tumor growth in- vivo.
  • Fig 20 demonstrates that CM 10 enhances granzyme B secretion of NK cells in the presence of CEACAMl -positive pancreatic cancer cell lines.
  • the present invention provides antibodies which recognize CEACAMl comprising specific sets of CDR sequences which possess improved and unique specificity, selectivity, affinity and/or activity.
  • Antibodies according to the present invention bind CEACAM1 with higher affinity than other anti-CEACAMl antibodies, they blocks the function of CEACAM1, while not all anti CEACAM antibodies do, and more efficiently than polyclonal anti CEACAM antibodies.
  • antibodies according to the present invention are effective against cancer cells, in particular melanoma cells: the antibodies render melanoma cells more susceptible to lymphocytes, inhibit melanoma growth rate in vivo, an effect which is enhanced when the antibody is combined with adoptive T cell transfer in vivo.
  • the in vivo anti-melanoma effect of anti- CEACAMl antibodies according to the invention is a combined direct anti-tumor effect as well as immunomodulatory effect rendering the cells more susceptible to reactive lymphocytes.
  • An antibody according to the present invention fragments and derivatives can be used as an effective tool for diagnosis, immunomodulation and cancer treatment.
  • the antibody inhibits CEACAM 1 homophilic interactions, as determined by co- incubation of immune effector cells and target cells expressing CEACAM 1 and assaying IL-2 secretion and by the in vitro killing assays.
  • the antibody of the present invention is shown to enhances CM 10 enhances HLA restricted T cell killing and to enhance granzyme B (a serine protease involves in mediation apoptosis of the target cells) secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody. It is also inhibits the binding between CEACAM 1 to CEACAM5 in a dose- dependent manner therefore can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM 1-CEACAM5 axis in order to suppress the immune cells.
  • an antibody according to the invention is effective in inhibiting melanoma cells invasion. Furthermore, in vivo administration of an antibody according to the invention, either alone or in combination with reactive lymphocytes was shown effective in inhibiting growth of melanoma tumors. The combination of adoptive human T cell transfer with monoclonal antibody injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group.
  • isolated antibody or antibody fragment having the same binding specificity and selectivity to an antibody defined herein comprising an antigen recognition domain having specific CDR segments described above.
  • isolated antibody or antibody fragment is capable of binding the same epitope determinant of the CEACAM1 protein as does the antibody described above by its specific CDR segments sequences.
  • Monoclonal antibodies can be designed to selectively target tumor cells and elicit a variety of responses once bound. These agents can destruct tumor cells in different ways such as blocking tumor cell proliferation or activating the immune system.
  • Chimeric monoclonal antibodies according to the present invention were designed to specifically bind and neutralize various functions of the CEACAM1 protein and other CEACAM subtype proteins, and to induce the specific death of tumor cells. Without wishing to be bound to any theory, it is suggested that monoclonal antibodies according to the present invention act also via activation of the immune system against cancerous cells.
  • CEACAM 1 is not found on normal melanocytes, but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens. It has been previously demonstrated mechanistically that CEACAM 1 protects melanoma cells by inhibiting effector functions of NK cells and T cells.
  • CM 10 is a chimeric monoclonal antibody which binds with high affinity to human CEACAM 1.
  • CM 10 efficiently blocked CEACAM 1-homophilic interactions in a dose dependent manner and improves CEACAM 1 positive melanoma cells killing by T cells and NK cells.
  • CM 10 significantly inhibited the in- vivo growth of melanoma xenografts when administered systemically along with melanoma-reactive human T lymphocytes (tumor-infiltrating lymphocytes, TILs). Without wishing to be bound to any theory, this is in line with the suggested mechanism of action; abrogation of immune-protective interactions of the tumor cells with the activated lymphocytes.
  • CEACAM 1 is expressed by a wide variety of epithelial cells, including colon, prostate, breast, kidney etc. Extensive examination of CEACAM 1 expression profile on normal and malignant tissues by IHC have been performed. The expression analysis showed a strong staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in restricted sites of several organs. When more quantitative method was used to quantify the number of CM 10 mAb molecules bound to malignant and normal primary cells, very low CM 10 molecules could be detected in normal cells, which may indicate that CM10 binds mostly to patient's tumor cells. Furthermore it is shown that CM 10 has no effect on primary cells proliferation and is completely or almost completely, unable to induce CDC or ADCC indicating the potential safety of the monoclonal antibody in human subjects.
  • CM 10 has an immunomodulation activity, possible immune-related side effects, are evaluated. Following PBMC activation, CEACAM1 is upregulated on the activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46). Ex-vivo human PBMC proliferation assay revealed that CM 10 has no effect on naive and activated PBMC proliferative response.
  • CEACAM1 blockade over abrogation of generalized inhibitory mechanisms is the expected selectivity to the vicinity of the tumor and therefore fewer adverse events compare to other general immune toxicity agents.
  • CM 10 shows encouraging activity and safety profile and is a promising candidate for cancer immunotherapy and can be used as a strategy to selectively enhance the anti-tumor properties of the endogenous immune response in several malignancies, such as melanoma and non-small cell lung cancer.
  • binding to additional CEACAM subtypes increases the therapeutic profile of the antibody, thus it can be used for diagnosis and treatment of other types of malignancies which do not extensively express CEACAM 1 but express CEACAM5, for example.
  • CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70%> of non-small cell lung cancer cells and 50% of breast cancers. It is also over-expressed in thyroid, stomach, ovarian and uterine cancers (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30).
  • CM 10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM 10 from 4-5 types of malignancies to above 10.
  • the anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies. It seems that even these toxic conjugated forms don't show safety problems, which can indicate that CEACAM5 is a safe target.
  • the human counterparts of murine IgG subclasses are based on similarities in biological and functional activities.
  • Murine IgG2a and IgG2b and human IgGl and IgG3 share the ability to fix complement and bind to protein antigens (Hussain et al., 1995, Clinical and Diagnostic Laboratory Immunology 726-732).
  • Murine IgGl and human IgG4 are considered to be similar because of their property of binding to mast cells.
  • Human IgG4 is the only human IgG subclass which does not activate complement and the subclasses IgGl and 3 are the most effective in activating complements. For mouse it is the subclasses IgG2a and IgG2b which are active with IgGl and possibly IgG3 being inactive (Clark MR., Chem Immunol. 1997;65:88-110).
  • chimeric monoclonal antibodies which recognize CEACAM1 are of subtype mouse IgGl .
  • human equivalent of mouse IgGl is IgG4 it would be expected to create a chimeric antibody comprising the human IgG4 constant framework.
  • chimeric monoclonal antibodies comprise a human IgGl constant framework.
  • the present invention provides a monoclonal antibody which recognizes CEACAM1, or an antibody fragment comprising at least an antigen-binding portion thereof, comprising at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof.
  • analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the sequence of the reference sequence are disclosed.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the reference sequence are disclosed.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 98% sequence identity with the CDR sequence of the reference antibody are disclosed.
  • the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least one heavy-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 21, and at least one light-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody binding site of the antibody or fragment thereof consists of three heavy chain CDRs selected from the group consisting of SEQ ID NOs: 7, 8, 9, 13, 14 and 15 and three light chain CDRs selected from the group consisting of SEQ ID NOs: 10, 11, 12, 16, 17, 18, and analogs and derivatives thereof having at least 97% sequence identity with the antibody binding site.
  • the antibody binding site consists of the six CDRs of SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
  • the antibody binding site consists of the six CDRs of SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
  • the heavy chain CDR1 of the antibody according to the invention or a fragment thereof is selected from NNLIE (SEQ ID NO: 7) and GYAFTNNL (SEQ ID NO: 13).
  • the heavy chain CDR2 of the antibody according to the invention or a fragment thereof is selected from VINPGSGDTNYNEKFKG (SEQ ID NO: 8) and INPGSGDT (SEQ ID NO: 14).
  • the heavy chain CDR3 of the antibody according to the invention or a fragment thereof is selected from GDYYGGFAVDY (SEQ ID NO: 9) and ARGDYYGGFAVDY (SEQ ID NO: 15).
  • the light chain CDR1 of the antibody according to the invention or a fragment thereof is selected from RTSQDIGNYLN (SEQ ID NO: 10) and QDIGNY (SEQ ID NO: 16).
  • the light chain CDR2 of the antibody according to the invention or a fragment thereof is selected from YTSRLHS (SEQ ID NO: 11) and YTS (SEQ ID NO: 17).
  • the light chain CDR3 of the antibody according to the invention or a fragment thereof is selected from QQGKSLP (SEQ ID NO: 12) and QQGKSLPRT (SEQ ID NO: 18).
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 7, 8 and 9.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 13, 14 and 15.
  • CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 10, 11 and 12.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 16, 17 and 18.
  • the antibody or fragment thereof comprises a heavy chain variable domain sequence consisting of the of SEQ ID NO: 26 and a light chain variable domain sequence consisting of SEQ ID NO: 28, or an analog or derivative thereof having at least 90% sequence identity with the antibody or fragment sequence.
  • the present invention provides a monoclonal antibody, or an antibody fragment comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, and a framework sequence selected from mouse IgG2a, mouse IgG2b, mouse IgG3, human IgGl, human IgG2, human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric monoclonal antibody which recognizes CEACAM 1 comprising at least one CDR sequence selected from the group consisting of: SEQ ID NOs: 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, and 18; and analogs and derivatives thereof having at least 97%> sequence identity with said CDR sequences, and a constant region sequence selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric or humanized monoclonal antibody which recognizes CEACAM 1 comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97%> sequence identity with said CDR sequences, and a constant region subclass selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a heavy chain sequence according to SEQ ID NO: 30.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a light chain sequence according to SEQ ID NO: 31.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a human IgGl heavy chain sequence according to SEQ ID NO: 30, and a human IgGl light chain sequence according to SEQ ID NO: 31.
  • CEACAMl is used to refer to the protein product of the CEACAMl gene e.g., NP 001020083.1, NP 001703.2. In humans, 11 different CEACAMl splice variants have been detected so far. Individual CEACAMl isoforms differ with respect to the number of extracellular immunoglobulin-like domains (for example, CEACAMl with four extracellular immunoglobulin-like domains is known as CEACAMl -4), membrane anchorage and/or the length of their cytoplasmic tail (for example, CEACAMl -4 with a long cytoplasmic tail is known as CEACAMl -4L and CEACAMl -4 with a short cytoplasmic tail is known as CEACAMl -4S).
  • the N-terminal domain of CEACAMl starts immediately after the signal peptide and its structure is regarded as IgV-type.
  • the N-terminal IgV-type domain is comprised of 108 amino acids, from amino acid 35 to 142. This domain was identified as responsible for the homophilic binding activity (Watt et al, 2001, Blood. 98, 1469-79). All variants, including these splice variants are included within the term "CEACAMl".
  • an “anti-CEACAMl antibody”, “an antibody which recognizes CEACAMl”, “an antibody against CEACAMl”, or “an antibody to CEACAMl” is an antibody that binds to the CEACAMl protein with sufficient affinity and specificity.
  • an antibody according to the present teachings is capable of binding CEACAMl with a minimal affinity of about 10 "8 or 10 "9 M.
  • Some of the monoclonal antibodies of the present invention are capable of binding CEACAM3, 5 and/or 8 with a minimal affinity of about 5x10 ⁇ 7 M.
  • the anti-CEACAMl antibody of the invention can be used as a diagnostic or therapeutic agent in targeting and interfering with diseases or conditions wherein the CEACAMl expression or activity is involved.
  • an "antigen” is a molecule or a portion of a molecule capable of eliciting antibody formation and being bound by an antibody.
  • An antigen may have one or more than one epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which may be evoked by other antigens.
  • An antigen according to the present invention is a CEACAMl protein or a fragment thereof.
  • antigenic determinant or "epitope” according to the invention refers to the region of an antigen molecule that specifically reacts with particular antibody.
  • Peptide sequences derived from an epitope can be used, alone or in conjunction with a carrier moiety, applying methods known in the art, to immunize animals and to produce additional polyclonal or monoclonal antibodies. Isolated peptides derived from an epitope may be used in diagnostic methods to detect antibodies and as therapeutic agents when inhibition of said antibodies is required.
  • Antibodies, or immunoglobulins comprise two heavy chains linked together by disulfide bonds and two light chains, each light chain being linked to a respective heavy chain by disulfide bonds in a "Y" shaped configuration.
  • Proteolytic digestion of an antibody yields Fv (Fragment variable) and Fc (fragment crystalline) domains.
  • the antigen binding domains, Fab include regions where the polypeptide sequence varies.
  • F(ab') 2 represents two Fab' arms linked together by disulfide bonds.
  • the central axis of the antibody is termed the Fc fragment.
  • Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains (C R ).
  • Each light chain has a variable domain (V L ) at one end and a constant domain (C L ) at its other end, the light chain variable domain being aligned with the variable domain of the heavy chain and the light chain constant domain being aligned with the first constant domain of the heavy chain (CHI).
  • the variable domains of each pair of light and heavy chains form the antigen-binding site.
  • the domains on the light and heavy chains have the same general structure and each domain comprises four framework regions, whose sequences are relatively conserved, joined by three hypervariable domains known as complementarity determining regions (CDRl-3). These domains contribute specificity and affinity of the antigen-binding site.
  • the isotype of the heavy chain determines immunoglobulin class (IgG, IgA, IgD, IgE or IgM, respectively).
  • the light chain is either of two isotypes (kappa, ⁇ or lambda, ⁇ ) found in all antibody classes.
  • antibody is used in the broadest sense and includes monoclonal antibodies (including full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
  • the antibody according to the present invention is a molecule comprising at least the antigen-binding portion of an antibody.
  • Antibody or antibodies according to the invention include intact antibodies, such as polyclonal antibodies or monoclonal antibodies (mAbs), as well as proteolytic fragments thereof such as the Fab or F(ab') 2 fragments. Further included within the scope of the invention are chimeric antibodies; human and humanized antibodies; recombinant and engineered antibodies, and fragments thereof. Furthermore, the DNA encoding the variable region of the antibody can be inserted into the DNA encoding other antibodies to produce chimeric antibodies. Single chain antibodies also fall within the scope of the present invention.
  • Antibody fragments comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen.
  • Examples of antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CHI domains; (ii) the Fab' fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CHI domain; (iii) the Fd fragment having VH and CHI domains; (iv) the Fd' fragment having VH and CHI domains and one or more cysteine residues at the C-terminus of the CHI domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al, Nature 1989, 341, 544-546) which consists of a VH domain; (vii) isolated CDR regions; (viii) F(ab') 2 fragments, a bi
  • Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain i.e. linked V H -V L or single chain Fv (scFv).
  • neutralizing antibody refers to a molecule having an antigen- binding site to a specific receptor or ligand target capable of reducing or inhibiting (blocking) activity or signaling through a receptor, as determined by in vivo or in vitro assays, as per the specification.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” is not to be construed as requiring production of the antibody by any particular method. mAbs may be obtained by methods known to those skilled in the art.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al, Nature 1975, 256, 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al, Nature 1991, 352, 624-628 or Marks et al, J. Mol. Biol, 1991, 222:581- 597, for example.
  • the mAbs of the present invention may be of any immunoglobulin class including IgG, IgM, IgE, IgA.
  • a hybridoma producing a mAb may be cultivated in vitro or in vivo.
  • High titers of mAbs can be obtained in vivo production where cells from the individual hybridomas are injected intraperitoneally into pristine-primed Balb/c mice to produce ascites fluid containing high concentrations of the desired mAbs.
  • mAbs of isotype IgM or IgG may be purified from such ascites fluids, or from culture supernatants, using column chromatography methods well known to those of skill in the art.
  • the monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA 57:6851-6855 (1984)).
  • complementarity determining region (CDR) grafting may be performed to alter certain properties of the antibody molecule including affinity or specificity.
  • CDR complementarity determining region
  • Chimeric antibodies are molecules, the different portions of which are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region.
  • Antibodies which have variable region framework residues substantially from human antibody (termed an acceptor antibody) and complementarity determining regions substantially from a mouse antibody (termed a donor antibody) are also referred to as humanized antibodies.
  • Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non- human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • human antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al. Nature Biotechnology 1996 14,309-314; Sheets et al. PNAS (USA), 1998, 95, 6157-6162); Hoogenboom and Winter, J. Mol. Biol, 1991, 227, 381; Marks et al, J. Mol.
  • Human antibodies can also be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos.
  • the human antibody may be prepared via immortalization of human B lymphocytes producing an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or may have been immunized in vitro). See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al, J. Immunol, 147 (l):86-95 (1991); and U.S. Pat No. 5,750,373.
  • single chain variable fragment scFv
  • Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain (linked V H -V L or single chain Fv (scFv)).
  • V H and V L may copy natural monoclonal antibody sequences or one or both of the chains may comprise a CDR-FR construct of the type described in US patent 5,091,513, the entire contents of which are incorporated herein by reference.
  • a "molecule having the antigen-binding portion of an antibody” as used herein is intended to include not only intact immunoglobulin molecules of any isotype and generated by any animal cell line or microorganism, but also the antigen-binding reactive fraction thereof, including, but not limited to, the Fab fragment, the Fab' fragment, the F(ab') 2 fragment, the variable portion of the heavy and/or light chains thereof, Fab mini-antibodies (see WO 93/15210, US patent application 08/256,790, WO 96/13583, US patent application 08/817,788, WO 96/37621, US patent application 08/999,554, the entire contents of which are incorporated herein by reference), dimeric bispecific mini-antibodies (see Muller et al., 1998) and chimeric or single-chain antibodies incorporating such reactive fraction, as well as any other type of molecule or cell in which such antibody reactive fraction has been physically inserted, such as a chimeric T-cell receptor or a T-cell having such
  • Antibodies according to the invention can be obtained by administering CEACAM1, or epitope-bearing fragments, analogs, or cells expressing, to an animal, preferably a nonhuman, using routine protocols.
  • any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. Examples include various techniques, such as those in Kohler, G. and Milstein, C, Nature 256: 495-497 (1975); Kozbor et al, Immunology Today 4: 72 (1983); Cole et al, pg. 77-96 in MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc. (1985).
  • antibodies can be generated in vitro using phage display technology.
  • Such a production of recombinant antibodies is much faster compared to conventional antibody production and they can be generated against an enormous number of antigens.
  • many antigens prove to be non-immunogenic or extremely toxic, and therefore cannot be used to generate antibodies in animals.
  • affinity maturation i.e., increasing the affinity and specificity
  • large numbers of different antibodies against a specific antigen can be generated in one selection procedure.
  • To generate recombinant monoclonal antibodies one can use various methods all based on display libraries to generate a large pool of antibodies with different antigen recognition sites.
  • Such a library can be made in several ways: One can generate a synthetic repertoire by cloning synthetic CDR3 regions in a pool of heavy chain germline genes and thus generating a large antibody repertoire, from which recombinant antibody fragments with various specificities can be selected.
  • Non-human antibodies may be humanized by any methods known in the art.
  • the non-human complementarity determining regions are inserted into a human antibody or consensus antibody framework sequence. Further changes can then be introduced into the antibody framework to modulate affinity or immunogenicity.
  • US Patent 5,585,089 of Queen et al. discloses a humanized immunoglobulin and methods of preparing same, wherein the humanized immunoglobulin comprises complementarity determining regions (CDRs) from a donor immunoglobulin and heavy and light chain variable region frameworks from human acceptor immunoglobulin heavy and light chains, wherein said humanized immunoglobulin comprises amino acids from the donor immunoglobulin framework outside the Kabat and Chothia CDRs, wherein the donor amino acids replace corresponding amino acids in the acceptor immunoglobulin heavy or light chain frameworks.
  • CDRs complementarity determining regions
  • US Patent 5,225,539, of Winter also discloses an altered antibody or antigen-binding fragment thereof and methods of preparing same, wherein a variable domain of the antibody or antigen-binding fragment has the framework regions of a first immunoglobulin heavy or light chain variable domain and the complementarity determining regions of a second immunoglobulin heavy or light chain variable domain, wherein said second immunoglobulin heavy or light chain variable domain is different from said first immunoglobulin heavy or light chain variable domain in antigen binding specificity, antigen binding affinity, species, class or subclass.
  • Anti-idiotype antibodies specifically immunoreactive with an antibody of the invention are also comprehended.
  • phage display technology can be utilized to select antibody genes with binding activities towards a polypeptide of the invention either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti-CEACAMl or from libraries (McCafferty, et al, 1990, Nature 348, 552-554; Marks, et al, 1992, Biotechnology 10, 779-783).
  • the affinity of these antibodies can also be improved by, for example, chain shuffling (Clackson et al., 1991, Nature 352:628).
  • the above-described antibodies can be employed to isolate or to identify clones expressing the polypeptides to purify the polypeptides by, for example, affinity chromatography.
  • the invention also provides conservative amino acid variants of the antibody molecules according to the invention.
  • Variants according to the invention also may be made that conserve the overall molecular structure of the encoded proteins. Given the properties of the individual amino acids comprising the disclosed protein products, some rational substitutions will be recognized by the skilled worker. Amino acid substitutions, i.e. "conservative substitutions,” may be made, for instance, on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
  • a “disorder” is any condition that would benefit from treatment with the antibody. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
  • disorders to be treated herein include benign and malignant tumors; leukemias and lymphoid malignancies; neuronal, glial, astrocytal, hypothalamic and other glandular, macrophagal, epithelial, stromal and blastocoelic disorders; and inflammatory, angiogenic, immunologic disorders or hyperpermeability states.
  • the term "therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal.
  • the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
  • the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
  • efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), the response rates (RR), duration of response, and/or quality of life.
  • Treatment refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented.
  • cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cancer.
  • the antibody of the present invention is attached to a cytotoxic or therapeutic moiety.
  • the cytotoxic or therapeutic moiety can be, for example, a cytotoxic moiety, a toxic moiety, a cytokine moiety, a bi-specific antibody moiety, a cytotoxin, a chemokine, a chemotherapy, a pro-apoptotic, interferon, a radioactive moiety, or combinations thereof, examples of which are provided infra.
  • anti-neoplastic composition refers to a composition useful in treating cancer comprising at least one active therapeutic agent capable of inhibiting or preventing tumor growth or function, and/or causing destruction of tumor cells.
  • Therapeutic agents suitable in an anti-neoplastic composition for treating cancer include, but not limited to, chemotherapeutic agents, radioactive isotopes, toxins, cytokines such as interferons, and antagonistic agents targeting cytokines, cytokine receptors or antigens associated with tumor cells.
  • the therapeutic agent is a chemotherapeutic agent.
  • diagnosis refers to determining presence or absence of a pathology, classifying a pathology or a symptom, determining a severity of the pathology, monitoring pathology progression, forecasting an outcome of a pathology and/or prospects of recovery.
  • the present invention also contemplates pharmaceutical formulations for human medical use, which comprise as the active agent at least one antibody which recognizes CEACAM1, for the manufacture of a therapeutic or diagnostic composition for the treatment, diagnosis or prophylaxis of the conditions variously described herein.
  • the active agent is preferably utilized together with one or more pharmaceutically acceptable carrier(s) and optionally any other therapeutic ingredients.
  • the carrier(s) must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the formulation and not unduly deleterious to the recipient thereof.
  • the active agent is provided in an amount effective to achieve the desired pharmacological effect, as described above, and in a quantity appropriate to achieve the desired daily dose.
  • the molecules of the present invention comprising the antigen binding portion of an antibody or comprising another polypeptide including a peptidomimetic will be suspended in a sterile saline solution for therapeutic uses.
  • the pharmaceutical compositions may alternatively be formulated to control release of active ingredient (molecule comprising the antigen binding portion of an antibody) or to prolong its presence in a patient's system.
  • suitable drug delivery systems include, e.g., implantable drug release systems, hydrogels, hydroxymethylcellulose, microcapsules, liposomes, microemulsions, microspheres, and the like. Controlled release preparations can be prepared through the use of polymers to complex or adsorb the molecule according to the present invention.
  • biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebaric acid.
  • the rate of release of the molecule according to the present invention, i.e., of an antibody or antibody fragment, from such a matrix depends upon the molecular weight of the molecule, the amount of the molecule within the matrix, and the size of dispersed particles.
  • composition of this invention may be administered by any suitable means, such as orally, topically, intranasally, subcutaneously, intramuscularly, intravenously, intra-arterially, intraarticulary, intralesionally or parenterally. Ordinarily, intravenous (i.v.), intraarticular, topical or parenteral administration will be preferred.
  • the therapeutically effective amount of the molecule according to the present invention will depend, inter alia upon the administration schedule, the unit dose of molecule administered, whether the molecule is administered in combination with other therapeutic agents, the immune status and health of the patient, the therapeutic activity of the molecule administered and the judgment of the treating physician.
  • a "therapeutically effective amount” refers to the amount of a molecule required to alleviate one or more symptoms associated with a disorder being treated over a period of time.
  • the daily dosage can generally be between about 0.0 lmg to about 500 mg, preferably about 0.0 lmg to about 50 mg, more preferably about O. lmg to about 10 mg, per kg body weight.
  • the daily dosage can generally be between about 0.00 lmg to about 100 mg, preferably about 0.00 lmg to about 10 mg, more preferably about 0.0 lmg to about 1 mg, per kg body weight.
  • the daily dosage can be administered, for example in regimens typical of 1- 4 individual administration daily.
  • Other preferred methods of administration include intraarticular administration of about 0.0 lmg to about 100 mg per kg body weight.
  • Various considerations in arriving at an effective amount are described, e.g., in Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th ed., Pergamon Press, 1990; and Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., 1990.
  • Suitable dosing regimens of combination chemotherapies are known in the art and described in, for example, Saltz et al. Proc ASCO 1999, 18, 233a and Douillard et al., Lancet 2000, 355, 1041-7.
  • the molecules of the present invention as active ingredients are dissolved, dispersed or admixed in an excipient that is pharmaceutically acceptable and compatible with the active ingredient as is well known.
  • excipients are, for example, water, saline, phosphate buffered saline (PBS), dextrose, glycerol, ethanol, or the like and combinations thereof.
  • PBS phosphate buffered saline
  • dextrose glycerol
  • ethanol ethanol
  • suitable carriers are well known to those skilled in the art.
  • the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents.
  • the pharmaceutical composition according to the present invention may be administered together with an anti-neoplastic composition.
  • the anti-neoplastic composition comprises at least one chemotherapeutic agent.
  • the chemotherapy agent which could be administered together with the antibody according to the present invention, or separately, may comprise any such agent known in the art exhibiting anticancer activity, including but not limited to: mitoxantrone, topoisomerase inhibitors, spindle poison vincas: vinblastine, vincristine, vinorelbine (taxol), paclitaxel, docetaxel; alkylating agents: mechlorethamine, chlorambucil, cyclophosphamide, melphalan, ifosfamide; methotrexate; 6-mercaptopurine; 5-fluorouracil, cytarabine, gemcitabin; podophyllotoxins: etoposide, irinotecan, topotecan, dacarbazin; antibiotics: doxorubicin (a)
  • the chemotherapeutic agent is selected from the group consisting of alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodophyllotoxins, antibiotics, L- asparaginase, topoisomerase inhibitor, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog.
  • the chemotherapeutic agent is selected from the group consisting of 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel and doxetaxel.
  • 5-fluorouracil 5-FU
  • leucovorin LV
  • irenotecan oxaliplatin
  • capecitabine paclitaxel
  • doxetaxel Two or more chemotherapeutic agents can be used in a cocktail to be administered in combination with administration of the anti-CEACAMl antibody.
  • Example 1 Generation and characterization of monoclonal antibodies which recognized CEACAM
  • Monoclonal antibodies that effectively block the CEACAMl homophilic interactions in vitro at nanomolar concentrations were generated by immunizing mice with recombinant human CEACAMl protein.
  • Hybridomas producing the CEACAMl -blocking antibodies were produced and re-cloned several times to yield a stable clone.
  • the DNA and amino acid sequence of one exemplary monoclonal antibody which recognizes CEACAMl was determined by Fusion Antibodies Ltd. mRNA was extracted from the hybridoma cell pellets and total RNA was extracted from the pellets using RNA extraction protocol. RT-PCR-cDNA was created from the RNA by reverse-transcription with an oligo(dT) primer. PCR reactions using variable domain primers were used to amplify both the VH and VL regions of the monoclonal antibody DNA.
  • VH and VL products were cloned into the Invitrogen sequencing vector pCR2.1 and transformed into TOP 10 for positive transfomants. Selected colonies were picked and analyzed through sequencing. The resulted DNA and amino acid sequences determined are:
  • VH Variable heavy chain
  • VL Variable light chain
  • N-terminal sequence analysis of the light chain was performed by the Edman degradation method to verify the N-terminus sequence of the light chain of one of the monoclonal antibodies.
  • the obtained N-terminal sequence was: DIQMTQTTSS (SEQ ID NO: 29), which is in accordance with the N-terminal expected sequence based on the DNA sequence.
  • the CDR segments were identified using two different algorithm methods:
  • Example 4 Design and production of a chimeric monoclonal antibody
  • variable heavy and light chains (SEQ ID NOs 25 and 27) were used to construct a chimeric antibody, comprising the human IgGl isotype constant domains and constant light (CL) human IgKappa domain.
  • the parent monoclonal antibody is mouse IgGl and its human equivalent is IgG4, a human IgGl framework was used to construct some of the chimeric antibodies of the present invention.
  • the DNA sequences for the light chain and heavy chain were synthesized and cloned into the expression vector pFUSION-DHFRl under separate promoters.
  • Suspension CHO cells (Invitrogen, UK) were cultivated at 130rpm, 8% C0 2 , 37°C in Pro CHO 5 serum free medium (Lonza, UK) in 250 and 500ml vented Erlenmeyer flasks (Corning, Netherlands). On the day of transfection, cells were seeded at a density of 2.0 X 106 cells/ml, 2.5g/ml of plasmid DNA (Geneart , Germany) was transfected into the cells using Polyethylenimine (Polysciences Inc, PA, US). Transfected cultures were incubated at 130 rpm, 8% C0 2 , 37°C for 9-10 days. Prior to harvest of the culture supernatants were spinned at 4,000 rpm for 40 minutes.
  • CMIO has the following amino acid sequence of the heavy and light chains:
  • Heavy chain amino acid sequence (without signal peptide):
  • Variable domain is in bold, CDRs according to IMGT are underlined.
  • CM 10 Variable domain is in bold, CDRs according to IMGT are underlined.
  • a plasmid containing the DNA sequences of the heavy and light chains of an exemplary chimeric monoclonal antibody denoted CM 10 was deposited on September 28, 2011 under ATCC Accession Number PTA-12130.
  • Example 5 Affinity characterization of the chimeric monoclonal antibody CM10
  • CM 10 The binding specificity of CM 10 to human CEACAM1 was tested in ELISA assay using purified human CEAC AMI . Indirect ELISA using 23 double dilutions of CM 10 were used to generate specific binding curve. The results shown in Figure 2 represent average O.D. from triplicate ⁇ SE. Similar results were obtain from other ten independent experiments.
  • the chimeric antibody CM 10 was evaluated for CEAC AMI binding by competitive ELISA and by BIAcore analysis.
  • CM 10 was used as tracer at a constant concentration and was competed with increasing concentrations of unlabelled CM 10.
  • the plate was developed with a StrepAvidin- HRP conjugate and the color reaction was developed with TMB as an HRP substrate.
  • the apparent affinity values detected for CM10 were 1.2-1.6 iiM.
  • Each antibody was immobilized onto a single channel of a CM5 sensor chip of Biacore3000 instrument by NHS-EDC coupling chemistry.
  • Recombinant CEAC AMI was flowed at 50 ⁇ /min over the chip in various concentrations (0.19, 0.39, 0.78, 1.56, 3.12, 6.25, 12.5 and 25nM).
  • the running buffer was PBS-ET( lOmM p-buffer pH7.4, 150mM NaCl, 3.4mM EDTA and 0.005% tween 20).
  • the data were analyzed using BIAEvaluation software 3.0 and the KD values of CM 10- CEACAM1 affinity, calculated from three independent experiments were (KD): 4.07- 5.05 iiM (average 4.56 iiM).
  • CM 10 membrane-bound endogenous CEACAM1
  • FACS analysis was performed.
  • Several human melanoma cell lines were screened for hCEACAMl expression while 526mel cell line was used as positive control and 003mel as negative control line.
  • 526mel, 003mel, Malme 3M, Skmel 5 and A375 cell lines were stained with CM 10.
  • Empty histograms represent mAb staining while darker histograms represent background staining. At least 5000 cells were used to analyze CEACAMl expression in each histogram.
  • CM 10 detects membrane-bound endogenous
  • CEACAMl .
  • Malme3M and Skmel5 cell lines showed high expression of CEACAMl while no expression could be detected in A375 melanoma cell-line.
  • the chimerization process was carried out successfully.
  • the chimeric antibody bind CEACAMl in an affinity of 1.4 nM as validated by two different approaches
  • the assay which determines the ability of anti CEACAMl mAb to blocks CEACAMl cell-cell interaction uses murine T cells (BW cells) that are stably transfected with a chimeric molecule composed of the extracelluUar portion of human CEACMAl fused to mouse z-chain (BW/CEACAM1). Engagement of CEACAMl by co-incubation of BW/CEACAM1 cells with B cells stably transfected with CEACAMl (221 /CEACAMl), lead to the secretion of mouse IL-2, mediated by the z-chain.
  • BW cells murine T cells
  • BW/CEACAM1 a chimeric molecule composed of the extracelluUar portion of human CEACMAl fused to mouse z-chain
  • Effectors cells (BW, expressing CEACAMl) were incubated in the presence of CM 10 or PBS for 30 minutes on ice. Following the incubation the effectors cells were co-culture over night with target cell expressing CEACAMl (221+) or negative to CEACAMl (221-). Mouse IL-2 secretion was measured by commercial ELISA. The results shown in Figure 4 represent average IL-2 secretion from duplicate wells. As shown in the figure, upon addition of CM 10, CEACAMl -mediated cell-cell interactions between T and B cells were abolished in a dose- depended manner as indicated by blockage of IL-2 secretion.
  • T cells Killing assay Melanoma-reactive T cells TILs (Tumor Infiltrating
  • Lymphocytes derived from melanoma patients
  • TILs were purchased from ELLA Institute at Shiba medical center and were growth according to the clinical lab protocols.
  • CFSE-labeled melanoma cells (SKmel5) were pre- incubated with CM10 (10 ⁇ g/ml) for 30 minutes on ice. TIL were added for additional 10 hours incubation at 37°C. Percentage of killing was determined by Pi-staining of the CFSE labeled melanoma cells. Effector-to-target ratio was 5: 1.
  • CFSE-labeled melanoma cells were pre -incubated with CM 10 for 30 minutes on ice.
  • TIL were added for additional 5 hours incubation at 37°C. Percentage of killing was determined by Pi-staining of the CFSE labeled melanoma cells. Results represent average of % specific killing from triplicate wells ⁇ SE per treatment. Effector-to-target ratio was 5: 1.
  • NK cells Natural killer cells
  • NK cells are a type of cytotoxic lymphocyte that can destroy malignant cells by releasing small proteins called perforin and granzyme that cause the target cell to die by apoptosis.
  • NK cells can by activated throw several different pathways among them cytokines, FC receptor, and MHC class 1 absence at the target cells.
  • cytokines cytokines, FC receptor, and MHC class 1 absence at the target cells.
  • Several activation and inhibition receptors to various ligands on target cells regulate the final cytoxicity activity of NK cells.
  • NK 92MI cells are IL-2 independent NK cell line that were purchased from the ATCC.
  • NK 92MI were incubated with CM 10 (0 ⁇ g/ml, 1 ⁇ g/ml or 5 ⁇ g/ml) or isotype match control Ab (5 ⁇ g/ml) for 30 minutes at 37°C, target cells expressing CEACAM1 were added for additional 5 hours. Percentage of killing was determined by classical LDH release assay. Results represent average of % cytotoxicity from triplicate wells ⁇ SE per treatment. Effector- to-target ratio was 2.5: 1.
  • CM 10 strongly enhanced the killing activity of NK cells on two melanoma cell lines expressing CEACAM1 (SKMel 5 and G361), compare to PBS or isotype match IgG. Similar results have been demonstrated in two other CEACAM1+ melanoma cell lines and in various effector-to-target (E:T) ratios.
  • ADCC Antibody-Dependent Cell-Mediated Cytotoxicity
  • CM 10 The ability of CM 10 to induce ADCC was examined in comparison to a positive control antibody (Polyclonal Ab anti CEACAM1 that showed ADCC activity in preliminary experiment). Isotype matched antibody served as negative control (hlgGl K). The results indicate that CM 10 do not trigger ADCC in the setting tested.
  • Complement proteins are found in the blood, and their action "complements" the work of antibodies.
  • Complement-dependent cytotoxicity (CDC) is a mechanism of killing cells in which antibody bound to the target cell surface fixes complement, results in assembly of the membrane attack complex that create pores in the target cell membrane and finally lead to cell lyses.
  • CM 10 In order to access the safety profile of CM 10, the ability of CM 10 to induce CDC was examined in two melanoma cell lines (SKmel28 and SKmel5) expressing CEACAM1.
  • Commercial pooled human serum was used as complement proteins source.
  • the commercial monoclonal antibody Rituximab incubated with Daudi cells was used as the assay positive control and commercial IgGlK as isotype match control to CM 10.
  • Melanoma cell lines - SKMEL5 and SKMEL28 or positive control Daudi cells were incubated with CM 10 or Rituxiamab respectively for 1 hour in room temperature followed by the addition of normal human serum at a final concentration of 50% for 2 additional hours in a humidified incubator (37°C, 5% C0 2 ).
  • the purpose of this experiment is to test the direct effect of CM 10 on melanoma cells in-vivo, as well as to evaluate the immunomodulatory effect, which is missing in the xenograft setting.
  • SKMel5 melanoma cells were injected SC (subcutaneous) to SCID-NOD mice and tumor volume was monitored by physical measurements. When the tumor volume reached 100mm A 3, the mice where divided into 5 randomized groups.
  • the TILs were injected either IT (Intra Tumoral) at two different concentrations or IV (Intra Venus) at one concentration (20X10 A 6 per mice) while one group received only one injection and the second group received 2 TIL injections.
  • TIL injection was followed by 5 days of hIL-2 administration.
  • the calibration experiment demonstrated that TIL IV injection has higher effect on tumor size than IT administration.
  • repetitive TIL regime provides better tumor growth inhibition over single injection, as could be predicted from T cells half life. Based on this data, TIL will be administrated every 10 days by IV injections, in future xenograft experiments.
  • mice Human CEACAMl positive SKmel5 melanoma cells were injected SC to SCID-NOD mice. When the tumors reached a volume of approximately 100mm 3 , the mice were randomized to one of the following treatment groups: a) Weekly IV injections of PBS; b) Weekly IV injections of 0.45mg CM10; c) Three IV injection of 20xl0 6 anti-tumor reactive human T cells (TIL) and weekly IV injections of PBS; d) Three IV injections of 20xl0 6 anti- tumor reactive human T cells and weekly IV injections of 0.45mg CM 10. A person blind to the experimental setting measured the tumors volume 2-3 times per week. The results of Figure 8 represent average tumor volume ⁇ SE from 6-10 mice per group.
  • CEACAMl is known as a regulator of lymphocyte activation.
  • CM 10 is an antibody that blocks the interactions between two CEACAMl molecules ( Figure 4) and therefore eliminates the inhibitory signals mediated by CEACAMl, results in stronger cytotoxic lymphocytes activation against tumor cells ( Figures 6 and 7).
  • the in-vivo xenograft result ( Figure 8) reinforce the immunomostimulatory nature of CM 10 and demonstrate significant growth inhibition of tumors in mice treated with CM 10 in the presence of TIL.
  • the scheme presented in Figure 9 demonstrates a non- limitative theory of the mode of action of CM 10 that prevents CEACAMl -CEACAMl interaction enabling activation of killing signals by immune system cells.
  • Example 7 CM10 in-vitro safety assessment
  • CEACAMl expression is increasing during the malignance transformation of melanoma cells. According to the literature CEACAMl is also expressed on normal cells, therefore it is important to map the possible binding sites of CM 10 in the body and to identify if binding of CM 10 to normal cells may lead to any undesired outcome.
  • Tissue micro array containing 100 cases of malignant melanoma (primary, metastasis) and of benign nevi were analyzed for anti CEACAMl binding intensity by standard IHC procedure. Each core of tumor was graded from 0 to +3. As shown in Figure 10, binding intensity of anti- CEACAMl mAb was seen in more than 50% of the melanoma samples and in 65% of metastatic melanoma samples.
  • the multi normal human organ tissue microarray included 33 types of normal organs, each type taken from 3 normal human individuals. The age ranged from 2 - 67 years, 43 specimens were derived females and 57 specimens from males.
  • the following tissues were negative for anti-CEACAMl mAb binding: Cerebrum, cerebellum, ovary, pancreas, parathyroid gland, hypophysis, thyroid gland, tonsil, bone marrow, spleen, thymus, lung, cardiac muscle, stomach, skeletal muscle, skin, peripheral nerves, mesothelium and retina.
  • a cell-specific staining was detected in some organs, mainly on the luminal side of epithelial cells forming ducts or glands in hollow visceral organs such as: brush border of small intestine; some apical colonic glands; Breast ductal epithelium; Liver bile canaliuculi; inner surface of renal tubules; few Endometrial glands ;luminal part of Salivary gland.
  • some low cellular staining was observed in adrenal gland cortex, apical surface of prostatic glands, Lomme cells of testis and single scattered cells in the pancreas. The only cells of the immune system that found positive were neutrophils within capillaries. No staining of lymphocytes was found in tissues and lymphatic organs.
  • weak to moderate positive staining was found in endothelial cells of small blood vessels at selective sites, including: ovary, adrenal gland, kidney, and rarely in pancreas, prostate, hypophysis and endometrium.
  • the IHC analysis showed a strong anti CEACAMl staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in the luminal aspect of epithelial cells of ducts or glands in hollow viscera. This cellular aspect is generally less accessible to an antibody administered via the peripherally blood.
  • CM 10 molecules bound to each cell types were used. Using the kit the MFI (mean florescence intensity) was directly translated to the number of molecules bound per cell.
  • MFI mean florescence intensity
  • CM 10 was conjugated to a PE molecule (RPE LYNX Rapid Conjugation Kits Serotec) according to the manufacture's protocol and was used ( ⁇ g/ml) with the QuantiBRITE PE beads kit (BD) to determine the ABC (antibodies bound per cell) by Flow cytometry.
  • RPE LYNX Rapid Conjugation Kits Serotec a PE molecule
  • BD QuantiBRITE PE beads kit
  • CM 10 Since some positive staining was found in normal tissues the effect of CM 10 on primary cell growth was examined. HUVEC and primary prostate cells were grown according to the ATCC protocols and were monitored for cell proliferation using XTT standard assay. No effect on cell-proliferation could be detected.
  • CEACAMl is absence on normal melanocytes but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens (Figure 10), in other normal organ there is restricted expression of CEACAMl in specific cells within several tissues.
  • Figure 11 A quantitative analysis, measuring the number of CM10 molecules that are bound to cells, revealed a very low numbers of bound-CMlO on normal human primary cell ( Figure 11). These results imply that the majority of CM10 molecule injected to patients will mainly target cancer cells and not normal tissues due to expression differences.
  • CM 10 has no effect on cell proliferation, CDC activity, and negligible or low ADCC activity which suggests that the binding of CM 10 to non-target cells, would not result in unwanted cell outcome.
  • CM 10 is an immunostimulatory antibody that blocks the interaction between two CEACAMl molecules and by doing so mediates stimulation of lymphocytes against malignant cells. It is important to verify that the antibody will not cause unleashed stimulation of the immune system which can cause severe adverse events.
  • CEACAMl In normal lymphocytes there is a neglect expression of CEACAMl on the cell membrane, only following cell activation CEACAMl is mobilized to the membrane, where it rapidly and strongly up-regulated on activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46).
  • no cross reactivity to normal lymphatic tissues Spleen, Thymus, Bone Marrow
  • lymphocytes was observed; nevertheless various in- vitro and ex-vivo immuno-toxicity analyses were performed to help in predicting potential side effects.
  • PBMC peripheral blood mononuclear cells
  • Human PBMC from 3 unrelated donors were isolated and incubated with CM 10 using 3 different concentrations (2 ⁇ g/ml, 20 ⁇ / ⁇ 1 or 200 ⁇ / ⁇ 1) or with a control mAb IgGlK (200 ⁇ / ⁇ 1) for 60 minutes and with eight replicate wells.
  • PHA (1 ⁇ / ⁇ 1) was added to 4 of the assay replicate wells and cells were incubated for 96 hours. 3H-Thymidine incorporation used to assay cell proliferation.
  • Example 8 CM10 selectivity panel.
  • CEA family is encoded by 18 genes and 11 pseudogenes on chromosome 19ql3.2.
  • Several closely related members belong to the CEACAM family (CEACAM 1,3, 4, 5, 6, 7, 8) and are differentially expressed by various human cell types.
  • the CEACAM proteins have been implicated in various adhesion mediated effects that govern the growth and differentiation of normal and cancerous cells (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46).
  • the closely related proteins in the family share a high amino acid similarity that varies from 45% up to 90% similarity between certain members.
  • CM 10 conjugated to a Biotin molecule and Strep-Avidin APC as secondary agent.
  • 721.221 cells expressing CEACAM 1,5,6,8 or HEK 293 T transient expressing CEACAM 3, 4 were stained with biotinylated CM 10 ( ⁇ g/ml) and Strep-Avidin APC as secondary agent.
  • Empty histograms represent mAb staining while red histograms represent background staining.
  • At least 10000 cells were used to analyze CM 10 binding in each histogram.
  • FAB was calculated by dividing the MFI of the stained cells in the MFI of the background staining. The results demonstrated in Figure 13, clearly indicate that CM 10 bind strongly to cells expressing CEACAM 1. Moderate staining was observed in cells expressing CEACAM3 and 5. Weak or neglect binding was demonstrated in cells expressing CEACAM 4, 6, 8.
  • CM 10 is a mAb developed to recognize human CEACAM1, a protein that was found to be associated with cancer, in general, and with Melanoma in particular.
  • the over- expression of CEACAM1 has been identified in a few malignancies among them melanoma, NSCLC, Thyroid cancer and gastric cancer. The evidence indicates that over-expression of CEACAM1 can be correlated with poor prognosis in melanoma and NSCLC patients.
  • CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70%> of non-small cell lung cancer cells and 50% of breast cancers. It is also over-expressed in thyroid, stomach, ovarian and uterine cancers (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30).
  • CM 10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM 10 from 4-5 types of malignancies to above 10.
  • the anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies. It seems that even these toxic conjugated forms don't show safety problems, which can indicate that CEACAM5 is a safe target (Liersch, et al. 2005, J Clin Oncol 23(27), 6763-70; Ychou, et al. 2008, Clin Cancer Res 14(11), 3487-93).
  • none of these agents target the immunological regulation of tumors, which can be targeted by an antibody which can bind both CEACAM1 and CEACAM5, such as CM10.
  • the target molecule was the N-domain of the human CEACAM1 molecule having the sequence:
  • CLIPS Chemically Linked Peptides on Scaffolds
  • a 0.5 mM solution of the T2 CLIPS template 1,3-bis (bromomethyl) benzene is dissolved in ammonium bicarbonate (20 mM, pH 7.9)/acetonitrile (l : l(v/v).
  • ammonium bicarbonate 20 mM, pH 7.9/acetonitrile (l : l(v/v).
  • This solution is added onto the peptide arrays.
  • the CLIPS template will bind to side-chains of two cysteines as present in the solid-phase bound peptides of the peptide-arrays (455 wells plate with 3 ⁇ wells).
  • the peptide arrays are gently shaken in the solution for 30 to 60 minutes while completely covered in solution.
  • the peptide arrays are washed extensively with excess of H 2 0 and sonicated in disrupt-buffer containing 1 percent SDS/0.1 percent beta-mercaptoethanol in PBS (pH 7.2) at 70°C for 30 minutes, followed by sonication in H 2 0 for another 45 minutes.
  • the T3 CLIPS carrying peptides were made in a similar way but with three cysteines.
  • a total number of 3002 peptides was synthesized that includes: CLIPS matrix set combining two different areas of the entire protein wherein native cysteines are replaced by alanines; Linear peptide sets of length 6,10,15,20,25 and 33; Linear peptide sets of length 15, where the middle residue is replaced by alanine; CLIPS conformational loop set of length 15 wherein native cysteines are replaced by alanines; and CLIPS conformational loop set of length 15 with the middle residue replace by alanine wherein native cysteines are replaced by alanines.
  • the binding of antibody to each of the synthesized peptides was tested in a PEPSCAN-based ELISA.
  • the peptide arrays were incubated with primary antibody (CM 10) solution (overnight at 4°C). After washing, the peptide arrays were incubated with a 1/1000 dilution of an antibody peroxidase conjugate for one hour at 25°C. After washing, the peroxidase substrate 2,2'-azino-di-3-ethylbenzthiazoline sulfonate (ABTS) and 2 microliters/milliliter of 3 percent H 2 0 2 were added. After one hour, the color development was measured. The color development was quantified with a charge coupled device (CCD) - camera and an image processing system.
  • CCD charge coupled device
  • the values obtained from the CCD camera range from 0 to 3000 mAU, similar to a standard 96-well plate ELISA-reader.
  • the results are quantified and stored into the Peplab database.
  • the binding values are extracted for analysis using graphical representation of data where the valuses taken by a variable in a two-dimensional map are represented as colors.
  • the core of the epitope of CM10.S91 consists of residues i 7 VLLLVFINLPQQLF 2 9.
  • a secondary binding region was observed on sequence around 68 YP ASLLIQNVT 79 .
  • the discontinuous epitope for CM10.S91 consists of i 7 VLLLVHNLPQQLF 29 (core) together with 68 PNASLLI 75 (support).
  • Example 10 Additional experiments assessing the activity of CM10
  • PD markers are often proximal in a molecular pathway to the drug target and are used to measure the effect of a drug regardless of therapeutic effect.
  • Granzyme B is a serine protease that is released through cytoplasmic granules of cytotoxic T cells (CTLs) and NK cells upon recognition of specific targets. This in turn mediates the apoptosis of the target cells.
  • CTLs cytotoxic T cells
  • CM 10 enhances granzyme B secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody.
  • TIL were incubated with CM 10 (0 ⁇ g/ml, ⁇ g/ml, 5 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control Ab (IPI-Ipilimumab 10 ⁇ g/ml) for 30 minutes at 37°C; Target positive melanoma cells expressing CEACAM1 and HLA-A2 - SKMEL5, were added for an overnight incubation at effector-to-target ratio of 2.5: 1.
  • Granzyme B secretion was measured by ELISA. Results represent the mean + S.E of granzyme B release values from 6 repeats per treatment. Similar results were seen in another independent experiment.
  • TIL secretes low initial levels of granzyme B that remained low in the presence of CM 10 alone. Only when the target cells were added to the TIL, granzyme B elevated dramatically. Yet, CM 10 was able to significantly increase granzyme B secretion above the high initial levels. Similar results were seen when NK92MI cells were used as effector cells demonstrating that CM 10 can enhance granzyme B secretion form NK cells in a similar manner. The use of Granzyme B as PD marker to CM 10 treatment is also examined in complementary set of experiments including in vivo models and patients specimens.
  • CM 10 blocks CE AC AM 1 -CE AC AM5 interactions
  • Carcinoembryonic antigen (CEA, CEACAM5, and CD66e) has been found to be associated with various types of cancers, particularly colorectal carcinoma, as well as gastrointestinal, pancreatic cancers, non-small cell lung cancer ,breast cancers , thyroid, stomach and ovarian cancer.
  • the molecule has been developed to be a target for cancer diagnosis and therapy.
  • I-defective 721.221 cells also suppressed NK-mediated cytotoxicity (Stern et al J Immunol.
  • CE AC AM5 -CE AC AM 1 heterophilic interactions are also able to trigger inhibitory CEACAM1 signaling in immune cells.
  • CEACAM1 positive cell line (SKMel 5) was incubated with an isotype control or CM 10 in various concentrations, unbound CM 10 was washed twice, followed by incubation with or without soluble biotinylated CEACAM5. The binding of the biotinylated CEACAM5 to the cells was detected by a secondary strepavidin-APC and FACS analysis. The results represent the mean of duplicate wells + SE. Similar results were obtained in two other independent experiments.
  • CM 10 can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM1-CEACAM5 axis in order to suppress the immune cells.
  • CM 10 enhances HLA restricted T cell killing
  • Cytotoxic T cells destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. These cells recognize their targets by binding to antigens associated with HLA molecules, which are present on the surface of nearly every cell of the body. The killing of infected or malignant cells requires the recruitment of several pathways in order to generate proper response.
  • CM 10 enhances the "natural" CTL activity which is HLA restricted or alternatively causes a general stimulation of the immune system.
  • TIL were incubated with CM 10 (0 ⁇ g/ml, ⁇ g/ml, 5 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control antibody for 30 minutes at 37°C.
  • Target melanoma cells SKMEL5, expressing CEACAM1 and HLA-A2 were pre -incubated with or without HLA-A2 blocking monoclonal antibody for 1 hour and were added for an overnight incubation at effector-to- target ratio of 2.5: 1. Killing was determined by standard LDH release assay. Results represent the mean + S.E of LDH release values from 3 repeats per treatment.
  • CM 10 will improve the activity of CTLs against malignant cells in vivo and will not facilitate non-specific activation of the immune system.
  • CM 10 The immunomodulatory activity of CM 10 inhibits tumor growth in- vivo
  • human tumor xenograft model One of the most widely used models to assess the in vivo action of a novel anti cancer agents is the human tumor xenograft model.
  • human tumor cells are transplanted under the skin into immunocompromised mice that do not reject human cells.
  • the tumor develops over several weeks, and the response to appropriate therapeutic regimes can be studied in vivo.
  • the advantage of a model that involves treatment in early stages of tumor formation is the opportunity to examine the agent's influence in a setting that can be more similar to metastasis spread in patients and to identify the effect of the treatment on initial tumor implantation.
  • CM 10 immunomodulatory activity of CM 10 in vivo was therefore examined in SCID- NOD mice engrafted with human melanoma cells under prophylactic treatment regime.
  • SCID-NOD mice were randomized according to the five treatment groups indicated in figure 18.
  • 6X10 6 SKmel5 cells (melanoma cell line) were injected SC in Day 0.
  • Mice were treated with antibodies/TIL as indicated in the figure.
  • Arrows indicate time of administration; Thin arrows represent antibodies-0.25mg/mouse/injection (CM 10, IgG control and Ipilimumab control) and wide arrows for TIL (20X10 A 6 cell per mouse per injection).
  • the tumors' volume was blindly measured 2-3 times per week. The results represent average tumor volumes ⁇ SE from 8-9 mice per group.
  • Fig 18 shows that the combination of adoptive human T cell transfer with CM 10 injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group (69% TGI).
  • the results demonstrate that CM 10 also has an effect as a single agent (45% TGI at day 32) and probably worked directly on the tumor cells or the tumors' surroundings by inhibiting proliferation, angiogenesis or through other biological pathways.
  • the tumors' total weight was determined at the experiment termination day.
  • the results obtained support the volume measurements, and show a dramatic decrease in the tumor burden of the TIL+ CM 10 treated group and also statistically significant reduction in the tumors' weight in the CM 10 treated group.
  • CM 10 enhances the immunomodulatory killing activity of NK cells on CEACAM1 -positive pancreatic cancer cell lines
  • CM 10 can enhance the activity of immune cells against pancreatic cancer cell lines. Killing assays were conducted by co-culture of NK92MI cells that were pre-treated with various concentrations of CM 10 with different CEACAM1 positive target pancreatic cancer cell lines. NK 92MI were incubated with CM10 (0 ⁇ g/ml, ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control Ab (10 ⁇ g/ml) for 30 minutes at 37°C; A.
  • Target cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5: 1 (COLO-357) or overnight at an effector- to-target ratio of 5: 1 (BXPC3). Results represent an average of % cytotoxicity ⁇ SE as determined by classical LDH release assay from triplicate wells per treatment.
  • CM 10 enhanced this activity by up to 2 folds from the baseline cytotoxicity (PBS or control Ab). Similar results were seen in additional two lines.
  • CM 10 enhances granzyme B secretion of NK cells in the presence of CEACAM1 -positive pancreatic cancer cell lines
  • CM 10 can enhance the secretion of granzyme B from NK cells in the presence of pancreatic cancer cells.
  • NK cells were pre-treated with various concentrations of CM 10 and then co-cultured with four different target pancreatic cancer cell lines. The supernatants were analyzed for granzyme B content by a specific ELISA.
  • NK 92MI were incubated with CM10 (0 ⁇ g/ml, ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control antibody (10 ⁇ g/ml) for 30 minutes at 37°C.
  • Target pancreatic cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5: 1 A. (COLO- 357 and ASPC-1) and B. (SU8686) or E:T of 10: 1 C. (BXPC3).
  • Granzyme B secretion was measured by ELISA. Results represent the mean j ⁇ S.E of granzyme B release values from 2- 6 repeats per treatment.
  • Figure 20 clearly demonstrates that CM 10 increases granzyme B secretion from NK cells in the presence of pancreatic cancer cells.
  • Example 11 Humanized and Human Antibodies
  • a humanized antibody typically has a human framework grafted with non human CDRs.
  • a humanized antibody has one or more amino acid sequence introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain.
  • Humanization can be essentially performed following the method of Winter and co-workers (Jones et al, Nature, 321 :522-525, 1986; Riechmann et al, Nature, 332:323-327, 1988; Verhoeyen et al, Science, 239: 1534-1536, 1988), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
  • humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • variable domains both light and heavy
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity.
  • the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151 :2296, 1993; Chothia et al., J. Mol. Biol., 196:901, 1987).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285, 1992; Presta et al, J. Immunol, 151 :2623, 1993).
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • transgenic animals e.g., mice
  • transgenic animals e.g., mice
  • JH antibody heavy-chain joining region
  • transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (e.g., Jakobovits et al, Proc. Natl. Acad. Sci.
  • Human antibodies can also be derived from phage-display libraries (Hoogenboom et al., J. Mol. Biol, 227:381, 1991; Marks et al, J. Mol. Biol, 222:581-597, 1991; Vaughan et al. Nature Biotech 14:309, 1996).
  • the antibody fragments can be isolated from the antibody phage libraries discussed above.
  • Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al, Bio/Technology 10: 163-167, 1992).
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • the antibody of choice is a single chain Fv fragment (scFv).
  • scFv single chain Fv fragment
  • the following experiments are used to determine the potential of CM 10 against viral infection.
  • the experiments include different target cells, various virus and several in vivo and in vitro models.
  • Detection/diagnosis Examination of CEACAM expression level in cell lines and primary cells infected with different virus types, by FACS analysis, RT PCR and Immuno- histochemestry.
  • Treatment after viral infection the infected cell are incubated with immune system cell and the killing ability of the effectors cells and the viral load is examined. In addition, the viral load and replication and overall survival are determined in vivo after virus infection and treatment with anti CEACAM antibodies.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Mycology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Virology (AREA)
  • Reproductive Health (AREA)
  • Physical Education & Sports Medicine (AREA)

Abstract

The present invention provides antibodies, as well as molecules having at least the antigen-binding portion of an antibody, recognizing a specific epitope of the protein CEACAM1 and optionally binds also other subtypes of the CEACAM protein family. Disclosed antibodies and antibody fragments are characterized by specific CDR sequences. Methods of production and use in therapy and diagnosis, of such antibodies and antibody fragments are also provided.

Description

ANTIBODIES TO CARCINOEMBRYONIC ANTIGEN-RELATED CELL
ADHESION MOLECULE (CEACAM)
FIELD OF THE INVENTION
The present invention relates to therapeutic and diagnostic antibodies, useful in diseases involving Carcinoembryonic Antigen-Related Cell Adhesion Molecule (CEACAM), expression, activation or function. In particular, the present invention provides antibodies having specific complementarity determining regions (CDRs) and improved properties over other antibodies which recognize CEACAMl .
BACKGROUND OF THE INVENTION
The transmembrane protein Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAMl, also known as biliary glycoprotein (BGP), CD66a and C-CAM1), is a member of the carcinoembryonic antigen family (CEA) that also belongs to the immunoglobulin superfamily. CEACAMl interacts with other known CEACAM proteins, including CD66a (CEACAMl), CD66e (CEACAM6) and CD66e (CEACAM5, CEA) proteins. It is expressed on a wide spectrum of cells, ranging from epithelial cells to those of hemopoietic origin (e.g. immune cells).
Many different functions have been attributed to the CEACAMl protein. It was shown that the CEACAMl protein is over expressed in some carcinomas of colon, prostate, as well as other types of cancer. Additional data support the central involvement of CEACAMl in angiogenesis and metastasis. CEACAMl also plays a role in the modulation of innate and adaptive immune responses. For example, CEACAMl was shown to be an inhibitory receptor for activated T cells contained within the human intestinal epithelium (W099/52552 and Morales et al. J. Immunol. 1999, 163, 1363-1370). Additional reports have indicated that CEACAMl engagement either by T Cell Receptor cross-linking with Monoclonal antibodies (mAbs) or by Neisseria gonorrhoeae Opa proteins inhibits T cell activation and proliferation.
Melanoma is a malignancy of pigment-producing cells (melanocytes), responsible for 75% of skin cancer-related mortality worldwide, mainly due to extensive metastasis. Metastatic melanoma (MM) responds feebly to most anticancer regimens, and mean overall survival mean for patients with MM is 8.5 months. There is evidence that overexpression of CEACAMl can be correlated with poor prognosis and is detected in the majority of metastatic melanoma cases. CEACAMl is rarely expressed by normal melanocytes, but frequently found on melanoma cells. CEACAMl expression on primary cutaneous melanoma lesions strongly predicts the development of metastatic disease with poor prognosis. Moreover, increased CEACAMl expression was observed on NK cells derived from some patients with metastatic melanoma compared with healthy donors.
Evidence indicates that CEACAMl may have an important role in virus infections.
For example, Markel at el. (J. Clinical Investigation 2002, 110, 943-953) demonstrated that lymphocytes isolated from the deciduae of CMV-infected patients express the CEACAMl protein in increased levels. The increased CEACAMl expression on the decidual lymphocytes might diminish the local immune response and serve as another mechanism developed by the virus to avoid recognition and clearance primarily by activated decidual lymphocytes. Albarran-Somoza et al. (Journal of Histochemistry & Cytochemistry 2006, 54, 1393), who studied the protein expression pattern of CEACAMl in cervical cancer and precursor lesions in the context of human papillomavirus (HPV) infection, showed that CEACAMl immunostaining is significantly increased in high-grade squamous intraepithelial lesions (SIL) in comparison with low-grade SIL and normal cervical tissues. The authors suggested that CEACAMl upregulation may be related to integration of HPV DNA in high- grade SIL and that CEACAMl may be an important biological marker in SIL and cervical cancer progression. Altogether this evidence indicates that CEACAMl plays an important role in various viral infections. In addition, CEACAMl over expression may serve as marker of various viral infections.
WO2007/063424 and U.S. Patent Application No. 20070110668 disclose methods for regulating the immune system, and in particular methods for the regulation of a specific immune response, including the regulation of lymphocyte activity. These methods comprise both the negative and positive modulation of CEACAMl protein function.
U.S. Patent Application No. 20070071758 teaches methods and compositions for enhancing the efficacy of tumor-infiltrating lymphocyte (TIL) therapy in the treatment of cancer by negatively modulating the activity of the CEACAMl protein, such as for example, by using an immunoglobulin specific for CEACAMl .
U.S. Patent Application No. 20080108140 discloses methods of modulating specific immune responses to create a protective immunity in the treatment of autoimmune diseases and diseases requiring the transplantation of tissue. In particular, it relates to the suppression of immune responses in a targeted fashion, by increasing the functional concentration of the CEACAMl protein in the target tissue. U.S. Patent Application No. 20040047858 discloses specific antibodies which are capable of modulating T cell activity via CEACAM1 and uses thereof in treating immune response related diseases (e.g. graft versus host disease, autoimmune diseases, cancers etc.).
U.S. Patent Application Nos. 20020028203, 20050169922 and 20080102071 disclose compositions which bind T cell inhibitory receptor molecules and modulate (i.e. enhance or suppress) T cell activity (e.g. cytotoxicity and proliferation), such as biliary glycoprotein binding agents, and methods of using such compositions such as for treatment of diseases (e.g. an autoimmune disease, immunodeficiency, cancer etc.).
WO 2010/125571 to the present inventor discloses a murine monoclonal antibody produced by a specific hybridoma cell. The mAb is highly selective to CEACAM1 and does not cross-react with other members of the CEACAM family.
None of the known antibodies which recognize CEACAM 1 have the spectrum of binding specificity of the monoclonal antibodies of the present invention. Thus, there is an unmet need to provide antibodies recognizing specific subsets of CEACAM proteins which can be used diagnostically and therapeutically in diseases involving CEACAM expression or activation.
SUMMARY OF THE INVENTION
The present invention discloses monoclonal antibodies which recognize a specific set of CEACAM subtypes. Advantageously, the antibodies of the invention show binding to CEACAM 1 and at least one additional subtype selected from CEACAM5 and CEACAM3. The antibodies of the invention are characterized by having unique CDR sequence and framework combinations and by binding to newly identified epitopes within the CEACAM 1 molecule. The unique specificity of the monoclonal antibodies of the present invention, broaden their therapeutic utility for treatment and diagnosis of additional types of malignancies and viral infections. The present invention also provides methods for identifying and isolating such antibodies, methods for their production, and therapeutic and diagnostic uses thereof.
The monoclonal antibodies according to the present invention have specific combinations of CDRs and possess unique properties and improved specificity and potency over known anti CEACAM 1 antibodies.
According to one aspect, the present invention provides a monoclonal antibody which recognizes CEACAM 1, or an antibody fragment thereof comprising at least an antigen- binding portion thereof, having heavy-chain CDRs comprising sequences set forth in SEQ ID NOs: 1, 2 and 3, and light-chain CDRs comprising sequences set forth in SEQ ID NOs: 4, 5 and 6, and analogs and derivatives thereof.
According to some embodiments a monoclonal antibody or antibody fragment which recognizes CEACAM1 is provided having a heavy-chain CDR1 comprising a sequence set forth in SEQ ID NO: 1, a heavy-chain CDR2 comprising a sequence set forth in SEQ ID NO: 2 a heavy-chain CDR3 comprising a sequence set forth in SEQ ID NO: 3, a light-chain CDR1 comprising a sequence set forth in SEQ ID NO: 4, a light-chain CDR2 comprising a sequence set forth in SEQ ID NO: 5 and a light-chain CDR3 comprising a sequence set forth in SEQ ID NO:6, and analogs and derivatives thereof.
According to some embodiments a monoclonal antibody which recognizes
CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 7, 8 and 9.
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 13, 14 and 15.
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, comprising light chain CDRs having the sequences set forth in SEQ ID NOs: 10, 11 and 12.
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs having the sequences set forth in SEQ ID NOs: 16, 17 and 18.
According to other embodiments a monoclonal antibody is provided having CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
According to yet other embodiments, a monoclonal antibody is provided having CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
Analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the antigen-binding portion of the reference sequence are also within the scope of the present invention.
According to some embodiments, analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the antigen-binding portion of the reference sequence are provided. According to a specific embodiment the antibody comprises a heavy chain variable domain sequence having a sequence set forth in SEQ ID NO: 26: QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYW GQGTSVTVSS, or an analog or derivative thereof having at least 97% sequence identity with the heavy chain sequence.
According to yet another embodiment the antibody comprises a light chain variable domain sequence having a sequence set forth in SEQ ID NO: 28:
DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSG VPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK, or an analog or derivative thereof having at least 97% sequence identity with the light chain sequence.
According to a specific embodiment the antibody or fragment thereof comprises a heavy chain variable domain having a sequence set forth in SEQ ID NO: 26 and a light chain variable domain having a sequence set forth in SEQ ID NO: 28, or an analog or derivative thereof having at least 97% sequence identity with the antibody or fragment sequence.
The present invention encompasses monoclonal antibodies isolated from hybridoma cells or other biological systems, as well as monoclonal antibodies produced recombinantly or synthetically. A monoclonal antibody according to the present invention may contain a constant region from any mammalian species, including but not limited to mouse, rat and human. A monoclonal antibody according to the present invention includes a chimeric antibody, a humanized antibody, a fully human antibody, a xenogeneic antibody, and an antibody fragment comprising at least the antigen-binding portion of an antibody. According to a specific embodiment the antibody fragment is selected from the group consisting of: Fab, Fab', F(ab')2, Fd, Fd', Fv, dAb, isolated CDR region, single chain antibody, "diabodies", and "linear antibodies".
According to some particular embodiments the present invention provides a monoclonal antibody, or an antibody fragment comprising:
i. a framework sequence selected from the group consisting of: mouse IgG2a, mouse IgG2b, mouse IgG3, human IgGl, human IgG2, human IgG3; and
ii. a set of six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or a set of six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, wherein the monoclonal antibody or fragment binds with an affinity of at least about 5xlO"7M to at least two CEACAM subtypes.
According to some embodiments, the monoclonal antibody or fragment thereof binds with an affinity of at least about 5xlO"7M to at least two CEACAM subtypes. According to other embodiments, the monoclonal antibody or fragment thereof binds with an affinity of at least about 10"8M to CEACAMl .
According to some specific embodiments, the monoclonal antibody is a chimeric monoclonal antibody.
According to some embodiments, the chimeric antibody comprises human-derived constant regions.
According to some embodiments the human constant regions of the chimeric antibody are selected from the group consisting of: human IgGl, human IgG2, and human IgG3
According to a particular embodiment, a chimeric or humanized monoclonal antibody which recognizes CEACAMl is provided comprising the six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or the six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 95% sequence identity with said CDR sequences, and a constant region subclass selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO"7M to at least two CEACAM subtypes.
According to a specific embodiment the chimeric or humanized monoclonal antibody or fragment thereof, comprises a constant region subclass of human IgGl subtype.
According to another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided comprising a heavy chain sequence set forth in SEQ ID NO: 30.
According to yet another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided comprising a light chain sequence set forth in SEQ ID NO: 31.
According to yet another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided having a heavy chain sequence set forth in SEQ ID NO: 30, and light chain sequence set forth in SEQ ID NO: 31.
According to a particular embodiment, a monoclonal antibody which recognizes CEACAMl is provided produced from DNA sequences of the heavy and light chains contained in a plasmid deposited on September 28, 2011 under ATCC Accession Number PTA-12130.
Monoclonal antibodies of the present invention exhibit according to some embodiments specific binding to more than one CEACAM subtype. According to some embodiments, the monoclonal antibody binds at least two different CEACAM subtypes. According to some specific embodiments the monoclonal antibody binds to CEACAMl and at least one of CEACAM3 and CEACAM5. According to a particular embodiment the monoclonal antibody binds to CEACAMl and CEACAM5. According to another particular embodiment the monoclonal antibody binds to CEACAMl and CEACAM3. According to yet other embodiments, a monoclonal antibody according to the present invention binds to CEACAM subtypes 1, 3 and 5.
According to particular embodiments, a monoclonal antibody according to the present invention does not bind to CEACAM4 and CEACAM6.
According to yet another aspect the present invention provides a monoclonal antibody which recognizes CEACAMl, or a fragment thereof comprising at least the antigen-binding portion, which is capable of binding the same epitope on the CEACAMl molecule to which a monoclonal antibody to CEACAMl having a heavy chain sequence set forth in SEQ ID NO: 26 or SEQ ID NO: 30 and a light chain sequence set forth as SEQ ID NO: 28 or SEQ ID NO: 31, binds.
According to some embodiments, the monoclonal antibody is reactive with a epitope within residues 17-29 and 68-79 of human CEACAMl having the sequences VLLLVHNLPQQLF (SEQ ID NO:32) and YPNASLLIQNVT (SEQ ID NO:33) respectively.
According to some embodiments, the epitope on the CEACAMl molecule to which the monoclonal antibody binds is an epitope comprising amino acid residues within the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and YPNASLLIQNVT (SEQ ID NO: 33).
According to other embodiments, the monoclonal antibody according to the invention binds an epitope comprising at least four amino acids of the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
According to yet other embodiments, the monoclonal antibody according to the invention binds an epitope within sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
According to some embodiments, the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the six CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11 and 12 binds.
According to yet other embodiments, the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17 and 18 binds. According to a particular embodiment, the monoclonal antibody or fragment thereof binds to the same epitope which is bound by an antibody produced from DNA sequences deposited on September 28, 201 1 under ATCC Accession Number PTA-12130.
The present invention provides, according to yet another aspect, an isolated peptide sequence of 6-20 amino acids comprising at least three amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32) and at least three amino acids from the sequence YPNASLLIQNVT (SEQ ID NO: 33). Analogs and derivatives of said peptide, having at least 85%, 90%, 95% or 98%> homology with the parent sequence are also within the scope of the present invention.
According to some embodiments, the isolated peptide comprises at least six amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
According to yet other embodiments, the isolated peptide comprises the amino acids of the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
Use of the isolated peptides for production of monoclonal or polyclonal antibodies is also within the scope of the present invention as well as their use in diagnosis or treatment.
Within the scope of the present invention are also nucleic acid molecules encoding an antibody or antibody fragment according to the invention, having affinity and specificity for CEACAM1.
According to this aspect, an isolated polynucleotide sequence encoding an antibody which recognizes CEACAM1 or an antibody fragment thereof is disclosed.
According to some embodiments, the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 25 or analog thereof having at least 90% sequence identity with said DNA sequence. According to other embodiments, the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 27 or analog thereof having at least 90%> sequence identity with said DNA sequence.
Plasmids comprising at least one polynucleotide sequence encoding a monoclonal antibody or fragment thereof according to the invention are also disclosed, as well as host cells comprising these plasmids.
According to a particular embodiment, a plasmid comprising polynucleotide sequences set forth in SEQ ID NOs: 25 and 27, deposited on September 28, 201 1 under ATCC Accession Number PTA-12130, is disclosed.
In another aspect the present invention is related to a pharmaceutical composition useful for preventing, attenuating or treating a disease or disorder associated with CEACAM1 , CEACAM3 or CEACAM5 expression, activation or function. A pharmaceutical composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody which recognizes CEACAMl, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and a pharmaceutically acceptable carrier.
According to some embodiments, the pharmaceutical composition comprises a monoclonal antibody capable of binding to CEACAMl with a binding affinity of at least 10~8 kD.
According to additional embodiments, the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 10~8 kD to CEACAMl and with affinity of at least about 5xlO~7M to at least one of CEACAM3 and CEACAM5.
According to a particular embodiment, the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 5x10~7 kD to CEACAMl, CEACAM3 and CEACAM5.
According to certain embodiments the disease or disorder associated with
CEACAMl, CEACAM3 and/or CEACAM5 expression, activation or function is a cell proliferative disease or disorder. According to some embodiments the cell proliferative disease or disorder is cancer.
According to some embodiments, the cancer associated with over-expression of CEACAM5 is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
According to a specific embodiment the cancers associated with over expression of CEACAMl are melanoma, pancreatic cancer, all types of lung cancers and myeloma.
The pharmaceutical composition according to the present invention may be administered as a stand alone treatment or in addition to a treatment with any other therapeutic agent. According to a specific embodiment, antibodies according to the present invention are administered to a subject in need thereof as part of a treatment regimen in conjunction with at least one anti-cancer agent. The pharmaceutical composition according to the present invention may be administered together with the other agent or separately.
In another aspect the present invention provides diagnostic compositions useful for detecting at least one CEACAM subtype selected from the group consisting if: CEACAMl, CEACAM3 and CEACAM5, in a subject. A diagnostic composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody having affinity of at least about 5x10~7 M to CEACAMl, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and an optional carrier or excipient.
In yet another aspect the present invention is related to a method of preventing, attenuating or treating a disease or disorder associated with expression, activation or function of CEACAM, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of an antibody to CEACAM; and a pharmaceutically acceptable carrier.
According to some embodiments the disease or disorder is a cell proliferative disease or disorder. According to certain embodiments the cell proliferative disease or disorder is cancer. According to a specific embodiment the monoclonal antibody, or fragment thereof, has an affinity of at least about 10"8M to CEACAM 1 and the cancer is melanoma.
According to other embodiments, the monoclonal antibody, or fragment thereof, has an affinity of at least about 5xlO~7M to CEACAM5 and the cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic, non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, myeloma and uterine.
According to an additional embodiment, the disease or disorder associated with over expression of CEACAM 1 is a viral infection.
According to some embodiments, the viral infection is caused by a virus selected from the group consisting of: DNA viruses, such as but not limited to cytomegalovirus (CMV), adenovirus, hepatitis virus and human papillomavirus (HPV); and RNA viruses such as but not limited to influenza virus and human immuno-deficiency virus (HIV).
According to an aspect of the present invention there is provided a method of immunomodulation, the method comprising contacting a CEACAM-expressing lymphocyte with the antibody or antibody fragment.
According to an aspect of the present invention there is provided a method of inhibiting migration of a CEACAM expressing tumor cell, the method comprising contacting the CEACAM expressing tumor cell with the antibody or antibody fragment, thereby inhibiting migration of a CEACAM expressing tumor cell.
According to some embodiments, the tumor cell comprises a melanoma tumor cell. According to an aspect of the present invention there is provided a method of treating cancer, the method comprising administering to a subject in need thereof a therapeutically effective amount of the antibody or antibody fragment, thereby treating the cancer in the subject. According to an aspect of the present invention there is provided a method of inhibiting CEACAM homotypic or heterotypic protein-protein interaction, the method comprising contacting a CEACAMl -expressing lymphocyte with the antibody or antibody fragment, thereby inhibiting CEACAMl homotypic or heterotypic protein-protein interaction.
According to some embodiments, the isolated antibody or antibody fragment is attached to a cytotoxic moiety.
According to some embodiments, the cytotoxic moiety comprises a cytotoxin, a chemokine, a chemotherapeutic composition, a pro-apoptotic, an interferon, a radioactive moiety, or combinations thereof.
According to some embodiments, the antibody or antibody fragment is attached to an identifiable moiety.
According to some embodiments, cells of the cancer are characterized by over expression of CEACAMl as compared to unaffected cells.
According to some embodiments, the method of treating cancer further comprises administering to the subject lymphocytes.
According to some embodiments, the lymphocytes comprise T cells or NK cells. According to some embodiments, the lymphocytes express CEACAMl . According to other embodiments, the CEACAMl -expressing lymphocyte is a Tumor Infiltrating Lymphocyte (TIL). According to other embodiments, the CEACAMl -expressing lymphocyte is a cytotoxic T cell.
The antibody of the present invention can be used to block CEACAM on either or both immune effector cells (CEACAM expressing lymphocytes e.g., tumor infiltrating cells, T cells or NK cells) and target cells (e.g., CEACAM expressing pathological cells such as cancer cells). Examples of cancer cells which are candidates for this therapy include, but are not limited to, melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cells.
According to a further aspect of the invention there is provided a method of rendering a CEACAM expressing tumor cell susceptible to immunomodulation. The method comprising contacting the CEACAM expressing tumor cell (e.g., melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary or endometrial cell) with the antibody or antibody fragment described above, thereby rendering the CEACAM expressing tumor cell susceptible to immunomodulation.
Additionally or alternatively, the present invention also envisages a method of immunomodulation (e.g., inhibiting CEACAM 1 homotypic or heterotypic protein-protein interaction), by contacting a CEACAM 1 -expressing lymphocyte with the antibody or antibody fragment described herein.
The therapeutic or preventive methods of the present teachings can be effected ex- vivo (e.g., used in T cell based adoptive immunotherapy) or in-vivo.
Antibodies of some embodiments of the invention can have anti cancer activity which is independent from its immunomodulatory activity described above.
In another aspect, the present invention provides a method for increasing the duration or progression of response or survival of a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody which recognizes CEACAM and an anti-neoplastic composition, wherein said anti-neoplastic composition comprises at least one chemotherapeutic agent, whereby the co-administration of the antibody and the anti-neoplastic composition effectively increases the duration or progression of response or survival.
Furthermore, the present invention provides a method for treating a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody to CEACAM and an anti-neoplastic composition whereby coadministration of the antibody to CEACAM and the anti-neoplastic composition effectively increases the response incidence in the group of subjects.
Aside from therapeutic applications, antibodies of the present invention can also be used in diagnostic applications.
Thus, according to a further aspect there is provided a method for diagnosing a cancer in a subject in need thereof, the method comprising contacting a biological sample derived from the subject (in-vivo, in vitro or ex-vivo) with the antibody or antibody fragment described herein, wherein a complex formation beyond a predetermined threshold is indicative of the cancer in the subject. According to some embodiments, cells of the cancer are characterized by over expression of CEACAM as compared to unaffected cells.
According to a particular embodiment the diagnosed cancer is selected from the group consisting of: melanoma, pancreatic cancer, lung cancer and myeloma.
According to another particular embodiment the measured protein is CEACAM5 and the diagnosed cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
As mentioned, the method of the invention is affected under conditions sufficient to form an immunocomplex; such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods to optimize such conditions are known to those skilled in the art, and examples are disclosed herein. As used herein the phrase "immunocomplex" refers to a complex which comprises the antibody of the invention and the CEACAM. Determining a presence or level of the immunocomplex of the invention may be direct or by detecting an identifiable (detectable) moiety which may be attached to the antibody.
The level of the immunocomplex in the tested cell (e.g., a cell of a subject in need thereof) is compared to a predetermined threshold. It will be appreciated that the antibody of the present invention can also be used to measure the amount of serum soluble CEACAM. Regardless, the threshold may be determined based on a known reference level and/or a level in a control cell or serum. The control cell can be obtained from a control, healthy subject (e.g., a subject not suffering from the cancer) or from the same subject prior to disease initiation or following treatment. According to some embodiments of the invention, the control subject is of the same species e.g. human, preferably matched with the same age, weight, sex etc. as the subject in need thereof.
To facilitate diagnosis, the above teachings can be combined with other methods of diagnosing cancer which are well known in the art include but are not limited to imaging, molecular tests and surgical biopsies.
According to another aspect of present invention a method for detecting or quantifying the presence of CEACAM in is provided. Thus, the present invention also provides methods for diagnosing conditions associated with CEACAM expression using antibodies which recognizes CEACAM. Diagnostic methods according to the invention may be performed according to specific embodiments, in-vitro or ex-vivo. The antibodies according to the present invention may be also used to configure screening methods. For example, an ELISA assay can be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art.
According to one embodiment a method is provided for detecting or quantifying the presence of CEACAM, comprising the steps of: i. incubating a biological sample with an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion;
ii. detecting the bound CEACAM using a detectable probe;
iii. comparing the amount of (ii) to a standard curve obtained from reference samples containing known amounts of CEACAM; and
iv. calculating the amount of the CEACAM in the sample from the standard curve.
According to another embodiment a method for diagnosing a disease or disorder associated with CEACAM expression is provided comprising the steps of:
i. incubating a biological sample with an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion; ii. detecting the bound CEACAM using a detectable probe;
iii. comparing the amount of (ii) to a standard curve obtained from reference samples containing known amounts of CEACAM;
iv. calculating the amount of the CEACAM in the biological sample from the standard curve; and
v. comparing the amount of (iv) to a normal CEACAM amount.
According to some embodiments the biological sample is a body fluid of a mammalian subject. According to particular embodiments, the mammalian subject is human.
The antibodies of the present invention may be also used in screening assays for assessing the CEACAM levels in patients and for prediction of the effectiveness of treatment.
The screening assays with the antibodies of the present invention may allow determination of the levels of CEACAM and therefore prediction of treatment outcome and planning of an appropriate treatment regimen.
According to other embodiments, the level of at least one of CEACAM 1, CEACAM3 and CEACAM5 is assessed. According to a particular embodiment the level of CEACAM 1 is assessed.
According to some embodiments of the invention, the antibody or antibody fragment is attached to an identifiable moiety.
It will be appreciated that such attachment of antibodies, or fragments thereof, and identifiable moiety can be effected using chemical conjugation or by recombinant DNA technology according to methods well known in the art.
The identifiable moiety can be a member of a binding pair, which is identifiable via its interaction with an additional member of the binding pair and a label which is directly visualized. In one example, the member of the binding pair is an antigen which is identified by a corresponding labeled antibody. In one example, the label is a fluorescent protein or an enzyme producing a colorimetric reaction.
Another aspect of the present invention relates to the use of an antibody to CEACAM or an antibody fragment thereof, for diagnosis or treatment of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
According one embodiment the cell proliferative disease is melanoma.
According to other embodiments the cell proliferative disease or disorder is a cancer selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non- small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, uterine, and myeloma.
According to one embodiment, the present invention provides use of an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion, for preparation of a medicament for treatment of a disorder or disease associated with expression or activation of, including but not limited to cancer and viral infection.
The invention also relates to use of an antibody to CEACAM or an antibody fragment thereof, for the manufacture of a diagnostic composition for the diagnosis of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
Essentially all of the uses known or envisioned in the prior art for CEACAM 1, CEACAM3 and CEACAM5 antibodies can be accomplished with the antibodies of the present invention which are shown to posses improved affinity toward these proteins and superior inhibitory and in indirect immunomodulatory effects on CEACAM 1 bearing cells. These uses include diagnostic, prophylactic and therapeutic techniques.
Further embodiments and the full scope of applicability of the present invention will become apparent from the detailed description given hereinafter.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 is an SDS-PAGE image showing light and heavy chains of the chimeric antibody CM10.
Figure 2 shows specific binding curve of CM 10 to purified hCEACAMl .
Figure 3 demonstrates specific binding of CM 10 to CEACAM 1 as detected by Flow Cytometry analysis.
Figure 4 confirms that CM 10 blocks CEACAM 1 -CEACAM 1 interaction between cells. Mouse IL-2 secretion of effectors cells (BW/221 cells expressing CEACAM 1) incubated in the presence of various CM 10 concentrations, was measured by ELISA. Figure 5 shows CM 10 enhancement of the specific killing activity of CEACAMl -positive melanoma cells.
Figure 6 demonstrates that CM 10 stimulates the killing activity of tumor-infiltrating lymphocyte (TILs).
Figure 7 demonstrates that CM 10 enhances the killing activity of NK cells on CEACAMl positive melanoma cell lines.
Figure 8 CM 10 immunomodulatory effect inhibits tumor growth in- vivo. Arrows indicate time of administration (CM10 cyrcles, TIL triangles, CM10 and TIL open squares).
Figure 9 is a schematic presentation of CM 10 immunomodulatory mode of action.
Figure 10 represents CEACAMl binding intensity level in tumors as determined by anti CEACAMl antibody.
Figure 11 shows quantification of CM 10 molecules bound per cell.
Figure 12 confirms that CM 10 has no effect on PBMC Proliferation. Results represent average proliferation rates from three donors for each treatment.
Figure 13 presents FACS analysis of binding between CM 10 to CEACAM family proteins. CEACAMl, 5, 6 and 8 were expressed by 721.221 cells, and CEACAM3 and 4 by HEK293T cells.
Figure 14 represents results of complement-dependent cytotoxicity (CDC) assay in melanoma cell lines.
Fig 15 demonstrates that CM 10 enhances granzyme B secretion of TIL in the presence of CEACAMl and HLA-A2 positive melanoma cells.
Fig 16 shows that CM 10 blocks CEACAM 1-CE AC AM5 interactions.
Fig 17 presents CM10 enhancement of HLA restricted T cell killing.
Fig 18 demonstrates the immunomodulatory activity of CM 10 inhibits tumor growth in- vivo. Fig 19: indicates that CM 10 enhances the killing activity of NK cells on CEACAMl -positive pancreatic cancer cell lines COLO-357 and BXPC3.
Fig 20: demonstrates that CM 10 enhances granzyme B secretion of NK cells in the presence of CEACAMl -positive pancreatic cancer cell lines. DETAILED DESCRIPTION OF THE INVENTION
The present invention provides antibodies which recognize CEACAMl comprising specific sets of CDR sequences which possess improved and unique specificity, selectivity, affinity and/or activity. Antibodies according to the present invention bind CEACAM1 with higher affinity than other anti-CEACAMl antibodies, they blocks the function of CEACAM1, while not all anti CEACAM antibodies do, and more efficiently than polyclonal anti CEACAM antibodies. Furthermore, antibodies according to the present invention are effective against cancer cells, in particular melanoma cells: the antibodies render melanoma cells more susceptible to lymphocytes, inhibit melanoma growth rate in vivo, an effect which is enhanced when the antibody is combined with adoptive T cell transfer in vivo.
It is shown here for the first time that the in vivo anti-melanoma effect of anti- CEACAMl antibodies according to the invention is a combined direct anti-tumor effect as well as immunomodulatory effect rendering the cells more susceptible to reactive lymphocytes.
An antibody according to the present invention, fragments and derivatives can be used as an effective tool for diagnosis, immunomodulation and cancer treatment.
The antibody inhibits CEACAM 1 homophilic interactions, as determined by co- incubation of immune effector cells and target cells expressing CEACAM 1 and assaying IL-2 secretion and by the in vitro killing assays.
The antibody of the present invention is shown to enhances CM 10 enhances HLA restricted T cell killing and to enhance granzyme B (a serine protease involves in mediation apoptosis of the target cells) secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody. It is also inhibits the binding between CEACAM 1 to CEACAM5 in a dose- dependent manner therefore can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM 1-CEACAM5 axis in order to suppress the immune cells.
In addition it is herein shown that, an antibody according to the invention is effective in inhibiting melanoma cells invasion. Furthermore, in vivo administration of an antibody according to the invention, either alone or in combination with reactive lymphocytes was shown effective in inhibiting growth of melanoma tumors. The combination of adoptive human T cell transfer with monoclonal antibody injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group.
According to a further aspect of the invention there is provided an isolated antibody or antibody fragment having the same binding specificity and selectivity to an antibody defined herein comprising an antigen recognition domain having specific CDR segments described above. According to this aspect, isolated antibody or antibody fragment is capable of binding the same epitope determinant of the CEACAM1 protein as does the antibody described above by its specific CDR segments sequences.
The proposed sequence of an epitope to which a monoclonal antibody according to the invention binds is disclosed herein for the same time, together with proposed isolated peptides derived from this epitope which can be used for raising additional monoclonal antibodies.
Monoclonal antibodies (mAbs) can be designed to selectively target tumor cells and elicit a variety of responses once bound. These agents can destruct tumor cells in different ways such as blocking tumor cell proliferation or activating the immune system. Chimeric monoclonal antibodies according to the present invention were designed to specifically bind and neutralize various functions of the CEACAM1 protein and other CEACAM subtype proteins, and to induce the specific death of tumor cells. Without wishing to be bound to any theory, it is suggested that monoclonal antibodies according to the present invention act also via activation of the immune system against cancerous cells.
Both the clinical and biological evidence highlight CEACAM 1 as a promising target for the development of targeted-immunotherapy. CEACAM 1 is not found on normal melanocytes, but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens. It has been previously demonstrated mechanistically that CEACAM 1 protects melanoma cells by inhibiting effector functions of NK cells and T cells.
It is herein demonstrated for the first time that CM 10 is a chimeric monoclonal antibody which binds with high affinity to human CEACAM 1. In-vitro, CM 10 efficiently blocked CEACAM 1-homophilic interactions in a dose dependent manner and improves CEACAM 1 positive melanoma cells killing by T cells and NK cells. Moreover, CM 10 significantly inhibited the in- vivo growth of melanoma xenografts when administered systemically along with melanoma-reactive human T lymphocytes (tumor-infiltrating lymphocytes, TILs). Without wishing to be bound to any theory, this is in line with the suggested mechanism of action; abrogation of immune-protective interactions of the tumor cells with the activated lymphocytes.
Several evidences reported that CEACAM 1 is expressed by a wide variety of epithelial cells, including colon, prostate, breast, kidney etc. Extensive examination of CEACAM 1 expression profile on normal and malignant tissues by IHC have been performed. The expression analysis showed a strong staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in restricted sites of several organs. When more quantitative method was used to quantify the number of CM 10 mAb molecules bound to malignant and normal primary cells, very low CM 10 molecules could be detected in normal cells, which may indicate that CM10 binds mostly to patient's tumor cells. Furthermore it is shown that CM 10 has no effect on primary cells proliferation and is completely or almost completely, unable to induce CDC or ADCC indicating the potential safety of the monoclonal antibody in human subjects.
Since CM 10 has an immunomodulation activity, possible immune-related side effects, are evaluated. Following PBMC activation, CEACAM1 is upregulated on the activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46). Ex-vivo human PBMC proliferation assay revealed that CM 10 has no effect on naive and activated PBMC proliferative response.
The main advantage of CEACAM1 blockade over abrogation of generalized inhibitory mechanisms is the expected selectivity to the vicinity of the tumor and therefore fewer adverse events compare to other general immune toxicity agents.
As demonstrated in the present invention, CM 10 shows encouraging activity and safety profile and is a promising candidate for cancer immunotherapy and can be used as a strategy to selectively enhance the anti-tumor properties of the endogenous immune response in several malignancies, such as melanoma and non-small cell lung cancer.
Binding to additional CEACAM subtypes increases the therapeutic profile of the antibody, thus it can be used for diagnosis and treatment of other types of malignancies which do not extensively express CEACAM 1 but express CEACAM5, for example.
CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70%> of non-small cell lung cancer cells and 50% of breast cancers. It is also over-expressed in thyroid, stomach, ovarian and uterine cancers (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30). The evidence that CM 10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM 10 from 4-5 types of malignancies to above 10. The anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies. It seems that even these toxic conjugated forms don't show safety problems, which can indicate that CEACAM5 is a safe target. The human counterparts of murine IgG subclasses are based on similarities in biological and functional activities. Murine IgG2a and IgG2b and human IgGl and IgG3 share the ability to fix complement and bind to protein antigens (Hussain et al., 1995, Clinical and Diagnostic Laboratory Immunology 726-732). Murine IgGl and human IgG4 are considered to be similar because of their property of binding to mast cells. Human IgG4 is the only human IgG subclass which does not activate complement and the subclasses IgGl and 3 are the most effective in activating complements. For mouse it is the subclasses IgG2a and IgG2b which are active with IgGl and possibly IgG3 being inactive (Clark MR., Chem Immunol. 1997;65:88-110).
Several known monoclonal antibodies which recognize CEACAM1 are of subtype mouse IgGl . As the human equivalent of mouse IgGl is IgG4 it would be expected to create a chimeric antibody comprising the human IgG4 constant framework. Unexpectedly, according to some embodiments of the present invention chimeric monoclonal antibodies comprise a human IgGl constant framework.
According to one aspect, the present invention provides a monoclonal antibody which recognizes CEACAM1, or an antibody fragment comprising at least an antigen-binding portion thereof, comprising at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof.
According to some embodiments, analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the sequence of the reference sequence are disclosed.
According to other embodiments analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the reference sequence are disclosed.
According to yet other embodiments, analogs and derivatives of the monoclonal antibody or fragment thereof having at least 98% sequence identity with the CDR sequence of the reference antibody are disclosed.
According to one embodiment the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
According to other embodiments the antibody or antibody fragment comprises at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
According to yet other embodiments the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
According to some embodiments the antibody or antibody fragment comprises at least one heavy-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 21, and at least one light-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
According to other embodiments, the antibody binding site of the antibody or fragment thereof consists of three heavy chain CDRs selected from the group consisting of SEQ ID NOs: 7, 8, 9, 13, 14 and 15 and three light chain CDRs selected from the group consisting of SEQ ID NOs: 10, 11, 12, 16, 17, 18, and analogs and derivatives thereof having at least 97% sequence identity with the antibody binding site.
According to yet other embodiments, the antibody binding site consists of the six CDRs of SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
According to other embodiments, the antibody binding site consists of the six CDRs of SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
The CDR sequences according to the invention were identified using two different algorithm methods: IMGT algorithm (Lefranc et al., 1999, Nucleic Acids Research, 27, 209- 212); and KABAT algorithm (Wu TT and Kabat E.A., 1970, J. Exp. Med. 132, 211-250). The sequences revealed by both methods are disclosed. According to some embodiments, the heavy chain CDR1 of the antibody according to the invention or a fragment thereof is selected from NNLIE (SEQ ID NO: 7) and GYAFTNNL (SEQ ID NO: 13).
According to some embodiments, the heavy chain CDR2 of the antibody according to the invention or a fragment thereof is selected from VINPGSGDTNYNEKFKG (SEQ ID NO: 8) and INPGSGDT (SEQ ID NO: 14).
According to some embodiments, the heavy chain CDR3 of the antibody according to the invention or a fragment thereof is selected from GDYYGGFAVDY (SEQ ID NO: 9) and ARGDYYGGFAVDY (SEQ ID NO: 15).
According to some embodiments, the light chain CDR1 of the antibody according to the invention or a fragment thereof is selected from RTSQDIGNYLN (SEQ ID NO: 10) and QDIGNY (SEQ ID NO: 16).
According to some embodiments, the light chain CDR2 of the antibody according to the invention or a fragment thereof is selected from YTSRLHS (SEQ ID NO: 11) and YTS (SEQ ID NO: 17).
According to some embodiments, the light chain CDR3 of the antibody according to the invention or a fragment thereof is selected from QQGKSLP (SEQ ID NO: 12) and QQGKSLPRT (SEQ ID NO: 18).
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 7, 8 and 9.
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 13, 14 and 15.
According to some embodiments a monoclonal antibody which recognizes
CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 10, 11 and 12.
According to some embodiments a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 16, 17 and 18.
According to a specific embodiment the antibody comprises the heavy chain variable domain sequence:
According to a specific embodiment the antibody or fragment thereof comprises a heavy chain variable domain sequence consisting of the of SEQ ID NO: 26 and a light chain variable domain sequence consisting of SEQ ID NO: 28, or an analog or derivative thereof having at least 90% sequence identity with the antibody or fragment sequence.
According to some particular embodiments the present invention provides a monoclonal antibody, or an antibody fragment comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, and a framework sequence selected from mouse IgG2a, mouse IgG2b, mouse IgG3, human IgGl, human IgG2, human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO~7M to at least two CEACAM subtypes.
According to a particular embodiment, a chimeric monoclonal antibody which recognizes CEACAM 1 is provided, comprising at least one CDR sequence selected from the group consisting of: SEQ ID NOs: 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, and 18; and analogs and derivatives thereof having at least 97%> sequence identity with said CDR sequences, and a constant region sequence selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO~7M to at least two CEACAM subtypes.
According to a particular embodiment, a chimeric or humanized monoclonal antibody which recognizes CEACAM 1 is provided comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97%> sequence identity with said CDR sequences, and a constant region subclass selected from human IgGl, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5xlO~7M to at least two CEACAM subtypes.
According to yet another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided comprising a heavy chain sequence according to SEQ ID NO: 30.
According to yet another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided comprising a light chain sequence according to SEQ ID NO: 31.
According to yet another particular embodiment a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion, is provided comprising a human IgGl heavy chain sequence according to SEQ ID NO: 30, and a human IgGl light chain sequence according to SEQ ID NO: 31. Definitions
The term "CEACAMl" is used to refer to the protein product of the CEACAMl gene e.g., NP 001020083.1, NP 001703.2. In humans, 11 different CEACAMl splice variants have been detected so far. Individual CEACAMl isoforms differ with respect to the number of extracellular immunoglobulin-like domains (for example, CEACAMl with four extracellular immunoglobulin-like domains is known as CEACAMl -4), membrane anchorage and/or the length of their cytoplasmic tail (for example, CEACAMl -4 with a long cytoplasmic tail is known as CEACAMl -4L and CEACAMl -4 with a short cytoplasmic tail is known as CEACAMl -4S). The N-terminal domain of CEACAMl starts immediately after the signal peptide and its structure is regarded as IgV-type. For example, in CEACAMl annotation PI 3688, the N-terminal IgV-type domain is comprised of 108 amino acids, from amino acid 35 to 142. This domain was identified as responsible for the homophilic binding activity (Watt et al, 2001, Blood. 98, 1469-79). All variants, including these splice variants are included within the term "CEACAMl".
An "anti-CEACAMl antibody", "an antibody which recognizes CEACAMl", "an antibody against CEACAMl", or "an antibody to CEACAMl" is an antibody that binds to the CEACAMl protein with sufficient affinity and specificity. Typically, an antibody according to the present teachings is capable of binding CEACAMl with a minimal affinity of about 10"8 or 10"9 M. Some of the monoclonal antibodies of the present invention are capable of binding CEACAM3, 5 and/or 8 with a minimal affinity of about 5x10~7 M.
Preferably, the anti-CEACAMl antibody of the invention can be used as a diagnostic or therapeutic agent in targeting and interfering with diseases or conditions wherein the CEACAMl expression or activity is involved.
An "antigen" is a molecule or a portion of a molecule capable of eliciting antibody formation and being bound by an antibody. An antigen may have one or more than one epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which may be evoked by other antigens. An antigen according to the present invention is a CEACAMl protein or a fragment thereof.
The term "antigenic determinant" or "epitope" according to the invention refers to the region of an antigen molecule that specifically reacts with particular antibody. Peptide sequences derived from an epitope can be used, alone or in conjunction with a carrier moiety, applying methods known in the art, to immunize animals and to produce additional polyclonal or monoclonal antibodies. Isolated peptides derived from an epitope may be used in diagnostic methods to detect antibodies and as therapeutic agents when inhibition of said antibodies is required.
Antibodies, or immunoglobulins, comprise two heavy chains linked together by disulfide bonds and two light chains, each light chain being linked to a respective heavy chain by disulfide bonds in a "Y" shaped configuration. Proteolytic digestion of an antibody yields Fv (Fragment variable) and Fc (fragment crystalline) domains. The antigen binding domains, Fab, include regions where the polypeptide sequence varies. The term F(ab')2 represents two Fab' arms linked together by disulfide bonds. The central axis of the antibody is termed the Fc fragment. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains (CR). Each light chain has a variable domain (VL) at one end and a constant domain (CL) at its other end, the light chain variable domain being aligned with the variable domain of the heavy chain and the light chain constant domain being aligned with the first constant domain of the heavy chain (CHI). The variable domains of each pair of light and heavy chains form the antigen-binding site. The domains on the light and heavy chains have the same general structure and each domain comprises four framework regions, whose sequences are relatively conserved, joined by three hypervariable domains known as complementarity determining regions (CDRl-3). These domains contribute specificity and affinity of the antigen-binding site. The isotype of the heavy chain (gamma, alpha, delta, epsilon or mu) determines immunoglobulin class (IgG, IgA, IgD, IgE or IgM, respectively). The light chain is either of two isotypes (kappa, κ or lambda, λ) found in all antibody classes.
The term "antibody" is used in the broadest sense and includes monoclonal antibodies (including full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
The antibody according to the present invention is a molecule comprising at least the antigen-binding portion of an antibody. Antibody or antibodies according to the invention include intact antibodies, such as polyclonal antibodies or monoclonal antibodies (mAbs), as well as proteolytic fragments thereof such as the Fab or F(ab')2 fragments. Further included within the scope of the invention are chimeric antibodies; human and humanized antibodies; recombinant and engineered antibodies, and fragments thereof. Furthermore, the DNA encoding the variable region of the antibody can be inserted into the DNA encoding other antibodies to produce chimeric antibodies. Single chain antibodies also fall within the scope of the present invention. "Antibody fragments" comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. Examples of antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CHI domains; (ii) the Fab' fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CHI domain; (iii) the Fd fragment having VH and CHI domains; (iv) the Fd' fragment having VH and CHI domains and one or more cysteine residues at the C-terminus of the CHI domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al, Nature 1989, 341, 544-546) which consists of a VH domain; (vii) isolated CDR regions; (viii) F(ab')2 fragments, a bivalent fragment including two Fab' fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g. single chain Fv; scFv) (Bird et al, Science 1988, 242, 423-426; and Huston et al, PNAS (USA) 1988, 85,5879-5883); (x) "diabodies" with two antigen binding sites, comprising a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (see, e.g., EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. Sci. USA, 1993, 90, 6444-6448); (xi) "linear antibodies" comprising a pair of tandem Fd segments (VH-CHl-VH-CHl) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al. Protein Eng., 1995, 8, 1057-1062; and U.S. Pat. No. 5,641,870).
Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain i.e. linked VH-VL or single chain Fv (scFv).
A "neutralizing antibody" as used herein refers to a molecule having an antigen- binding site to a specific receptor or ligand target capable of reducing or inhibiting (blocking) activity or signaling through a receptor, as determined by in vivo or in vitro assays, as per the specification.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. The modifier "monoclonal" is not to be construed as requiring production of the antibody by any particular method. mAbs may be obtained by methods known to those skilled in the art. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al, Nature 1975, 256, 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The "monoclonal antibodies" may also be isolated from phage antibody libraries using the techniques described in Clackson et al, Nature 1991, 352, 624-628 or Marks et al, J. Mol. Biol, 1991, 222:581- 597, for example.
The mAbs of the present invention may be of any immunoglobulin class including IgG, IgM, IgE, IgA. A hybridoma producing a mAb may be cultivated in vitro or in vivo. High titers of mAbs can be obtained in vivo production where cells from the individual hybridomas are injected intraperitoneally into pristine-primed Balb/c mice to produce ascites fluid containing high concentrations of the desired mAbs. mAbs of isotype IgM or IgG may be purified from such ascites fluids, or from culture supernatants, using column chromatography methods well known to those of skill in the art.
The monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA 57:6851-6855 (1984)). In addition, complementarity determining region (CDR) grafting may be performed to alter certain properties of the antibody molecule including affinity or specificity. A non-limiting example of CDR grafting is disclosed in US patent 5,225,539.
Chimeric antibodies are molecules, the different portions of which are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region. Antibodies which have variable region framework residues substantially from human antibody (termed an acceptor antibody) and complementarity determining regions substantially from a mouse antibody (termed a donor antibody) are also referred to as humanized antibodies. Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used. Chimeric antibodies and methods for their production are known in the art (for example PCT patent applications WO 86/01533, WO 97/02671, WO 90/07861, WO 92/22653 and US patents 5,693,762, 5,693,761, 5,585,089, 5,530,101 and 5,225,539).
"Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non- human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al, Nature 1986, 321, 522-525; Riechmann et al, Nature 1988, 332, 323- 329; and Presta, Curr. Op. Struct. Biol, 1992 2, 593-596.
A "human antibody" is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al. Nature Biotechnology 1996 14,309-314; Sheets et al. PNAS (USA), 1998, 95, 6157-6162); Hoogenboom and Winter, J. Mol. Biol, 1991, 227, 381; Marks et al, J. Mol. Biol, 1991, 222, 581). Human antibodies can also be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al, Bio/Technology 10: 779-783 (1992); Lonberg et al, Nature 368: 856-859 (1994); Morrison, Nature 565:812-13 (1994); Fishwild et al, Nature Biotechnology 14: 845-51 (1996); Neuberger, Nature Biotechnology 14: 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol. 75:65-93 (1995). Alternatively, the human antibody may be prepared via immortalization of human B lymphocytes producing an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or may have been immunized in vitro). See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al, J. Immunol, 147 (l):86-95 (1991); and U.S. Pat No. 5,750,373.
By the term "single chain variable fragment (scFv)" is meant a fusion of the variable regions of the heavy and light chains of immunoglobulin, linked together with a short (usually serine, glycine) linker. Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain (linked VH-VL or single chain Fv (scFv)). Both VH and VL may copy natural monoclonal antibody sequences or one or both of the chains may comprise a CDR-FR construct of the type described in US patent 5,091,513, the entire contents of which are incorporated herein by reference. The separate polypeptides analogous to the variable regions of the light and heavy chains are held together by a polypeptide linker. Methods of production of such single chain antibodies, particularly where the DNA encoding the polypeptide structures of the VH and VL chains are known, may be accomplished in accordance with the methods described, for example, in US patents 4,946,778, 5,091,513 and 5,096,815, the entire contents of each of which are incorporated herein by reference.
A "molecule having the antigen-binding portion of an antibody" as used herein is intended to include not only intact immunoglobulin molecules of any isotype and generated by any animal cell line or microorganism, but also the antigen-binding reactive fraction thereof, including, but not limited to, the Fab fragment, the Fab' fragment, the F(ab')2 fragment, the variable portion of the heavy and/or light chains thereof, Fab mini-antibodies (see WO 93/15210, US patent application 08/256,790, WO 96/13583, US patent application 08/817,788, WO 96/37621, US patent application 08/999,554, the entire contents of which are incorporated herein by reference), dimeric bispecific mini-antibodies (see Muller et al., 1998) and chimeric or single-chain antibodies incorporating such reactive fraction, as well as any other type of molecule or cell in which such antibody reactive fraction has been physically inserted, such as a chimeric T-cell receptor or a T-cell having such a receptor, or molecules developed to deliver therapeutic moieties by means of a portion of the molecule containing such a reactive fraction. Such molecules may be provided by any known technique, including, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques.
Antibodies according to the invention can be obtained by administering CEACAM1, or epitope-bearing fragments, analogs, or cells expressing, to an animal, preferably a nonhuman, using routine protocols. For preparation of monoclonal antibodies, any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. Examples include various techniques, such as those in Kohler, G. and Milstein, C, Nature 256: 495-497 (1975); Kozbor et al, Immunology Today 4: 72 (1983); Cole et al, pg. 77-96 in MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc. (1985).
Besides the conventional method of raising antibodies in vivo, antibodies can be generated in vitro using phage display technology. Such a production of recombinant antibodies is much faster compared to conventional antibody production and they can be generated against an enormous number of antigens. Furthermore, when using the conventional method, many antigens prove to be non-immunogenic or extremely toxic, and therefore cannot be used to generate antibodies in animals. Moreover, affinity maturation (i.e., increasing the affinity and specificity) of recombinant antibodies is very simple and relatively fast. Finally, large numbers of different antibodies against a specific antigen can be generated in one selection procedure. To generate recombinant monoclonal antibodies one can use various methods all based on display libraries to generate a large pool of antibodies with different antigen recognition sites. Such a library can be made in several ways: One can generate a synthetic repertoire by cloning synthetic CDR3 regions in a pool of heavy chain germline genes and thus generating a large antibody repertoire, from which recombinant antibody fragments with various specificities can be selected. One can use the lymphocyte pool of humans as starting material for the construction of an antibody library. It is possible to construct naive repertoires of human IgM antibodies and thus create a human library of large diversity. This method has been widely used successfully to select a large number of antibodies against different antigens. Protocols for bacteriophage library construction and selection of recombinant antibodies are provided in the well-known reference text Current Protocols in Immunology, Colligan et al (Eds.), John Wiley & Sons, Inc. (1992-2000), Chapter 17, Section 17.1. Non-human antibodies may be humanized by any methods known in the art. In one method, the non-human complementarity determining regions (CDRs) are inserted into a human antibody or consensus antibody framework sequence. Further changes can then be introduced into the antibody framework to modulate affinity or immunogenicity.
For example, US Patent 5,585,089 of Queen et al. discloses a humanized immunoglobulin and methods of preparing same, wherein the humanized immunoglobulin comprises complementarity determining regions (CDRs) from a donor immunoglobulin and heavy and light chain variable region frameworks from human acceptor immunoglobulin heavy and light chains, wherein said humanized immunoglobulin comprises amino acids from the donor immunoglobulin framework outside the Kabat and Chothia CDRs, wherein the donor amino acids replace corresponding amino acids in the acceptor immunoglobulin heavy or light chain frameworks.
US Patent 5,225,539, of Winter, also discloses an altered antibody or antigen-binding fragment thereof and methods of preparing same, wherein a variable domain of the antibody or antigen-binding fragment has the framework regions of a first immunoglobulin heavy or light chain variable domain and the complementarity determining regions of a second immunoglobulin heavy or light chain variable domain, wherein said second immunoglobulin heavy or light chain variable domain is different from said first immunoglobulin heavy or light chain variable domain in antigen binding specificity, antigen binding affinity, species, class or subclass.
Anti-idiotype antibodies specifically immunoreactive with an antibody of the invention are also comprehended.
Techniques for the production of single chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to produce single chain antibodies to polypeptides or polynucleotides of this invention. Also, transgenic mice, or other organisms such as other mammals, can be used to express humanized antibodies immunospecific to the polypeptides or polynucleotides of the invention.
Alternatively, phage display technology can be utilized to select antibody genes with binding activities towards a polypeptide of the invention either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti-CEACAMl or from libraries (McCafferty, et al, 1990, Nature 348, 552-554; Marks, et al, 1992, Biotechnology 10, 779-783). The affinity of these antibodies can also be improved by, for example, chain shuffling (Clackson et al., 1991, Nature 352:628).
The above-described antibodies can be employed to isolate or to identify clones expressing the polypeptides to purify the polypeptides by, for example, affinity chromatography.
The invention also provides conservative amino acid variants of the antibody molecules according to the invention. Variants according to the invention also may be made that conserve the overall molecular structure of the encoded proteins. Given the properties of the individual amino acids comprising the disclosed protein products, some rational substitutions will be recognized by the skilled worker. Amino acid substitutions, i.e. "conservative substitutions," may be made, for instance, on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
A "disorder" is any condition that would benefit from treatment with the antibody. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question. Non-limiting examples of disorders to be treated herein include benign and malignant tumors; leukemias and lymphoid malignancies; neuronal, glial, astrocytal, hypothalamic and other glandular, macrophagal, epithelial, stromal and blastocoelic disorders; and inflammatory, angiogenic, immunologic disorders or hyperpermeability states.
The term "therapeutically effective amount" refers to an amount of a drug effective to treat a disease or disorder in a mammal. In the case of cancer, the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder. To the extent the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. For cancer therapy, efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), the response rates (RR), duration of response, and/or quality of life.
"Treatment" refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented.
The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cancer.
According to some embodiments, the antibody of the present invention is attached to a cytotoxic or therapeutic moiety. The cytotoxic or therapeutic moiety can be, for example, a cytotoxic moiety, a toxic moiety, a cytokine moiety, a bi-specific antibody moiety, a cytotoxin, a chemokine, a chemotherapy, a pro-apoptotic, interferon, a radioactive moiety, or combinations thereof, examples of which are provided infra.
The term "anti-neoplastic composition" refers to a composition useful in treating cancer comprising at least one active therapeutic agent capable of inhibiting or preventing tumor growth or function, and/or causing destruction of tumor cells. Therapeutic agents suitable in an anti-neoplastic composition for treating cancer include, but not limited to, chemotherapeutic agents, radioactive isotopes, toxins, cytokines such as interferons, and antagonistic agents targeting cytokines, cytokine receptors or antigens associated with tumor cells. Preferably the therapeutic agent is a chemotherapeutic agent.
As used herein the term "diagnosing" refers to determining presence or absence of a pathology, classifying a pathology or a symptom, determining a severity of the pathology, monitoring pathology progression, forecasting an outcome of a pathology and/or prospects of recovery.
Pharmacology
The present invention also contemplates pharmaceutical formulations for human medical use, which comprise as the active agent at least one antibody which recognizes CEACAM1, for the manufacture of a therapeutic or diagnostic composition for the treatment, diagnosis or prophylaxis of the conditions variously described herein.
In such pharmaceutical and medicament formulations, the active agent is preferably utilized together with one or more pharmaceutically acceptable carrier(s) and optionally any other therapeutic ingredients. The carrier(s) must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the formulation and not unduly deleterious to the recipient thereof. The active agent is provided in an amount effective to achieve the desired pharmacological effect, as described above, and in a quantity appropriate to achieve the desired daily dose.
Typically, the molecules of the present invention comprising the antigen binding portion of an antibody or comprising another polypeptide including a peptidomimetic will be suspended in a sterile saline solution for therapeutic uses. The pharmaceutical compositions may alternatively be formulated to control release of active ingredient (molecule comprising the antigen binding portion of an antibody) or to prolong its presence in a patient's system. Numerous suitable drug delivery systems are known and include, e.g., implantable drug release systems, hydrogels, hydroxymethylcellulose, microcapsules, liposomes, microemulsions, microspheres, and the like. Controlled release preparations can be prepared through the use of polymers to complex or adsorb the molecule according to the present invention. For example, biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebaric acid. The rate of release of the molecule according to the present invention, i.e., of an antibody or antibody fragment, from such a matrix depends upon the molecular weight of the molecule, the amount of the molecule within the matrix, and the size of dispersed particles.
The pharmaceutical composition of this invention may be administered by any suitable means, such as orally, topically, intranasally, subcutaneously, intramuscularly, intravenously, intra-arterially, intraarticulary, intralesionally or parenterally. Ordinarily, intravenous (i.v.), intraarticular, topical or parenteral administration will be preferred.
It will be apparent to those of ordinary skill in the art that the therapeutically effective amount of the molecule according to the present invention will depend, inter alia upon the administration schedule, the unit dose of molecule administered, whether the molecule is administered in combination with other therapeutic agents, the immune status and health of the patient, the therapeutic activity of the molecule administered and the judgment of the treating physician. As used herein, a "therapeutically effective amount" refers to the amount of a molecule required to alleviate one or more symptoms associated with a disorder being treated over a period of time.
Although an appropriate dosage of a molecule of the invention varies depending on the administration route, type of molecule (polypeptide, polynucleotide, organic molecule etc.) age, body weight, sex, or conditions of the patient, and should be determined by the physician in the end, in the case of oral administration, the daily dosage can generally be between about 0.0 lmg to about 500 mg, preferably about 0.0 lmg to about 50 mg, more preferably about O. lmg to about 10 mg, per kg body weight. In the case of parenteral administration, the daily dosage can generally be between about 0.00 lmg to about 100 mg, preferably about 0.00 lmg to about 10 mg, more preferably about 0.0 lmg to about 1 mg, per kg body weight. The daily dosage can be administered, for example in regimens typical of 1- 4 individual administration daily. Other preferred methods of administration include intraarticular administration of about 0.0 lmg to about 100 mg per kg body weight. Various considerations in arriving at an effective amount are described, e.g., in Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th ed., Pergamon Press, 1990; and Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., 1990.
Suitable dosing regimens of combination chemotherapies are known in the art and described in, for example, Saltz et al. Proc ASCO 1999, 18, 233a and Douillard et al., Lancet 2000, 355, 1041-7.
The molecules of the present invention as active ingredients are dissolved, dispersed or admixed in an excipient that is pharmaceutically acceptable and compatible with the active ingredient as is well known. Suitable excipients are, for example, water, saline, phosphate buffered saline (PBS), dextrose, glycerol, ethanol, or the like and combinations thereof. Other suitable carriers are well known to those skilled in the art. In addition, if desired, the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents.
The pharmaceutical composition according to the present invention may be administered together with an anti-neoplastic composition. According to a specific embodiment the anti-neoplastic composition comprises at least one chemotherapeutic agent. The chemotherapy agent, which could be administered together with the antibody according to the present invention, or separately, may comprise any such agent known in the art exhibiting anticancer activity, including but not limited to: mitoxantrone, topoisomerase inhibitors, spindle poison vincas: vinblastine, vincristine, vinorelbine (taxol), paclitaxel, docetaxel; alkylating agents: mechlorethamine, chlorambucil, cyclophosphamide, melphalan, ifosfamide; methotrexate; 6-mercaptopurine; 5-fluorouracil, cytarabine, gemcitabin; podophyllotoxins: etoposide, irinotecan, topotecan, dacarbazin; antibiotics: doxorubicin (adriamycin), bleomycin, mitomycin; nitrosoureas: carmustine (BCNU), lomustine, epirubicin, idarubicin, daunorubicin; inorganic ions: cisplatin, carbop latin; interferon, asparaginase; hormones: tamoxifen, leuprolide, flutamide, and megestrol acetate.
According to a specific embodiment, the chemotherapeutic agent is selected from the group consisting of alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodophyllotoxins, antibiotics, L- asparaginase, topoisomerase inhibitor, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog. According to another embodiment, the chemotherapeutic agent is selected from the group consisting of 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel and doxetaxel. Two or more chemotherapeutic agents can be used in a cocktail to be administered in combination with administration of the anti-CEACAMl antibody.
The following examples are intended to illustrate how to make and use the compounds and methods of this invention and are in no way to be construed as a limitation. Although the invention will now be described in conjunction with specific embodiments thereof, it is evident that many modifications and variations will be apparent to those skilled in the art. Accordingly, it is intended to embrace all such modifications and variations that fall within the spirit and broad scope of the appended claims. EXAMPLES
Means for preparing and characterizing antibodies are well known in the art. A description follows as to exemplify techniques for the production, characterization and use of anti-CEACAMl antibodies in accordance with the present invention.
Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, "Molecular Cloning: A laboratory Manual" Sambrook et al., 1989; "Current Protocols in Molecular Biology" Volumes I-III Ausubel, R. M., ed. 1994; Ausubel et al, "Current Protocols in Molecular Biology", John Wiley and Sons, Baltimore, Maryland 1989; Perbal, "A Practical Guide to Molecular Cloning", John Wiley & Sons, New York 1988; Watson et al., "Recombinant DNA", Scientific American Books, New York; Birren et al. (eds) "Genome Analysis: A Laboratory Manual Series", Vols. 1-4, Cold Spring Harbor Laboratory Press, New York 1998; methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; "Cell Biology: A Laboratory Handbook", Volumes I-III Cellis, J. E., ed. 1994; "Current Protocols in Immunology" Volumes I-III Coligan J. E., ed. 1994; Stites et al. (eds), "Basic and Clinical Immunology" (8th Edition), Appleton & Lange, Norwalk, CT 1994; Mishell and Shiigi (eds), "Selected Methods in Cellular Immunology", W. H. Freeman and Co., New York 1980; available immunoassays are extensively described in the patent and scientific literature, see, for example, U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876; 4,879,219; 5,011,771 and 5,281,521; "Oligonucleotide Synthesis" Gait, M. J., ed. (1984); "Nucleic Acid Hybridization" Hames, B. D., and Higgins S. J., eds. 1985; "Transcription and Translation" Hames, B. D., and Higgins S. J., Eds. 1984; "Animal Cell Culture" Freshney, R. I., ed. 1986; "Immobilized Cells and Enzymes" IRL Press, (1986); "A Practical Guide to Molecular Cloning" Perbal, B., 1984 and "Methods in Enzymology" Vol. 1-317, Academic Press; "PCR Protocols: A Guide To Methods And Applications", Academic Press, San Diego, CA 1990; Marshak et al, "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" CSHL Press 1996. The procedures therein are believed to be well known in the art.
Example 1: Generation and characterization of monoclonal antibodies which recognized CEACAM
Monoclonal antibodies that effectively block the CEACAMl homophilic interactions in vitro at nanomolar concentrations were generated by immunizing mice with recombinant human CEACAMl protein. Hybridomas producing the CEACAMl -blocking antibodies were produced and re-cloned several times to yield a stable clone.
The DNA and amino acid sequence of one exemplary monoclonal antibody which recognizes CEACAMl was determined by Fusion Antibodies Ltd. mRNA was extracted from the hybridoma cell pellets and total RNA was extracted from the pellets using RNA extraction protocol. RT-PCR-cDNA was created from the RNA by reverse-transcription with an oligo(dT) primer. PCR reactions using variable domain primers were used to amplify both the VH and VL regions of the monoclonal antibody DNA.
The VH and VL products were cloned into the Invitrogen sequencing vector pCR2.1 and transformed into TOP 10 for positive transfomants. Selected colonies were picked and analyzed through sequencing. The resulted DNA and amino acid sequences determined are:
Variable heavy chain (VH)
DNA sequence of the VH domain:
ATGGGATGGACCTTGGTCTTTCTCTTTCTCCTGTCAGTAACTGCAGGTGTTCACTC CCAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGGCCTGGGACTTCAGT GAAGGTGTCCTGCAAGGCTTCTGGATACGCCTTCACTAATAACTTGATAGAGTGG GTAAAACAGAGGCCTGGACAGGGCCTTGAGTGGATTGGAGTGATTAATCCTGGA AGTGGTGATACTAACTACAATGAGAAGTTCAAGGGCAAGGCAACACTGACTGCA GACAAATCCTCCAACACTGCCTACATGCAGCTCAGCAGCCTGACATCTGATGACT CTGCGGTCTATTTCTGTGCAAGAGGGGATTACTACGGTGGCTTTGCTGTGGACTA CTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACGACACCCCCATCC GTTTATCCCTTGGCCCCTGGAAGCTTGGG (SEQ ID NO: 25). Amino acid sequence of the VH domain:
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWG QGTSVTVSS (SEQ ID NO: 26).
Variable light chain (VL)
DNA sequence of the VL domain:
ATGGTGTCCTCAGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGAACCAG ATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGAC AGAGTCACCATCAGTTGCAGGACAAGTCAGGACATTGGCAATTATTTAAACTGG TATCAGC AGAAACC AGATGGAACTGTTAAACTCCTGATCTACTACAC ATC AAGAT TACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTC TCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAG GGTAAAAGCCTTCCTCGGACGTTCGGTGGAGGCACCAAGTTGGAAATCAAACGG GCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACAT CTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAGAGA (SEQ ID NO: 27).
Amino acid sequence of the VL domain:
DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSGV PSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK (SEQ ID NO: 28).
N-terminal amino-acid sequencing and Mass-Spectra analysis were used to confirm the VL and VH identities.
Example 2: Verification of N-terminal amino acid sequence
Amino acid sequence analysis of the light chain was performed by the Edman degradation method to verify the N-terminus sequence of the light chain of one of the monoclonal antibodies. The obtained N-terminal sequence was: DIQMTQTTSS (SEQ ID NO: 29), which is in accordance with the N-terminal expected sequence based on the DNA sequence.
Example 3: Complementary determining region (CDR) sequences
The CDR segments were identified using two different algorithm methods:
1. IMGT algorithm (Lefranc et al, 1999, Nucleic Acids Research, 27, 209-212);
2. KABAT algorithm (Wu TT and Kabat E.A., 1970, J. Exp. Med. 132, 211-250). Table 1 summarizes the determined CDR sequences using the two methods as well as the minimal consensus sequence and combined sequence of sequences identified using both methods.
Table 1. CDR sequences
Figure imgf000041_0001
* wherein Xi is absent or is Thr (T) and X2 is absent or is He (I)
Example 4: Design and production of a chimeric monoclonal antibody
The DNA sequence of the variable heavy and light chains (SEQ ID NOs 25 and 27) were used to construct a chimeric antibody, comprising the human IgGl isotype constant domains and constant light (CL) human IgKappa domain. Although the parent monoclonal antibody is mouse IgGl and its human equivalent is IgG4, a human IgGl framework was used to construct some of the chimeric antibodies of the present invention. The DNA sequences for the light chain and heavy chain were synthesized and cloned into the expression vector pFUSION-DHFRl under separate promoters.
Transient Transfection of CHO cells
Suspension CHO cells (Invitrogen, UK) were cultivated at 130rpm, 8% C02, 37°C in Pro CHO 5 serum free medium (Lonza, UK) in 250 and 500ml vented Erlenmeyer flasks (Corning, Netherlands). On the day of transfection, cells were seeded at a density of 2.0 X 106 cells/ml, 2.5g/ml of plasmid DNA (Geneart , Germany) was transfected into the cells using Polyethylenimine (Polysciences Inc, PA, US). Transfected cultures were incubated at 130 rpm, 8% C02, 37°C for 9-10 days. Prior to harvest of the culture supernatants were spinned at 4,000 rpm for 40 minutes.
Media was harvested and purified in two separate batches. The media was filtered through a 0.8μιη gyrodisc filter and purified using a 1ml Protein A column. The antibody was purified by FPLC. 320ml sample was loaded at 0.2mls/min overnight and increased to 0.5mls/min after 17 hours. Column was washed/equilibrated with PBS at 0.5mls/min before elution with pH 3.0 Gly/HCL elution buffer. A good peak was observed and fractions 1 to 5 were quantified by Bradford Assay. The Bradford assay showed protein present in fractions 1-4 which were pooled and dialyzed for buffer exchange overnight in 1 liter of PBS (4°C, 120 RPM). A concentration of 1.823 mg/ml was observed for the 4 ml sample, therefore a total yield of approximately 7.32 mg was purified. In the second batch, the results of the Bradford assay showed protein present in fractions 1-3 which were pooled and dialyzed. From the 320 ml conditioned medium a total yield of approximately 7.32 mg was purified (batch A). From a 910 ml culture a total yield of approximately 15.74 mg was purified (batch B). Total transient expression yielded about 23 mg of purified protein. After concentration determinations and SDS/PAGE analysis, 19.65 mg of the chimeric antibody were yielded. The purified antibody samples were analyzed by SDS-PAGE to assess purity. Figure 1 depicts the SDS-PAGE gel image showing light and heavy chains of the chimeric antibody. MS analysis revealed that the molecular weight of CMIO heavy chain is 48.6 KDa and of light chain is 23.3 KDa.
The resulted antibody, denoted CMIO, has the following amino acid sequence of the heavy and light chains:
Heavy chain amino acid sequence (without signal peptide):
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWG
QGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV
HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYIC VNHKPSNTKVDKKVEPKSCDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 30).
Variable domain is in bold, CDRs according to IMGT are underlined.
Light chain amino acid sequence (without signal peptide):
DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSG VPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:31)
Variable domain is in bold, CDRs according to IMGT are underlined. A plasmid containing the DNA sequences of the heavy and light chains of an exemplary chimeric monoclonal antibody denoted CM 10 was deposited on September 28, 2011 under ATCC Accession Number PTA-12130. Example 5: Affinity characterization of the chimeric monoclonal antibody CM10
Binding of CM 10 to purified human CEACAM1
The binding specificity of CM 10 to human CEACAM1 was tested in ELISA assay using purified human CEAC AMI . Indirect ELISA using 23 double dilutions of CM 10 were used to generate specific binding curve. The results shown in Figure 2 represent average O.D. from triplicate ± SE. Similar results were obtain from other ten independent experiments.
In order to test whether the chimerization process affect the binding affinity of the antibody, the chimeric antibody CM 10 was evaluated for CEAC AMI binding by competitive ELISA and by BIAcore analysis.
For the ELISA, recombinant purified human CEAC AMI was bound to the plate. The chemically biotinylated CM 10 was used as tracer at a constant concentration and was competed with increasing concentrations of unlabelled CM 10. Following incubation and washing, the plate was developed with a StrepAvidin- HRP conjugate and the color reaction was developed with TMB as an HRP substrate.
Using 50 ng/ml of tracer, the apparent affinity values detected for CM10 were 1.2-1.6 iiM.
BIAcore analysis
Each antibody was immobilized onto a single channel of a CM5 sensor chip of Biacore3000 instrument by NHS-EDC coupling chemistry.
Recombinant CEAC AMI was flowed at 50 μΐ/min over the chip in various concentrations (0.19, 0.39, 0.78, 1.56, 3.12, 6.25, 12.5 and 25nM). The running buffer was PBS-ET( lOmM p-buffer pH7.4, 150mM NaCl, 3.4mM EDTA and 0.005% tween 20). The data were analyzed using BIAEvaluation software 3.0 and the KD values of CM 10- CEACAM1 affinity, calculated from three independent experiments were (KD): 4.07- 5.05 iiM (average 4.56 iiM).
Binding specificity of CM 10 to membrane-bound endogenous CEAC AMI
In order to test the binding of CM 10 to membrane-bound endogenous CEACAM1, a FACS analysis was performed. Several human melanoma cell lines were screened for hCEACAMl expression while 526mel cell line was used as positive control and 003mel as negative control line. 526mel, 003mel, Malme 3M, Skmel 5 and A375 cell lines were stained with CM 10. Empty histograms represent mAb staining while darker histograms represent background staining. At least 5000 cells were used to analyze CEACAMl expression in each histogram.
As can be appreciated from Figure 3, CM 10 detects membrane-bound endogenous
CEACAMl . Malme3M and Skmel5 cell lines showed high expression of CEACAMl while no expression could be detected in A375 melanoma cell-line.
Conclusion
The chimerization process was carried out successfully. The chimeric antibody bind CEACAMl in an affinity of 1.4 nM as validated by two different approaches The FACS analysis testing the binding specificity of CM 10 to various melanoma cell lines, demonstrate that the antibody retained its biological binding ability.
Example 6. Assessing the activity of CM 10
Blocking cell-cell interaction assay
The assay which determines the ability of anti CEACAMl mAb to blocks CEACAMl cell-cell interaction uses murine T cells (BW cells) that are stably transfected with a chimeric molecule composed of the extracelluUar portion of human CEACMAl fused to mouse z-chain (BW/CEACAM1). Engagement of CEACAMl by co-incubation of BW/CEACAM1 cells with B cells stably transfected with CEACAMl (221 /CEACAMl), lead to the secretion of mouse IL-2, mediated by the z-chain.
Effectors cells (BW, expressing CEACAMl) were incubated in the presence of CM 10 or PBS for 30 minutes on ice. Following the incubation the effectors cells were co-culture over night with target cell expressing CEACAMl (221+) or negative to CEACAMl (221-). Mouse IL-2 secretion was measured by commercial ELISA. The results shown in Figure 4 represent average IL-2 secretion from duplicate wells. As shown in the figure, upon addition of CM 10, CEACAMl -mediated cell-cell interactions between T and B cells were abolished in a dose- depended manner as indicated by blockage of IL-2 secretion.
In- vitro immunomodulatory killing assays
T cells Killing assay: Melanoma-reactive T cells TILs (Tumor Infiltrating
Lymphocytes, derived from melanoma patients) can destroy melanoma cells with matched HLA. TILs were purchased from ELLA Institute at Shiba medical center and were growth according to the clinical lab protocols. CFSE-labeled melanoma cells (SKmel5) were pre- incubated with CM10 (10μg/ml) for 30 minutes on ice. TIL were added for additional 10 hours incubation at 37°C. Percentage of killing was determined by Pi-staining of the CFSE labeled melanoma cells. Effector-to-target ratio was 5: 1. In another assay, CFSE-labeled melanoma cells were pre -incubated with CM 10 for 30 minutes on ice. TIL were added for additional 5 hours incubation at 37°C. Percentage of killing was determined by Pi-staining of the CFSE labeled melanoma cells. Results represent average of % specific killing from triplicate wells ±SE per treatment. Effector-to-target ratio was 5: 1.
The results describes in Figure 5 show that the killing activity of T cells is enhanced in the presence of the anti CEACAM1 mAb, CM10. Furthermore, in assay conditions where TILs where unable to kill any melanoma cells (short incubation or low TIL ratio), addition of CM 10 stimulated the killing activity of TILs while no killing could be detected with IgGl isotype control (Figure 6).
N cells Killing assay
Natural killer cells (NK cells) are a type of cytotoxic lymphocyte that can destroy malignant cells by releasing small proteins called perforin and granzyme that cause the target cell to die by apoptosis. NK cells can by activated throw several different pathways among them cytokines, FC receptor, and MHC class 1 absence at the target cells. Several activation and inhibition receptors to various ligands on target cells regulate the final cytoxicity activity of NK cells. NK 92MI cells are IL-2 independent NK cell line that were purchased from the ATCC.
NK 92MI were incubated with CM 10 (0^g/ml, 1 μg/ml or 5 μg/ml) or isotype match control Ab (5 μg/ml) for 30 minutes at 37°C, target cells expressing CEACAM1 were added for additional 5 hours. Percentage of killing was determined by classical LDH release assay. Results represent average of % cytotoxicity from triplicate wells ±SE per treatment. Effector- to-target ratio was 2.5: 1.
The assay describes in Figure 7 shows that CM 10 strongly enhanced the killing activity of NK cells on two melanoma cell lines expressing CEACAM1 (SKMel 5 and G361), compare to PBS or isotype match IgG. Similar results have been demonstrated in two other CEACAM1+ melanoma cell lines and in various effector-to-target (E:T) ratios.
Antibody-Dependent Cell-mediated Cytotoxicity
Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) is a mechanism of cell- mediated immunity whereby an effectors cell of the immune system (mostly NK cells) actively lyses target cells that has been bound by a specific antibody. In order to access the safety profile of CM 10 we have conducted preliminary ADCC assay where the ability of CM 10 to induce ADCC was examined in three melanoma cell lines (CEACAM1 positive cell lines: G361 and SKmel5 and CEACAM1 negative cell line: SKmel28).
The ability of CM 10 to induce ADCC was examined in comparison to a positive control antibody (Polyclonal Ab anti CEACAM1 that showed ADCC activity in preliminary experiment). Isotype matched antibody served as negative control (hlgGl K). The results indicate that CM 10 do not trigger ADCC in the setting tested.
Complement-Dependent Cytotoxicity
Complement proteins are found in the blood, and their action "complements" the work of antibodies. Complement-dependent cytotoxicity (CDC) is a mechanism of killing cells in which antibody bound to the target cell surface fixes complement, results in assembly of the membrane attack complex that create pores in the target cell membrane and finally lead to cell lyses.
In order to access the safety profile of CM 10, the ability of CM 10 to induce CDC was examined in two melanoma cell lines (SKmel28 and SKmel5) expressing CEACAM1. Commercial pooled human serum was used as complement proteins source. The commercial monoclonal antibody Rituximab incubated with Daudi cells was used as the assay positive control and commercial IgGlK as isotype match control to CM 10. Melanoma cell lines - SKMEL5 and SKMEL28 or positive control Daudi cells were incubated with CM 10 or Rituxiamab respectively for 1 hour in room temperature followed by the addition of normal human serum at a final concentration of 50% for 2 additional hours in a humidified incubator (37°C, 5% C02). The percent of lysed cells was determined by Propidium iodine (PI) staining. The results (Figure 14) represent the average + S.E of 2 individual experiments preformed in duplicates, indicating that CM 10 did not induce CDC lysis in the setting tested. In-vivo efficacy experiment
The purpose of this experiment is to test the direct effect of CM 10 on melanoma cells in-vivo, as well as to evaluate the immunomodulatory effect, which is missing in the xenograft setting.
Calibration of xenograft experiments
CEACAM1 positive human melanoma cell line purchased from "ATCC" (SKMel5) and NOD-SCID, age matched mice from "Harlan laboratories" were used. The calibration assay was conducted in order to monitor the growth of the tumors and to find the optimal TILs regime. SKMel5 melanoma cells were injected SC (subcutaneous) to SCID-NOD mice and tumor volume was monitored by physical measurements. When the tumor volume reached 100mmA3, the mice where divided into 5 randomized groups. The TILs were injected either IT (Intra Tumoral) at two different concentrations or IV (Intra Venus) at one concentration (20X10A6 per mice) while one group received only one injection and the second group received 2 TIL injections. Each TIL injection was followed by 5 days of hIL-2 administration. The calibration experiment demonstrated that TIL IV injection has higher effect on tumor size than IT administration. In addition repetitive TIL regime provides better tumor growth inhibition over single injection, as could be predicted from T cells half life. Based on this data, TIL will be administrated every 10 days by IV injections, in future xenograft experiments.
In-vivo immunomodulatory, anti-cancer activity of CM 10
Human CEACAMl positive SKmel5 melanoma cells were injected SC to SCID-NOD mice. When the tumors reached a volume of approximately 100mm3, the mice were randomized to one of the following treatment groups: a) Weekly IV injections of PBS; b) Weekly IV injections of 0.45mg CM10; c) Three IV injection of 20xl06 anti-tumor reactive human T cells (TIL) and weekly IV injections of PBS; d) Three IV injections of 20xl06anti- tumor reactive human T cells and weekly IV injections of 0.45mg CM 10. A person blind to the experimental setting measured the tumors volume 2-3 times per week. The results of Figure 8 represent average tumor volume ±SE from 6-10 mice per group. Arrows indicate time of administration (CM10 cyrcle, TIL triangles, CM10 and TIL open squares). As shown, a moderate inhibition of tumor growth was observed either with CM 10 alone or with TIL only, but the differences did not reach statistical significance when compared to the control treatment. Strikingly, the combination of adoptive human T cell transfer with CM 10 injections exhibited significant synergism and strongly inhibited xenograft growth. This observation concurs with the in-vitro data showing the potentiating effect of CM 10 on T cell killing (Figures 5 and 6).
Significant growth inhibition was observed in the group treated with CM 10 in the presence of TIL. These results reinforce the immunostimulatory effect of anti CEACAMl mAb in different cell lines, and indicate that CM 10 can be used as promising immunomodulatory antibody. This observation concurs with the in-vitro data showing the stimulatory effect of CM 10 on melanoma cells killing by T cell.
Conclusions
CEACAMl is known as a regulator of lymphocyte activation. CM 10 is an antibody that blocks the interactions between two CEACAMl molecules (Figure 4) and therefore eliminates the inhibitory signals mediated by CEACAMl, results in stronger cytotoxic lymphocytes activation against tumor cells (Figures 6 and 7). The in-vivo xenograft result (Figure 8) reinforce the immunomostimulatory nature of CM 10 and demonstrate significant growth inhibition of tumors in mice treated with CM 10 in the presence of TIL. The scheme presented in Figure 9 demonstrates a non- limitative theory of the mode of action of CM 10 that prevents CEACAMl -CEACAMl interaction enabling activation of killing signals by immune system cells.
Example 7: CM10 in-vitro safety assessment
The effect of CM 10 on normal human cells
In order to evade from the immune system cancer cells alter the expression of many molecules. Several evidences have showed that CEACAMl expression is increasing during the malignance transformation of melanoma cells. According to the literature CEACAMl is also expressed on normal cells, therefore it is important to map the possible binding sites of CM 10 in the body and to identify if binding of CM 10 to normal cells may lead to any undesired outcome.
Normal human tissues cross reactivity
In this study, the binding intensity of anti-CEACAMl mAb in a human tissue microarray containing normal and malignant melanoma samples was examined. The binding intensity was assessed using a standard pathological scoring system. Tissue micro array (TMA) containing 100 cases of malignant melanoma (primary, metastasis) and of benign nevi were analyzed for anti CEACAMl binding intensity by standard IHC procedure. Each core of tumor was graded from 0 to +3. As shown in Figure 10, binding intensity of anti- CEACAMl mAb was seen in more than 50% of the melanoma samples and in 65% of metastatic melanoma samples.
The multi normal human organ tissue microarray (TMA) included 33 types of normal organs, each type taken from 3 normal human individuals. The age ranged from 2 - 67 years, 43 specimens were derived females and 57 specimens from males. The following tissues were negative for anti-CEACAMl mAb binding: Cerebrum, cerebellum, ovary, pancreas, parathyroid gland, hypophysis, thyroid gland, tonsil, bone marrow, spleen, thymus, lung, cardiac muscle, stomach, skeletal muscle, skin, peripheral nerves, mesothelium and retina. A cell-specific staining was detected in some organs, mainly on the luminal side of epithelial cells forming ducts or glands in hollow visceral organs such as: brush border of small intestine; some apical colonic glands; Breast ductal epithelium; Liver bile canaliuculi; inner surface of renal tubules; few Endometrial glands ;luminal part of Salivary gland. In addition, some low cellular staining was observed in adrenal gland cortex, apical surface of prostatic glands, Leidig cells of testis and single scattered cells in the pancreas. The only cells of the immune system that found positive were neutrophils within capillaries. No staining of lymphocytes was found in tissues and lymphatic organs. Finally, weak to moderate positive staining was found in endothelial cells of small blood vessels at selective sites, including: ovary, adrenal gland, kidney, and rarely in pancreas, prostate, hypophysis and endometrium.
The IHC analysis showed a strong anti CEACAMl staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in the luminal aspect of epithelial cells of ducts or glands in hollow viscera. This cellular aspect is generally less accessible to an antibody administered via the peripherally blood.
Quantification of CM 10 molecules bound per cell
In order to quantify the exact number of CM 10 molecules bound to each cell types the QuantiBRITE kit was used. Using the kit the MFI (mean florescence intensity) was directly translated to the number of molecules bound per cell. Three human primary cells of tissues, which were found to be positive for anti-CEACAMl binding, were purchased from ATCC. HUVEC cells to represent the positive staining found in endothelial cells; primary prostate epithelial cells, since the apical surface of prostate glands showed positive staining, and primary renal proximal tubule epithelial cells since the inner surface of tubules stained positive. In more details, SkMel 5, G361, Malme 3M, NK 92MI, HUVEC, Renal primary cells and prostate primary cells were grown according to ATCC protocols. CM 10 was conjugated to a PE molecule (RPE LYNX Rapid Conjugation Kits Serotec) according to the manufacture's protocol and was used (^g/ml) with the QuantiBRITE PE beads kit (BD) to determine the ABC (antibodies bound per cell) by Flow cytometry. The number of CM 10 molecules bound per cell was analyzed using flow cytometry in the indicated primary cells in comparison to melanoma cell lines. At least 10000 cells were counted for each cell line.
Quantitative analysis (Figure 11 , the results represent the average of 2-3 independent experiments ± SE) showed that the CEACAMl -positive melanoma cells bind between 20,000-50,000 CM 10 molecules, while normal endothelial and epithelial cells (e.g. HUVEC, Kidney and Prostate) which have been reported to exert some CEACAMl expression, bind up to 2,000 CM10 molecules only. Furthermore, high numbers of CM10 antibodies were bound to the NK cells (~ 20000) which correlates with published data showing high CEACAMl expression on activated lymphocytes. These results reinforce the safety profile of CM 10 (low expression on primary cells) and its activity (NK results) as a player in activated lymphocyte-mediated cell lysis. Proliferation of human primary cells in the presence of CM 10
Since some positive staining was found in normal tissues the effect of CM 10 on primary cell growth was examined. HUVEC and primary prostate cells were grown according to the ATCC protocols and were monitored for cell proliferation using XTT standard assay. No effect on cell-proliferation could be detected.
Summary
The binding profile of anti CEACAMl mAb to normal tissues and melanomas cells was identified. CEACAMl is absence on normal melanocytes but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens (Figure 10), in other normal organ there is restricted expression of CEACAMl in specific cells within several tissues. A quantitative analysis, measuring the number of CM10 molecules that are bound to cells, revealed a very low numbers of bound-CMlO on normal human primary cell (Figure 11). These results imply that the majority of CM10 molecule injected to patients will mainly target cancer cells and not normal tissues due to expression differences. Furthermore, CM 10 has no effect on cell proliferation, CDC activity, and negligible or low ADCC activity which suggests that the binding of CM 10 to non-target cells, would not result in unwanted cell outcome.
The effect of CM 10 on the immune system
CM 10 is an immunostimulatory antibody that blocks the interaction between two CEACAMl molecules and by doing so mediates stimulation of lymphocytes against malignant cells. It is important to verify that the antibody will not cause unleashed stimulation of the immune system which can cause severe adverse events. In normal lymphocytes there is a neglect expression of CEACAMl on the cell membrane, only following cell activation CEACAMl is mobilized to the membrane, where it rapidly and strongly up-regulated on activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46). As demonstrated above, no cross reactivity to normal lymphatic tissues (Spleen, Thymus, Bone Marrow) or to lymphocytes was observed; nevertheless various in- vitro and ex-vivo immuno-toxicity analyses were performed to help in predicting potential side effects.
The effect of CM 10 on human lymphocytes proliferation
One of the most common and acceptable ways to evaluate safety of immunomudulatory antibodies in- vitro is by examine its effects on proliferation and cytokine secretion of normal human PBMC (peripheral blood mononuclear cells). Human PBMC from 3 unrelated donors were isolated and incubated with CM 10 using 3 different concentrations (2μg/ml, 20μ /ηι1 or 200μ /ηι1) or with a control mAb IgGlK (200μ§/ηι1) for 60 minutes and with eight replicate wells. PHA (1 μ§/ι 1) was added to 4 of the assay replicate wells and cells were incubated for 96 hours. 3H-Thymidine incorporation used to assay cell proliferation. Mock stimulated cells and PHA only stimulated cells used as assay's negative and positive controls respectively. The proliferation was assessed in resting lymphocytes as well as in activated lymphocytes (PHA treated). Mock stimulated cells and PHA only stimulated cells used as assay's negative and positive controls respectively. The results (Figure 12) clearly show that CM 10 has no effect on the proliferation of naive or activated human lymphocytes. In addition to the PBMC proliferation study, the effect of CM 10 on cytokine secretion from human PBMC is assessed. Cytokine secretion studies define the immunomodulatory effect of CM 10 and assist in predicting potential side effects.
Example 8. CM10 selectivity panel.
Characterization of the binding profile was performed using Cell lines over- expressing the different CEACAM family proteins and flow cytometry analysis. .
In humans, the CEA family is encoded by 18 genes and 11 pseudogenes on chromosome 19ql3.2. Several closely related members belong to the CEACAM family (CEACAM 1,3, 4, 5, 6, 7, 8) and are differentially expressed by various human cell types. The CEACAM proteins have been implicated in various adhesion mediated effects that govern the growth and differentiation of normal and cancerous cells (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46). The closely related proteins in the family share a high amino acid similarity that varies from 45% up to 90% similarity between certain members.
A standard FACS protocol was used with CM 10 conjugated to a Biotin molecule and Strep-Avidin APC as secondary agent. 721.221 cells expressing CEACAM 1,5,6,8 or HEK 293 T transient expressing CEACAM 3, 4, were stained with biotinylated CM 10 (^g/ml) and Strep-Avidin APC as secondary agent. Empty histograms represent mAb staining while red histograms represent background staining. At least 10000 cells were used to analyze CM 10 binding in each histogram. FAB was calculated by dividing the MFI of the stained cells in the MFI of the background staining. The results demonstrated in Figure 13, clearly indicate that CM 10 bind strongly to cells expressing CEACAM 1. Moderate staining was observed in cells expressing CEACAM3 and 5. Weak or neglect binding was demonstrated in cells expressing CEACAM 4, 6, 8. Conclusions
CM 10 is a mAb developed to recognize human CEACAM1, a protein that was found to be associated with cancer, in general, and with Melanoma in particular. The over- expression of CEACAM1 has been identified in a few malignancies among them melanoma, NSCLC, Thyroid cancer and gastric cancer. The evidence indicates that over-expression of CEACAM1 can be correlated with poor prognosis in melanoma and NSCLC patients.
CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70%> of non-small cell lung cancer cells and 50% of breast cancers. It is also over-expressed in thyroid, stomach, ovarian and uterine cancers (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30). The evidence that CM 10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM 10 from 4-5 types of malignancies to above 10. The anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies. It seems that even these toxic conjugated forms don't show safety problems, which can indicate that CEACAM5 is a safe target (Liersch, et al. 2005, J Clin Oncol 23(27), 6763-70; Ychou, et al. 2008, Clin Cancer Res 14(11), 3487-93). On the other hand, none of these agents target the immunological regulation of tumors, which can be targeted by an antibody which can bind both CEACAM1 and CEACAM5, such as CM10.
Example 9: Epitope mapping of CM10
To reconstruct discontinuous epitopes of the target molecule, a library of structured peptides was synthesized. The target molecule was the N-domain of the human CEACAM1 molecule having the sequence:
1 QLTTESMPFN VAEGKEVLLL VHNLPQQLFG YSWYKGERVD GNRQIVGYAI 50
51 GTQQATPGPA NSGRET IYPN ASLLIQNVTQ NDTGFYTLQV IKSDLVNEEA1 00
101 TGQFHVYP1 08 (SEQ ID NO:35).
The library was synthesized using Pepscan's Chemically Linked Peptides on Scaffolds (CLIPS) technology which allows to structure peptides into single loops, double-loops, triple loops, sheet-like folds, helix-like folds and combinations thereof (Timmerman et al. 2007, J. Mol. Recognit. 20:283-99 and Slootstra et al. 1996, Molecular Diversity 1: 87-96). CLIPS templates are coupled to cysteine residues. The side-chains of multiple cysteines in the peptides are coupled to one or two CLIPS templates. For example, a 0.5 mM solution of the T2 CLIPS template 1,3-bis (bromomethyl) benzene is dissolved in ammonium bicarbonate (20 mM, pH 7.9)/acetonitrile (l : l(v/v). This solution is added onto the peptide arrays. The CLIPS template will bind to side-chains of two cysteines as present in the solid-phase bound peptides of the peptide-arrays (455 wells plate with 3 μΐ wells). The peptide arrays are gently shaken in the solution for 30 to 60 minutes while completely covered in solution. Finally, the peptide arrays are washed extensively with excess of H20 and sonicated in disrupt-buffer containing 1 percent SDS/0.1 percent beta-mercaptoethanol in PBS (pH 7.2) at 70°C for 30 minutes, followed by sonication in H20 for another 45 minutes. The T3 CLIPS carrying peptides were made in a similar way but with three cysteines.
A total number of 3002 peptides was synthesized that includes: CLIPS matrix set combining two different areas of the entire protein wherein native cysteines are replaced by alanines; Linear peptide sets of length 6,10,15,20,25 and 33; Linear peptide sets of length 15, where the middle residue is replaced by alanine; CLIPS conformational loop set of length 15 wherein native cysteines are replaced by alanines; and CLIPS conformational loop set of length 15 with the middle residue replace by alanine wherein native cysteines are replaced by alanines.
The binding of antibody to each of the synthesized peptides was tested in a PEPSCAN-based ELISA. The peptide arrays were incubated with primary antibody (CM 10) solution (overnight at 4°C). After washing, the peptide arrays were incubated with a 1/1000 dilution of an antibody peroxidase conjugate for one hour at 25°C. After washing, the peroxidase substrate 2,2'-azino-di-3-ethylbenzthiazoline sulfonate (ABTS) and 2 microliters/milliliter of 3 percent H202 were added. After one hour, the color development was measured. The color development was quantified with a charge coupled device (CCD) - camera and an image processing system.
The values obtained from the CCD camera range from 0 to 3000 mAU, similar to a standard 96-well plate ELISA-reader. The results are quantified and stored into the Peplab database. The binding values are extracted for analysis using graphical representation of data where the valuses taken by a variable in a two-dimensional map are represented as colors.
Based on the observed binding patterns, the core of the epitope of CM10.S91 consists of residues i7VLLLVFINLPQQLF29. A secondary binding region was observed on sequence around 68YP ASLLIQNVT79. When the observed binding patterns are compared to the available crystal structure of the target protein, it is proposed that the discontinuous epitope for CM10.S91 consists of i7VLLLVHNLPQQLF29 (core) together with 68PNASLLI75 (support). Example 10: Additional experiments assessing the activity of CM10
Granzyme B secretion by effector cells as a potential PD marker
The development of robust pharmacodynamic (PD) markers is critical for improving the success of drugs in clinical trials and assists in selection of an optimal drug dose to balance efficacy and toxicity. PD markers are often proximal in a molecular pathway to the drug target and are used to measure the effect of a drug regardless of therapeutic effect. Granzyme B is a serine protease that is released through cytoplasmic granules of cytotoxic T cells (CTLs) and NK cells upon recognition of specific targets. This in turn mediates the apoptosis of the target cells. We sought to determine if CM 10 enhances granzyme B secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody.
TIL were incubated with CM 10 (0^g/ml, ^g/ml, 5μg/ml or 10 μg/ml) or an isotype matched control Ab (IPI-Ipilimumab 10 μg/ml) for 30 minutes at 37°C; Target positive melanoma cells expressing CEACAM1 and HLA-A2 - SKMEL5, were added for an overnight incubation at effector-to-target ratio of 2.5: 1. Granzyme B secretion was measured by ELISA. Results represent the mean + S.E of granzyme B release values from 6 repeats per treatment. Similar results were seen in another independent experiment.
A represented in Fig 15 TIL secretes low initial levels of granzyme B that remained low in the presence of CM 10 alone. Only when the target cells were added to the TIL, granzyme B elevated dramatically. Yet, CM 10 was able to significantly increase granzyme B secretion above the high initial levels. Similar results were seen when NK92MI cells were used as effector cells demonstrating that CM 10 can enhance granzyme B secretion form NK cells in a similar manner. The use of Granzyme B as PD marker to CM 10 treatment is also examined in complementary set of experiments including in vivo models and patients specimens.
CM 10 blocks CE AC AM 1 -CE AC AM5 interactions
Carcinoembryonic antigen (CEA, CEACAM5, and CD66e) has been found to be associated with various types of cancers, particularly colorectal carcinoma, as well as gastrointestinal, pancreatic cancers, non-small cell lung cancer ,breast cancers , thyroid, stomach and ovarian cancer. The molecule has been developed to be a target for cancer diagnosis and therapy.
Homophilic CEACAM1 interactions between a MHC-I-deficient melanoma cell line and NK cells significantly inhibited killing of the cancer cells by the NK cells (Markel et al J Immunol. 2002;168:2803-2810). Similiarly, forced expression of CEACAM5 in HLA class
I-defective 721.221 cells also suppressed NK-mediated cytotoxicity (Stern et al J Immunol.
2005;174:6692-6701), indicating CE AC AM5 -CE AC AM 1 heterophilic interactions are also able to trigger inhibitory CEACAM1 signaling in immune cells.
CEACAM1 positive cell line (SKMel 5) was incubated with an isotype control or CM 10 in various concentrations, unbound CM 10 was washed twice, followed by incubation with or without soluble biotinylated CEACAM5. The binding of the biotinylated CEACAM5 to the cells was detected by a secondary strepavidin-APC and FACS analysis. The results represent the mean of duplicate wells + SE. Similar results were obtained in two other independent experiments.
The results of Fig 16 demonstrate that CM 10 inhibits the binding between
CEACAM1 to CEACAM5 in a dose-dependent manner Therefore CM 10 can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM1-CEACAM5 axis in order to suppress the immune cells.
CM 10 enhances HLA restricted T cell killing
Cytotoxic T cells destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. These cells recognize their targets by binding to antigens associated with HLA molecules, which are present on the surface of nearly every cell of the body. The killing of infected or malignant cells requires the recruitment of several pathways in order to generate proper response.
This set of assays was sought to determine if CM 10 enhances the "natural" CTL activity which is HLA restricted or alternatively causes a general stimulation of the immune system.
TIL were incubated with CM 10 (0^g/ml, ^g/ml, 5μg/ml or 10 μg/ml) or an isotype matched control antibody for 30 minutes at 37°C. Target melanoma cells SKMEL5, expressing CEACAM1 and HLA-A2 were pre -incubated with or without HLA-A2 blocking monoclonal antibody for 1 hour and were added for an overnight incubation at effector-to- target ratio of 2.5: 1. Killing was determined by standard LDH release assay. Results represent the mean + S.E of LDH release values from 3 repeats per treatment. The results in Fig 17 demonstrate that in the presence of HLA-A2 blocking antibodies CM 10 was unable to augment melanoma cell killing by the TIL and that CMlO's activity is HLA restricted. Similar result was seen in another independent experiment. It is therefore suggested that in accordance with these results CM 10 will improve the activity of CTLs against malignant cells in vivo and will not facilitate non-specific activation of the immune system.
The immunomodulatory activity of CM 10 inhibits tumor growth in- vivo
One of the most widely used models to assess the in vivo action of a novel anti cancer agents is the human tumor xenograft model. In this model, human tumor cells are transplanted under the skin into immunocompromised mice that do not reject human cells. Depending upon the number of cells injected and the cells' growth rate, the tumor develops over several weeks, and the response to appropriate therapeutic regimes can be studied in vivo. The advantage of a model that involves treatment in early stages of tumor formation is the opportunity to examine the agent's influence in a setting that can be more similar to metastasis spread in patients and to identify the effect of the treatment on initial tumor implantation.
The immunomodulatory activity of CM 10 in vivo was therefore examined in SCID- NOD mice engrafted with human melanoma cells under prophylactic treatment regime. SCID-NOD mice were randomized according to the five treatment groups indicated in figure 18. 6X106 SKmel5 cells (melanoma cell line) were injected SC in Day 0. Mice were treated with antibodies/TIL as indicated in the figure. Arrows indicate time of administration; Thin arrows represent antibodies-0.25mg/mouse/injection (CM 10, IgG control and Ipilimumab control) and wide arrows for TIL (20X10A6 cell per mouse per injection). The tumors' volume was blindly measured 2-3 times per week. The results represent average tumor volumes ±SE from 8-9 mice per group.
Fig 18 shows that the combination of adoptive human T cell transfer with CM 10 injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group (69% TGI). The results demonstrate that CM 10 also has an effect as a single agent (45% TGI at day 32) and probably worked directly on the tumor cells or the tumors' surroundings by inhibiting proliferation, angiogenesis or through other biological pathways.
In the same set of experiments the tumors' total weight was determined at the experiment termination day. The results obtained support the volume measurements, and show a dramatic decrease in the tumor burden of the TIL+ CM 10 treated group and also statistically significant reduction in the tumors' weight in the CM 10 treated group.
CM 10 enhances the immunomodulatory killing activity of NK cells on CEACAM1 -positive pancreatic cancer cell lines
Preliminary screening showed that pancreatic cancer cell lines and patient specimens express high levels of CEACAM1 (94% from pancreatic cancer specimens were CEACAM1 positive). Therefore, an experiment was conducted to examine if CM 10 can enhanced the activity of immune cells against pancreatic cancer cell lines. Killing assays were conducted by co-culture of NK92MI cells that were pre-treated with various concentrations of CM 10 with different CEACAM1 positive target pancreatic cancer cell lines. NK 92MI were incubated with CM10 (0^g/ml, ^g/ml or 10 μg/ml) or an isotype matched control Ab (10 μg/ml) for 30 minutes at 37°C; A. Target cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5: 1 (COLO-357) or overnight at an effector- to-target ratio of 5: 1 (BXPC3). Results represent an average of % cytotoxicity ±SE as determined by classical LDH release assay from triplicate wells per treatment.
The results represented in figure 19 show that although the killing of the pancreatic cancer cells by the NK cells was relatively low, CM 10 enhanced this activity by up to 2 folds from the baseline cytotoxicity (PBS or control Ab). Similar results were seen in additional two lines.
CM 10 enhances granzyme B secretion of NK cells in the presence of CEACAM1 -positive pancreatic cancer cell lines
The experiment was designed to determine whether similarly to the melanoma cells, CM 10 can enhance the secretion of granzyme B from NK cells in the presence of pancreatic cancer cells. In a similar setting to the killing assay, NK cells were pre-treated with various concentrations of CM 10 and then co-cultured with four different target pancreatic cancer cell lines. The supernatants were analyzed for granzyme B content by a specific ELISA. NK 92MI were incubated with CM10 (0^g/ml, ^g/ml or 10 μg/ml) or an isotype matched control antibody (10 μg/ml) for 30 minutes at 37°C. Target pancreatic cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5: 1 A. (COLO- 357 and ASPC-1) and B. (SU8686) or E:T of 10: 1 C. (BXPC3). Granzyme B secretion was measured by ELISA. Results represent the mean j^S.E of granzyme B release values from 2- 6 repeats per treatment.
Figure 20 clearly demonstrates that CM 10 increases granzyme B secretion from NK cells in the presence of pancreatic cancer cells. Example 11: Humanized and Human Antibodies
A humanized antibody typically has a human framework grafted with non human CDRs. Thus, a humanized antibody has one or more amino acid sequence introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al, Nature, 321 :522-525, 1986; Riechmann et al, Nature, 332:323-327, 1988; Verhoeyen et al, Science, 239: 1534-1536, 1988), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151 :2296, 1993; Chothia et al., J. Mol. Biol., 196:901, 1987). Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285, 1992; Presta et al, J. Immunol, 151 :2623, 1993).
It is further important that antibodies be humanized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.
Alternatively, it is now possible to produce transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (e.g., Jakobovits et al, Proc. Natl. Acad. Sci. USA, 90:2551, 1993; Jakobovits et al, Nature, 362:255-258, 1993; Bruggermann et al, Year in Immuno., 7:33, 1993; and Duchosal et al. Nature 355:258, 1992. Human antibodies can also be derived from phage-display libraries (Hoogenboom et al., J. Mol. Biol, 227:381, 1991; Marks et al, J. Mol. Biol, 222:581-597, 1991; Vaughan et al. Nature Biotech 14:309, 1996).
Example 12. Antibody Fragments
Various techniques have been developed for the production of antibody fragments.
Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24: 107-117, 1992 and Brennan et al, Science, 229:81, 1985). However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from the antibody phage libraries discussed above. Alternatively, Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab')2 fragments (Carter et al, Bio/Technology 10: 163-167, 1992). According to another approach, F(ab')2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv). Example 13. Potency of anti CEACAM antibody against viral infections
The following experiments are used to determine the potential of CM 10 against viral infection. The experiments include different target cells, various virus and several in vivo and in vitro models.
Detection/diagnosis: Examination of CEACAM expression level in cell lines and primary cells infected with different virus types, by FACS analysis, RT PCR and Immuno- histochemestry.
Prevention: pre-incubation of target cells with anti CEACAM antibody and determination of the viral load or viral replication post viral infection.
Treatment: after viral infection the infected cell are incubated with immune system cell and the killing ability of the effectors cells and the viral load is examined. In addition, the viral load and replication and overall survival are determined in vivo after virus infection and treatment with anti CEACAM antibodies.
The foregoing description of the specific embodiments will so fully reveal the general nature of the invention that others can, by applying current knowledge, readily modify and/or adapt for various applications such specific embodiments without undue experimentation and without departing from the generic concept, and, therefore, such adaptations and modifications should and are intended to be comprehended within the meaning and range of equivalents of the disclosed embodiments. It is to be understood that the phraseology or terminology employed herein is for the purpose of description and not of limitation. The means, materials, and steps for carrying out various disclosed functions may take a variety of alternative forms without departing from the invention.

Claims

1. A monoclonal antibody or an antibody fragment thereof which recognizes human CEACAM1 having a heavy-chain CDR1 comprising a sequence set forth in SEQ ID NO: 1, a heavy-chain CDR2 comprising a sequence set forth in SEQ ID NO: 2 a heavy-chain CDR3 comprising a sequence set forth in SEQ ID NO: 3, a light-chain CDR1 comprising a sequence set forth in SEQ ID NO: 4, a light-chain CDR2 comprising a sequence set forth in SEQ ID NO: 5 and a light-chain CDR3 comprising a sequence set forth in SEQ ID NO: 6, and analogs and derivatives thereof.
2. The monoclonal antibody or fragment thereof according to claim 1, comprising heavy chain CDR1 having the sequence set forth in SEQ ID NO: 7, heavy chain CDR2 having the sequence set forth in SEQ ID NO: 8 and heavy chain CDR3 having the sequence set forth in SEQ ID NO: 9.
3. The monoclonal antibody or fragment thereof according to claim 1, comprising heavy chain CDR1 having the sequence set forth in SEQ ID NO: 13, heavy chain CDR2 having the sequence set forth in SEQ ID NO: 14 and heavy chain CDR3 having the sequence set forth in SEQ ID NO: 15.
4. The monoclonal antibody or fragment thereof according to claim 1, comprising light chain CDR1 having the sequence set forth in SEQ ID NO: 10, light chain CDR2 having the sequence set forth in SEQ ID NO: 11 and light chain CDR3 having the sequence set forth in SEQ ID NO: 12.
5. The monoclonal antibody or fragment thereof according to claim 1, comprising light chain CDR1 having the sequence set forth in SEQ ID NO: 16, light chain CDR2 having the sequence set forth in SEQ ID NO: 17, and light chain CDR3 having the sequence set forth in SEQ ID NO: 18.
6. The monoclonal antibody or fragment thereof according to claim 1, having CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
7. The monoclonal antibody or fragment thereof according to claim 1, having CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
8. An analog or derivative of a monoclonal antibody or fragment thereof according to any one of claims 1-7, having at least 90% sequence identity with the antigen-binding portion of the said monoclonal antibody.
9. The monoclonal antibody or fragment thereof, according to claim 1, comprising a heavy chain variable domain sequence having a sequence set forth in SEQ ID NO: 26, or an analog or derivative thereof having at least 97% sequence identity with said heavy chain sequence.
10. The monoclonal antibody or fragment thereof according to claim 1, comprising a light chain variable domain sequence having a sequence set forth in SEQ ID NO: 28, or an analog or derivative thereof having at least 97% sequence identity with said light chain sequence.
11. The monoclonal antibody or fragment thereof according to claim 1 , comprising a heavy chain variable domain having a sequence set forth in SEQ ID NO: 26 and a light chain variable domain having a sequence set forth in SEQ ID NO: 28, or an analog or derivative thereof having at least 97% sequence identity with the antibody or fragment sequence.
12. The monoclonal antibody or fragment thereof according to claim 1, comprising:
i. a framework sequence selected from the group consisting of: mouse IgG2a, mouse IgG2b, mouse IgG3, human IgGl, human IgG2, human IgG3; and
ii. six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, wherein the monoclonal antibody or fragment binds with an affinity of at least about 5xlO"7M to at least two CEACAM subtypes.
13. The monoclonal antibody or fragment thereof according to claim 12 capable of binding with an affinity of at least about 10"8M to CEACAM 1.
14. The monoclonal antibody or fragment thereof according to claim 13 capable of binding with an affinity of at least about 5xlO"7M to at least one of CEACAM3 and CEACAM5.
15. The monoclonal antibody or fragment thereof, according to claim 12 wherein the monoclonal antibody or fragment is a chimeric monoclonal antibody.
16. The chimeric monoclonal antibody or fragment thereof according to claim 15, comprising human derived constant regions selected from the group consisting of: human IgGl, human IgG2, and human IgG3
17. The chimeric monoclonal antibody or fragment thereof according to claim 16, comprising the six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or the six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 95%> sequence identity with said CDR sequences, wherein the monoclonal antibody binds with an affinity of at least about 10"8M to CEACAMl .
18. The chimeric monoclonal antibody or fragment thereof, according to claim 17, comprising a constant region subclass of human IgGl subtype.
19. The chimeric monoclonal antibody or fragment thereof according to claim 17, comprising a heavy chain sequence set forth in SEQ ID NO: 30.
20. The chimeric monoclonal antibody or fragment thereof according to claim 17, comprising a light chain sequence set forth in SEQ ID NO: 31.
21. The chimeric monoclonal antibody or fragment thereof according to claim 17, comprising a heavy chain sequence set forth in SEQ ID NO: 30, and light chain sequence set forth in SEQ ID NO: 31.
22. A monoclonal antibody which recognizes CEACAMl produced from DNA sequences of the heavy and light chains contained in a plasmid deposited on September 28, 2011 under ATCC Accession Number PTA-12130.
23. A monoclonal antibody which recognizes CEACAMl, or a fragment thereof comprising at least the antigen-binding portion, which is capable of binding the same epitope on the CEACAMl molecule to which a monoclonal antibody having the six CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11 and 12, or the six CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17 and 18, binds.
24. The monoclonal antibody or fragment thereof of claim 23 wherein the antibody is reactive with an epitope within residues 17-29 and 68-79 of human CEACAMl having the sequences VLLLVHNLPQQLF (SEQ ID NO:32) and YPNASLLIQNVT (SEQ ID
NO:33) respectively.
25. The monoclonal antibody or fragment thereof according to claim 23, wherein the epitope on the CEACAMl molecule to which the monoclonal antibody binds is an epitope comprising amino acid residues within the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and YPNASLLIQNVT (SEQ ID NO: 33).
26. The monoclonal antibody or fragment thereof according to claim 23, wherein the epitope on the CEACAMl molecule to which the monoclonal antibody binds comprises at least four amino acids of the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
27. The monoclonal antibody or fragment thereof according to claim 23, wherein the epitope on the CEACAMl molecule to which the monoclonal antibody binds is na epitope within sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
28. An isolated peptide sequence of 6-20 amino acids comprising at least three amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32) and at least three amino acids from the sequence YPNASLLIQNVT (SEQ ID NO: 33), or an analog or derivative having at least 85% homology with the parent sequence.
29. The isolated peptide of claim 28 comprising at least six amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
30. The isolated peptide of claim 28 comprising the amino acids of the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
31. Use of an isolated peptide according to claim 28 for production of antibodies which recognizes CEACAM1.
32. An isolated polynucleotide encoding a monoclonal antibody or antibody fragment according to any one of claims 1-27.
33. The isolated polynucleotide sequence according to claim 32, comprising a DNA sequences set forth in SEQ ID NO: 25 or SEQ ID NO: 27 or analogs thereof, having at least 90% sequence identity with said sequences.
34. A plasmid comprising at least one isolated polynucleotide sequence according to claim 32.
35. A plasmid according to claim 34 deposited on September 28, 2011 under ATCC Accession Number PTA-12130.
36. A pharmaceutical composition comprising a therapeutically effective amount of a monoclonal antibody or fragment according to any one of claims 1-27; and a pharmaceutically acceptable carrier.
37. The pharmaceutical composition of claim 36 for treatment of a disease or disorder associated with CEACAM1, CEACAM3 or CEACAM5 expression, activation or function.
38. The pharmaceutical composition of claim 37 wherein the disease or disorder is a cell proliferative disease or disorder.
39. The pharmaceutical composition of claim 38 wherein the cell proliferative disease or disorder is a cancer selected from the group consisting of: gastrointestinal, colorectal (CRC), pancreatic, non-small cell lung (NSCL), breast, thyroid, stomach, ovarian and uterine.
40. The pharmaceutical composition of claim 38 wherein the cell proliferative disease or disorder is a cancer selected from the group consisting of: melanoma, pancreatic cancer, lung cancer and myeloma.
41. A diagnostic composition comprising at least one monoclonal antibody or antibody fragment according to any one of claims 1-27; and an optional carrier or excipient.
42. A method of preventing, attenuating or treating a disease or disorder associated with expression, activation or function of CEACAM, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of a pharmaceutical composition according to claim 36.
43. The method of claim 42 wherein the disease or disorder is a cancer.
44. The method of claim 42 wherein the disease or disorder is a viral infection.
45. The method according to claim 42, wherein the isolated antibody or antibody fragment contained in the pharmaceutical composition is attached to a cytotoxic moiety and the disease is cancer.
46. The method of claim 46, further comprising administering to the subject CEACAM1- expressing lymphocytes.
47. The method of claim 46 wherein the lymphocytes comprise T cells, NK cells or Tumor Infiltrating Lymphocyte.
48. A method of immunomodulation, the method comprising contacting a CEACAM- expressing lymphocyte with the antibody or antibody fragment according to any one of claims 1-27.
49. A method of inhibiting migration of a CEACAM expressing tumor cell, the method comprising contacting the CEACAM expressing tumor cell with the antibody or antibody fragment, according to any one of claims 1-27, thereby inhibiting migration of a CEACAM expressing tumor cell.
50. A method of inhibiting CEACAM homotypic or heterotypic protein-protein interaction, the method comprising contacting a CEACAM 1 -expressing lymphocyte with the antibody or antibody fragment, according to any one of claims 1-27, thereby inhibiting CEACAM 1 homotypic or heterotypic protein-protein interaction.
51. A method for increasing the duration or progression of response or survival of a subject having cancer, comprising administering to the subject effective amounts of a composition comprising a monoclonal antibody or antibody fragment, according to any one of claims 1-27, and an anti-neoplastic composition, wherein said anti-neoplastic composition comprises at least one chemotherapeutic agent, whereby the coadministration of the antibody and the anti-neoplastic composition effectively increases the duration or progression of survival.
52. A method for diagnosing a cancer in a subject in need thereof, the method comprising contacting a biological sample derived from the subject with the diagnostic composition of claim 41, wherein a complex formation beyond a predetermined threshold is indicative of the cancer in the subject.
53. A method for diagnosing a disease or disorder associated with CEACAM expression is provided comprising the steps of:
i. incubating a biological sample with a monoclonal antibody or
antibody fragment according to any one of claims 1-27;
ii. detecting the bound CEACAM using a detectable probe;
iii. comparing the amount of (ii) to a standard curve obtained from
reference samples containing known amounts of CEACAM;
iv. calculating the amount of the CEACAM in the biological
sample from the standard curve; and
v. comparing the amount of (iv) to a normal CEACAM amount.
54. Use of a monoclonal antibody or an antibody fragment according to any one of claims 1- 27, for diagnosis, prevention or treatment of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
55. Use of a monoclonal antibody or an antibody fragment according to any one of claims 1- 27, for preparation of a medicament for treatment of a disorder or disease associated with expression or activation of CEACAM.
56. Use of a monoclonal antibody or an antibody fragment according to any one of claims 1- 27, for preparation of a diagnostic composition for the diagnosis of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
PCT/IL2012/050402 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) Ceased WO2013054331A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
CA2851762A CA2851762C (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US14/350,970 US9771431B2 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
AU2012322272A AU2012322272C1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
LTEP12840002.5T LT2744829T (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
EP17200104.2A EP3360899B1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
PL12840002T PL2744829T3 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
ES12840002.5T ES2661488T3 (en) 2011-10-11 2012-10-10 Antibodies for cell adhesion molecule related to carcinoembryonic antigen (CEACAM)
JP2014535228A JP6170926B2 (en) 2011-10-11 2012-10-10 Antibody against carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
BR112014008893-4A BR112014008893B1 (en) 2011-10-11 2012-10-10 Monoclonal antibody or antigen fragment thereof, isolated polynucleotide encoding said antibody, as well as pharmaceutical and diagnostic compositions comprising the same, plasmid and uses of said antibody or antigen fragment thereof
RU2014118773A RU2650869C2 (en) 2011-10-11 2012-10-10 Antibodies to the related cancer-embryonic antigen cell adhesion molecule (ceacam)
KR1020147010511A KR102189409B1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
HK15100064.4A HK1199646B (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
EP12840002.5A EP2744829B1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
IN873MUN2014 IN2014MN00873A (en) 2011-10-11 2012-10-10
CN201280049869.4A CN103987729B (en) 2011-10-11 2012-10-10 Antibody to Carcinoembryonic Antigen-Associated Cell Adhesion Molecule (CEACAM)
IL231931A IL231931B (en) 2011-10-11 2014-04-03 Antibodies to ceacam
US15/683,087 US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US17/037,136 US11891453B2 (en) 2011-10-11 2020-09-29 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ILPCT/IL2011/000808 2011-10-11
PCT/IL2011/000808 WO2013054320A1 (en) 2011-10-11 2011-10-11 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Related Child Applications (4)

Application Number Title Priority Date Filing Date
EP17200104.2A Previously-Filed-Application EP3360899B1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US14/350,970 A-371-Of-International US9771431B2 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
US15/683,087 Continuation US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US15/683,087 Division US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Publications (2)

Publication Number Publication Date
WO2013054331A1 true WO2013054331A1 (en) 2013-04-18
WO2013054331A8 WO2013054331A8 (en) 2014-04-10

Family

ID=48081453

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/IL2011/000808 Ceased WO2013054320A1 (en) 2011-10-11 2011-10-11 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
PCT/IL2012/050402 Ceased WO2013054331A1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Family Applications Before (1)

Application Number Title Priority Date Filing Date
PCT/IL2011/000808 Ceased WO2013054320A1 (en) 2011-10-11 2011-10-11 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Country Status (15)

Country Link
US (3) US9771431B2 (en)
EP (2) EP3360899B1 (en)
JP (1) JP6170926B2 (en)
KR (1) KR102189409B1 (en)
CN (1) CN103987729B (en)
AU (1) AU2012322272C1 (en)
BR (1) BR112014008893B1 (en)
CA (1) CA2851762C (en)
ES (2) ES2661488T3 (en)
IL (1) IL231931B (en)
IN (1) IN2014MN00873A (en)
LT (1) LT2744829T (en)
PL (2) PL2744829T3 (en)
RU (1) RU2650869C2 (en)
WO (2) WO2013054320A1 (en)

Cited By (91)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015075725A1 (en) 2013-11-25 2015-05-28 Ccam Biotherapeutics Ltd. Compositions comprising anti-ceacam1 and anti-pd antibodies for cancer therapy
WO2015075710A1 (en) * 2013-11-25 2015-05-28 Ccam Biotherapeutics Ltd. Compositions comprising anti-ceacam1 antibodies, lymphocyte activating agents and activated lymphocytes for cancer therapy
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
WO2015157252A1 (en) 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2015168144A1 (en) * 2014-04-29 2015-11-05 Edp Biotech Corporation Methods and compositions for screening and detecting cancer
WO2016014530A1 (en) 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
WO2016014553A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase synthesized chimeric antigen receptors
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
WO2016040892A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies
WO2016044605A1 (en) 2014-09-17 2016-03-24 Beatty, Gregory Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2016054555A2 (en) 2014-10-03 2016-04-07 Novartis Ag Combination therapies
WO2016057705A1 (en) 2014-10-08 2016-04-14 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
WO2016061142A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
WO2016090034A2 (en) 2014-12-03 2016-06-09 Novartis Ag Methods for b cell preconditioning in car therapy
WO2016100882A1 (en) 2014-12-19 2016-06-23 Novartis Ag Combination therapies
WO2016120331A1 (en) 2015-01-28 2016-08-04 Karl Sebastian Lang Agonistic anti-cd66cd66 antibody for antiviral therapy
WO2016126608A1 (en) 2015-02-02 2016-08-11 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
WO2016164580A1 (en) 2015-04-07 2016-10-13 Novartis Ag Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives
WO2016168595A1 (en) 2015-04-17 2016-10-20 Barrett David Maxwell Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
WO2016172583A1 (en) 2015-04-23 2016-10-27 Novartis Ag Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
KR20170003937A (en) * 2014-04-27 2017-01-10 씨씨에이엠 바이오세라퓨틱스 리미티드. Humanized antibodies against ceacam1
WO2017015427A1 (en) 2015-07-21 2017-01-26 Novartis Ag Methods for improving the efficacy and expansion of immune cells
WO2017019897A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to tim-3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017040930A2 (en) 2015-09-03 2017-03-09 The Trustees Of The University Of Pennsylvania Biomarkers predictive of cytokine release syndrome
WO2017103895A1 (en) 2015-12-18 2017-06-22 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2017106656A1 (en) 2015-12-17 2017-06-22 Novartis Ag Antibody molecules to pd-1 and uses thereof
WO2017106630A1 (en) 2015-12-18 2017-06-22 The General Hospital Corporation Polyacetal polymers, conjugates, particles and uses thereof
WO2017112741A1 (en) 2015-12-22 2017-06-29 Novartis Ag Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
WO2017149515A1 (en) 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
WO2018019380A1 (en) * 2016-07-28 2018-02-01 Universität Duisburg-Essen Immunostimulatory anti-ceacam1 antibodies
WO2018067992A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
WO2018102786A1 (en) 2016-12-03 2018-06-07 Juno Therapeutics, Inc. Methods for modulation of car-t cells
WO2018106738A1 (en) 2016-12-05 2018-06-14 Massachusetts Institute Of Technology Brush-arm star polymers, conjugates and particles, and uses thereof
WO2018201051A1 (en) 2017-04-28 2018-11-01 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
WO2018201056A1 (en) 2017-04-28 2018-11-01 Novartis Ag Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
WO2018223101A1 (en) 2017-06-02 2018-12-06 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
WO2018229715A1 (en) 2017-06-16 2018-12-20 Novartis Ag Compositions comprising anti-cd32b antibodies and methods of use thereof
WO2019006427A1 (en) 2017-06-29 2019-01-03 Juno Therapeutics, Inc. Mouse model for assessing toxicities associated with immunotherapies
WO2019081983A1 (en) 2017-10-25 2019-05-02 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2019089858A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
WO2019089969A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for b-cell maturation antigen
WO2019090003A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Chimeric antigen receptors specific for b-cell maturation antigen (bcma)
EP3487878A1 (en) 2016-07-20 2019-05-29 University of Utah Research Foundation Cd229 car t cells and methods of use thereof
WO2019118937A1 (en) 2017-12-15 2019-06-20 Juno Therapeutics, Inc. Anti-cct5 binding molecules and methods of use thereof
EP3514179A1 (en) 2014-01-24 2019-07-24 Dana-Farber Cancer Institute, Inc. Antibody molecules to pd-1 and uses thereof
WO2019152743A1 (en) 2018-01-31 2019-08-08 Celgene Corporation Combination therapy using adoptive cell therapy and checkpoint inhibitor
WO2019210153A1 (en) 2018-04-27 2019-10-31 Novartis Ag Car t cell therapies with enhanced efficacy
WO2019213282A1 (en) 2018-05-01 2019-11-07 Novartis Ag Biomarkers for evaluating car-t cells to predict clinical outcome
WO2019241426A1 (en) 2018-06-13 2019-12-19 Novartis Ag Bcma chimeric antigen receptors and uses thereof
WO2020069409A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd19 chimeric antigen receptor (car) and cd22 car combination therapies
WO2020069405A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies
WO2020092854A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
WO2020092848A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Methods for treatment using chimeric antigen receptors specific for b-cell maturation antigen
WO2020102770A1 (en) 2018-11-16 2020-05-22 Juno Therapeutics, Inc. Methods of dosing engineered t cells for the treatment of b cell malignancies
EP3660042A1 (en) 2014-07-31 2020-06-03 Novartis AG Subset-optimized chimeric antigen receptor-containing t-cells
WO2020113194A2 (en) 2018-11-30 2020-06-04 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
KR20200092091A (en) * 2019-01-24 2020-08-03 가톨릭대학교 산학협력단 Correlation of CEACAM1 and EpCAM in liver cancer and Methods for providing information for liver cancer therapeutic effect using using the same
WO2020160050A1 (en) 2019-01-29 2020-08-06 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ror1)
EP3712171A1 (en) 2014-08-19 2020-09-23 Novartis AG Treatment of cancer using a cd123 chimeric antigen receptor
EP3722316A1 (en) 2014-07-21 2020-10-14 Novartis AG Treatment of cancer using a cd33 chimeric antigen receptor
WO2021025177A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021108613A1 (en) 2019-11-26 2021-06-03 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2021207689A2 (en) 2020-04-10 2021-10-14 Juno Therapeutics, Inc. Methods and uses related to cell therapy engineered with a chimeric antigen receptor targeting b-cell maturation antigen
EP3909601A1 (en) 2020-05-11 2021-11-17 LeukoCom GmbH A novel antibody binding specifically to human ceacam1/3/5 and use thereof
WO2021236650A1 (en) 2020-05-19 2021-11-25 G1 Therapeutics, Inc. Cyclin-dependent kinase inhibiting compounds for the treatment of medical disorders
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022066774A1 (en) 2020-09-23 2022-03-31 Achillion Pharmaceuticals, Inc. Pharmaceutical compounds for the treatment of complement mediated disorders
WO2022136255A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
US11427647B2 (en) 2014-04-27 2022-08-30 Famewave Ltd. Polynucleotides encoding humanized antibodies against CEACAM1
WO2022254337A1 (en) 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
EP3898694A4 (en) * 2018-12-20 2023-02-15 Albert Einstein College of Medicine CEACAM1 (CD66A) HUMAN IMMUNE CHECKPOINT ANTAGONIST ANTIBODIES AND THEIR FORMULATIONS, KITS AND METHODS OF USE
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023250400A1 (en) 2022-06-22 2023-12-28 Juno Therapeutics, Inc. Treatment methods for second line therapy of cd19-targeted car t cells
WO2024031091A2 (en) 2022-08-05 2024-02-08 Juno Therapeutics, Inc. Chimeric antigen receptors specific for gprc5d and bcma
EP4324518A2 (en) 2014-01-31 2024-02-21 Novartis AG Antibody molecules to tim-3 and uses thereof
WO2024100663A1 (en) 2022-11-10 2024-05-16 Famewave Ltd. Anti carcinoembryonic antigen-related cell adhesion molecule 1 (ceacam1) antibodies for inhibition of neutrophil extracellular traps (net)-mediated activities
EP4378957A2 (en) 2015-07-29 2024-06-05 Novartis AG Combination therapies comprising antibody molecules to pd-1
WO2024129778A2 (en) 2022-12-13 2024-06-20 Juno Therapeutics, Inc. Chimeric antigen receptors specific for baff-r and cd19 and methods and uses thereof
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024165403A1 (en) 2023-02-06 2024-08-15 Philogen S.P.A. Anti-cea antibodies
WO2024213096A1 (en) * 2023-04-13 2024-10-17 Suzhou Neologics Bioscience Co., Ltd. Ceacam1-targeting antibodies and uses thereof
WO2025121444A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2026033885A1 (en) 2024-08-08 2026-02-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2

Families Citing this family (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8815248B2 (en) * 2005-06-09 2014-08-26 Gal Markel Modulation of immunity and CEACAM1 activity
EP2990421B1 (en) * 2009-04-30 2018-02-21 Tel HaShomer Medical Research Infrastructure and Services Ltd. Anti ceacam1 antibodies and methods of using same
US9402916B2 (en) 2011-03-17 2016-08-02 The University Of Birmingham Re-directed immunotherapy
EP3087099A4 (en) * 2013-12-23 2017-07-19 Oncomed Pharmaceuticals, Inc. Immunotherapy with binding agents
WO2015101996A1 (en) * 2014-01-02 2015-07-09 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to ceacam1 and kinase inhibitors for treating braf-mutated cells
AU2016215604B2 (en) 2015-02-02 2020-08-13 The University Of Birmingham Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes
KR20250099459A (en) 2015-11-03 2025-07-01 얀센 바이오테크 인코포레이티드 Antibodies specifically binding pd-1 and their uses
CN107345969A (en) * 2016-05-05 2017-11-14 中国医学科学院基础医学研究所 Purposes of the serum markers comprising AFP, GP73 and CEACAM1 in diagnosing hepatic diseases
CN107345968A (en) * 2016-05-05 2017-11-14 中国医学科学院基础医学研究所 Purposes of the CECAM1 albumen as serum markers in diagnosing hepatic diseases
KR102019913B1 (en) * 2017-03-24 2019-09-09 재단법인 목암생명과학연구소 Anti-ceacam1 antibody and use thereof
WO2018174629A1 (en) * 2017-03-24 2018-09-27 Mogam Institute For Biomedical Research Anti-ceacam1 antibody and use thereof
KR102325944B1 (en) * 2017-11-30 2021-11-12 재단법인 목암생명과학연구소 Anti-ceacam1 antibody and use thereof
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
US20210363244A1 (en) * 2018-05-09 2021-11-25 Good T Cells, Inc. Epitope of Regulatory T Cell surface Antigen and Antibody Specifically Biding Thereto
CN110684107B (en) * 2018-07-06 2021-03-23 中国人民解放军第四军医大学 Monoclonal antibody (MGd1) against MG7-Ag and use thereof
CN110684108B (en) * 2018-07-06 2021-06-04 中国人民解放军第四军医大学 anti-MG 7-Ag monoclonal antibody (CEA37) and application thereof
CA3121580A1 (en) 2018-12-07 2020-06-11 The Brigham And Women's Hospital, Inc. Humanized and affinity-matured anti-ceacam1 antibodies
US20220235142A1 (en) * 2019-06-04 2022-07-28 Shanghai GenBase Biotechnology Co., Ltd. Anti-ceacam5 monoclonal antibody, preparation method thereof and use thereof
BR112022008774A2 (en) * 2019-11-07 2022-07-26 Green Cross Corp STERIC EPITOPE OF CEACAM1 AND ANTI-CEACAM1 ANTIBODY OR FRAGMENT THEREOF, WHICH BINDS SPECIFICALLY TO THE SAME
CN111675750B (en) * 2020-06-11 2022-08-30 中国药科大学 Tumor targeting peptide aiming at carcinoembryonic antigen related adhesion molecule CEACAM and application thereof
CN113201070B (en) * 2020-08-04 2022-04-01 中山大学附属第五医院 anti-CEACAM 5 nano antibody
WO2022040470A1 (en) * 2020-08-20 2022-02-24 A2 Biotherapeutics, Inc. Compositions and methods for treating ceacam positive cancers
WO2022040454A1 (en) 2020-08-20 2022-02-24 A2 Biotherapeutics, Inc. Compositions and methods for treating mesothelin positive cancers
EP4097486A4 (en) 2020-08-20 2023-09-06 A2 Biotherapeutics, Inc. COMPOSITIONS AND METHODS FOR TREATING CEACAM POSITIVE CANCER
AU2021329456A1 (en) * 2020-08-21 2023-03-23 Shanghai GenBase Biotechnology Co., Ltd. Antibody specifically bound to glycosylated CEACAM5
WO2022041745A1 (en) * 2020-08-28 2022-03-03 安源医药科技(上海)有限公司 Antibody against sars-cov-2 coronavirus s protein and application thereof
CN112457402B (en) * 2020-10-21 2022-08-30 北京纽安博生物技术有限公司 anti-CEACAM 6 single-domain antibody, humanized single-domain antibody, fusion protein and application thereof
US20240083998A1 (en) * 2021-01-04 2024-03-14 City Of Hope Prevention and treatment of steroid-resistant or gut graft-versus-host disease (gvhd)
JPWO2024034580A1 (en) * 2022-08-08 2024-02-15
WO2024035662A2 (en) 2022-08-10 2024-02-15 Merck Sharp & Dohme Llc Proteins binding nkg2d, cd16, and ceacam5

Citations (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3839153A (en) 1970-12-28 1974-10-01 Akzona Inc Process for the detection and determination of specific binding proteins and their corresponding bindable substances
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3850578A (en) 1973-03-12 1974-11-26 H Mcconnell Process for assaying for biologically active molecules
US3853987A (en) 1971-09-01 1974-12-10 W Dreyer Immunological reagent and radioimmuno assay
US3867517A (en) 1971-12-21 1975-02-18 Abbott Lab Direct radioimmunoassay for antigens and their antibodies
US3879262A (en) 1972-05-11 1975-04-22 Akzona Inc Detection and determination of haptens
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3935074A (en) 1973-12-17 1976-01-27 Syva Company Antibody steric hindrance immunoassay with two antibodies
US3984533A (en) 1975-11-13 1976-10-05 General Electric Company Electrophoretic method of detecting antigen-antibody reaction
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
US4666828A (en) 1984-08-15 1987-05-19 The General Hospital Corporation Test for Huntington's disease
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4801531A (en) 1985-04-17 1989-01-31 Biotechnology Research Partners, Ltd. Apo AI/CIII genomic polymorphisms predictive of atherosclerosis
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4879219A (en) 1980-09-19 1989-11-07 General Hospital Corporation Immunoassay utilizing monoclonal high affinity IgM antibodies
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
US5011771A (en) 1984-04-12 1991-04-30 The General Hospital Corporation Multiepitopic immunometric assay
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
US5192659A (en) 1989-08-25 1993-03-09 Genetype Ag Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1993015210A1 (en) 1992-01-23 1993-08-05 Merck Patent Gmbh Monomeric and dimeric antibody-fragment fusion proteins
US5272057A (en) 1988-10-14 1993-12-21 Georgetown University Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase
US5281521A (en) 1992-07-20 1994-01-25 The Trustees Of The University Of Pennsylvania Modified avidin-biotin technique
WO1996013583A2 (en) 1994-10-20 1996-05-09 Morphosys Gesellschaft Für Proteinoptimierung Mbh Targeted hetero-association of recombinant proteins to multi-functional complexes
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
WO1997002671A2 (en) 1995-06-30 1997-01-23 Scientific Atlanta, Inc. System for coupling telephony signals transmitted through a broadband communications network to a telephony network interface
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
WO2001013937A1 (en) * 1999-08-26 2001-03-01 Skubitz Keith M Peptides capable of modulating the function of cd66 (ceacam) family members
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
US20070071758A1 (en) 2005-06-09 2007-03-29 Gal Markel CEACAM1 Based Cancer Therapy and Diagnosis
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
US8256790B2 (en) 2010-05-26 2012-09-04 William Olen Fortner Adjustable receiver hitch system
US8817788B2 (en) 2008-01-17 2014-08-26 Nec Corporation Wireless communication terminal, method, program, recording medium, and wireless communication system
US8999554B2 (en) 2011-12-27 2015-04-07 Lg Chem, Ltd. Lithium secondary battery and preparation thereof

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4348376A (en) 1980-03-03 1982-09-07 Goldenberg Milton David Tumor localization and therapy with labeled anti-CEA antibody
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US6022958A (en) 1986-08-13 2000-02-08 Bayer Corporation cDNAs coding for members of the carcinoembryonic antigen family
GB9421405D0 (en) 1994-10-21 1994-12-07 Dow Chemical Co Low voc laminating formulations
DE19852804C1 (en) 1998-11-16 1999-12-23 Christoph Wagener Pharmaceutical composition for manipulating angiogenesis
DE10016877A1 (en) 2000-04-05 2001-10-18 Scintec Diagnostics Gmbh Zug (Glyco) proteins with high immunoreactivity and a process for their preparation
SE0002835D0 (en) 2000-08-07 2000-08-07 Karolinska Innovations Ab Method and kit for production of monoclonal antibodies
EP1472276A4 (en) * 2001-02-28 2007-05-09 Keith M Skubitz Small peptides capable of modulating the function of cd66 (ceacam) family members
US20030022292A1 (en) 2001-06-07 2003-01-30 Gray-Owen Scott D. Ligation of CEACAM1
US20060058257A1 (en) 2001-08-03 2006-03-16 Christoph Wagener Influencing angiogenesis using CD66a
US20050107324A1 (en) 2003-07-12 2005-05-19 Bennett C. F. Modulation of CEACAM1 expression
US20030190600A1 (en) * 2002-04-05 2003-10-09 Dana-Faber Cancer Institute Carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) structure and uses thereof in drug identification and screening
US20030211477A1 (en) 2002-04-05 2003-11-13 Holmes Kathryn V. Carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) structure and uses thereof in drug identification and screening
CU23228A1 (en) 2002-04-29 2007-09-26 Ct Ingenieria Genetica Biotech FRAGMENTS OF SPECIFIC ANTIBODIES FOR THE HUMAN CARCINOEMBRIONARY ANTIGEN (CEA) SEQUENCES OF ITS VARIABLE REGIONS AND VECTORS FOR THE MICROBIAL EXPRESSION OF THE SAME
EP1572131B1 (en) 2002-10-08 2016-07-06 Immunomedics, Inc. Antibody therapy
CA2501757C (en) 2002-10-08 2012-04-24 Immunomedics, Inc. Combination therapy with class iii anti-cea monoclonal antibodies and therapeutic agents
KR20060127409A (en) 2003-11-13 2006-12-12 제넨테크, 인크. Tumor Treatment Methods and Screening Assays
US7371825B2 (en) * 2004-06-30 2008-05-13 Centocor, Inc. Anti-MCP-1 antibodies, compositions, methods and uses
PT1976880T (en) 2005-12-21 2016-09-28 Amgen Res Munich Gmbh PHARMACEUTICAL COMPOSITIONS WITH SOLID ECA RESISTANCE
AU2006328882B2 (en) * 2005-12-21 2011-06-16 Amgen Research (Munich) Gmbh Pharmaceutical antibody compositions with resistance to soluble CEA
WO2008029271A2 (en) 2006-02-27 2008-03-13 Gal Markel Ceacam based antibacterial agents
BRPI0813626A2 (en) * 2007-07-27 2014-12-23 Immatics Biotechnologies Gmbh Immunogenic Epitopes for Immunotherapy
EP2208069A4 (en) 2007-11-05 2012-02-01 Gal Markel DIAGNOSIS OF CANCER OUTSIDE LABORATORY BASED ON CEACAM1
WO2011010309A1 (en) 2009-07-21 2011-01-27 Tel Hashomer Medical Research Infrastructure And Services Ltd. A method of diagnosing cancer
AU2010288469A1 (en) * 2009-08-31 2012-03-01 Roche Glycart Ag Affinity-matured humanized anti CEA monoclonal antibodies
US8580714B2 (en) 2009-10-14 2013-11-12 Janssen Biotech, Inc. Methods of affinity maturing antibodies
JP6356134B2 (en) 2012-10-12 2018-07-11 ザ ブリガム アンド ウィメンズ ホスピタル インコーポレイテッドThe Brigham and Women’s Hospital, Inc. Enhanced immune response

Patent Citations (62)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3839153A (en) 1970-12-28 1974-10-01 Akzona Inc Process for the detection and determination of specific binding proteins and their corresponding bindable substances
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3853987A (en) 1971-09-01 1974-12-10 W Dreyer Immunological reagent and radioimmuno assay
US3867517A (en) 1971-12-21 1975-02-18 Abbott Lab Direct radioimmunoassay for antigens and their antibodies
US3879262A (en) 1972-05-11 1975-04-22 Akzona Inc Detection and determination of haptens
US3850578A (en) 1973-03-12 1974-11-26 H Mcconnell Process for assaying for biologically active molecules
US3935074A (en) 1973-12-17 1976-01-27 Syva Company Antibody steric hindrance immunoassay with two antibodies
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US3984533A (en) 1975-11-13 1976-10-05 General Electric Company Electrophoretic method of detecting antigen-antibody reaction
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4879219A (en) 1980-09-19 1989-11-07 General Hospital Corporation Immunoassay utilizing monoclonal high affinity IgM antibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5011771A (en) 1984-04-12 1991-04-30 The General Hospital Corporation Multiepitopic immunometric assay
US4666828A (en) 1984-08-15 1987-05-19 The General Hospital Corporation Test for Huntington's disease
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (en) 1985-03-28 1990-11-27 Cetus Corp
US4801531A (en) 1985-04-17 1989-01-31 Biotechnology Research Partners, Ltd. Apo AI/CIII genomic polymorphisms predictive of atherosclerosis
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5272057A (en) 1988-10-14 1993-12-21 Georgetown University Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
US5192659A (en) 1989-08-25 1993-03-09 Genetype Ag Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1993015210A1 (en) 1992-01-23 1993-08-05 Merck Patent Gmbh Monomeric and dimeric antibody-fragment fusion proteins
US5281521A (en) 1992-07-20 1994-01-25 The Trustees Of The University Of Pennsylvania Modified avidin-biotin technique
WO1996013583A2 (en) 1994-10-20 1996-05-09 Morphosys Gesellschaft Für Proteinoptimierung Mbh Targeted hetero-association of recombinant proteins to multi-functional complexes
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
WO1997002671A2 (en) 1995-06-30 1997-01-23 Scientific Atlanta, Inc. System for coupling telephony signals transmitted through a broadband communications network to a telephony network interface
US20020028203A1 (en) 1998-04-15 2002-03-07 Blumberg Richard S. T cell inhibitory receptor compositions and uses thereof
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
US20050169922A1 (en) 1998-04-15 2005-08-04 Blumberg Richard S. T cell inhibitory receptor compositions and uses thereof
US20080102071A1 (en) 1998-04-15 2008-05-01 Blumberg Richard S T cell inhibitory receptor compositions and uses thereof
WO2001013937A1 (en) * 1999-08-26 2001-03-01 Skubitz Keith M Peptides capable of modulating the function of cd66 (ceacam) family members
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
WO2007063424A2 (en) 2005-06-09 2007-06-07 Gal Markel The modulation of immunity and ceacam1 activity
US20070110668A1 (en) 2005-06-09 2007-05-17 Gal Markel Modulation of Immunity and Ceacam1 Activity
US20070071758A1 (en) 2005-06-09 2007-03-29 Gal Markel CEACAM1 Based Cancer Therapy and Diagnosis
US20080108140A1 (en) 2005-06-09 2008-05-08 Gal Markel CEACAM1 Mediated Protective Immunity
US8817788B2 (en) 2008-01-17 2014-08-26 Nec Corporation Wireless communication terminal, method, program, recording medium, and wireless communication system
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
US8256790B2 (en) 2010-05-26 2012-09-04 William Olen Fortner Adjustable receiver hitch system
US8999554B2 (en) 2011-12-27 2015-04-07 Lg Chem, Ltd. Lithium secondary battery and preparation thereof

Non-Patent Citations (89)

* Cited by examiner, † Cited by third party
Title
"Basic and Clinical Immunology", 1994, APPLETON & LANGE, NORWALK, CT
"Cell Biology: A Laboratory Handbook", vol. I-III, 1994
"Current Protocols in Immunology", 1992, JOHN WILEY & SONS, INC.
"Current Protocols in Immunology", vol. I-III, 1994
"Current Protocols in Molecular Biology", vol. I-III, 1994
"Genome Analysis: A Laboratory Manual Series", vol. 1-4, 1998, COLD SPRING HARBOR LABORATORY PRESS, NEW YORK
"Immobilized Cells and Enzymes", 1986, IRL PRESS
"Methods in Enzymology", vol. 1-317, ACADEMIC PRESS
"PCR Protocols: A Guide To Methods And Applications", 1990, ACADEMIC PRESS
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
"Selected Methods in Cellular Immunology", 1980, W. H. FREEMAN AND CO., NEW YORK
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS, BALTIMORE, MARYLAND
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRUGGERMANN ET AL., YEAR IN IMMUNO., vol. 7, 1993, pages 33
CARTER ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 163 - 167
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 628
CLARK MR., CHEM IMMUNOL., vol. 65, 1997, pages 88 - 110
COLE ET AL.: "MONOCLONAL ANTIBODIES AND CANCER THERAPY", 1985, ALAN R. LISS, INC., pages: 77 - 96
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77
DOUILLARD ET AL., LANCET, vol. 355, 2000, pages 1041 - 1047
DUCHOSAL ET AL., NATURE, vol. 355, 1992, pages 258
DUFFY, CLIN CHEM, vol. 47, 2001, pages 624 - 630
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 51
FRESHNEY, R. I.: "Animal Cell Culture", 1986
GAIT, M. J.: "Oligonucleotide Synthesis", 1984
GOODMAN; GILMAN'S: "The Pharmacological Bases of Therapeutics", 1990, PERGAMON PRESS
GRAY-OWEN; BLUMBERG, NAT REV IMMUNOL, vol. 6, 2006, pages 433 - 446
HAMES, B. D., AND HIGGINS S. J.: "Nucleic Acid Hybridization", 1985
HAMES, B. D., AND HIGGINS S. J.: "Transcription and Translation", 1984
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381
HUSTON ET AL., PNAS (USA, vol. 85, 1988, pages 5879 - 5883
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KIM SJ ET AL.: "Antibody engineering for the development of therapeutic antibodies (2005).", MOL CELLS., vol. 20, no. 1, 31 August 2005 (2005-08-31), pages 17 - 29, XP002540664, Retrieved from the Internet <URL:http://cms.daegu.ac.kr/sgpark/molecular%20biology/antibody%20engineering.pdf> *
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KOHLER, G.; MILSTEIN, C., NATURE, vol. 256, 1975, pages 495 - 497
KOZBOR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72
LEFRANC ET AL., NUCLEIC ACIDS RESEARCH, vol. 27, 1999, pages 209 - 212
LIERSCH ET AL., J CLIN ONCOL, vol. 23, no. 27, 2005, pages 6763 - 6770
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
MARKEL ET AL., J IMMUNOL., vol. 168, 2002, pages 2803 - 2810
MARKEL, J. CLINICAL INVESTIGATION, vol. 110, 2002, pages 943 - 953
MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MARSHAK ET AL.: "Strategies for Protein Purification and Characterization - A Laboratory Course Manual", 1996, CSHL PRESS
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MORALES ET AL., J. IMMUNOL., vol. 163, 1999, pages 1363 - 1370
MORIMOTO ET AL., JOURNAL OF BIOCHEMICAL AND BIOPHYSICAL METHODS, vol. 24, 1992, pages 107 - 117
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MORRISON, NATURE, vol. 368, 1994, pages 812 - 13
NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826
PAVONI E ET AL.: "Selection, affinity maturation, and characterization of a human scFv antibody against CEA protein (2006).", BMC CANCER, vol. 41, no. 6, 24 February 2006 (2006-02-24), XP021016244, Retrieved from the Internet <URL:http://www.biomedcentral.com/1471-2407/6/41><doi:10.1186/1471-2407-6-41> *
PERBAL, B.: "A Practical Guide to Molecular Cloning", 1984, PERBAL, B.
PERBAL: "A Practical Guide to Molecular Cloning", 1988, JOHN WILEY & SONS, NEW YORK
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
PRESTA LG ET AL.: "Humanization of an anti-vascular endothelial growth factor monoclonal antibody for the therapy of solid tumors and other disorders (1997).", CANCER RES., vol. 57, no. 20, 15 October 1997 (1997-10-15), pages 4593 - 4599, XP002926854, Retrieved from the Internet <URL:http://cancerres.aacrjournals.org/content/57/20/4593.1ong> *
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
SALTZ ET AL., PROC ASCO, vol. 18, 1999, pages 233A
SAMBROOK ET AL.: "Molecular Cloning: A laboratory Manual", 1989
See also references of EP2744829A4
SHEETS ET AL., PNAS (USA, vol. 95, 1998, pages 6157 - 6162
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SLOOTSTRA ET AL., MOLECULAR DIVERSITY, vol. 1, 1996, pages 87 - 96
STERN ET AL., J IMMUNOL., vol. 174, 2005, pages 6692 - 6701
THOMPSON, GRUNERT ET AL., J CLIN LAB ANAL, vol. 5, 1991, pages 344 - 366
TIMMERMAN ET AL., J. MOL. RECOGNIT., vol. 20, 2007, pages 283 - 299
VAUGHAN ET AL., NATURE BIOTECH, vol. 14, 1996, pages 309
VAUGHAN ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 309 - 314
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WATSON ET AL.: "Recombinant DNA", SCIENTIFIC AMERICAN BOOKS
WATT ET AL., BLOOD, vol. 98, 2001, pages 1469 - 1479
WU TT; KABAT E.A., J. EXP. MED., vol. 132, 1970, pages 211 - 250
YCHOU ET AL., CLIN CANCER RES, vol. 14, no. 11, 2008, pages 3487 - 3493
ZAPATA ET AL., PROTEIN ENG., vol. 8, 1995, pages 1057 - 1062
ZHENG C ET AL.: "A novel anti-CEACAM5 monoclonal antibody, CC4, suppresses colorectal tumor growth and enhances NK cells-mediated tumor immunity (2011).", PLOS ONE., vol. 6, no. 6, 22 June 2011 (2011-06-22), pages E21146, XP055145536, Retrieved from the Internet <URL:http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0021146> *

Cited By (141)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10081679B2 (en) 2013-11-25 2018-09-25 Ccam Biotherapeutics Ltd. Compositions comprising anti-CEACAM1 and anti-PD antibodies for cancer therapy
WO2015075710A1 (en) * 2013-11-25 2015-05-28 Ccam Biotherapeutics Ltd. Compositions comprising anti-ceacam1 antibodies, lymphocyte activating agents and activated lymphocytes for cancer therapy
EP3763387B1 (en) * 2013-11-25 2024-03-27 FameWave Ltd Compositions comprising anti-ceacam1 and anti-pd antibodies for cancer therapy
EP3074035B1 (en) * 2013-11-25 2020-05-13 FameWave Ltd. Compositions comprising anti-ceacam1 and anti-pd antibodies for cancer therapy
JP2016537383A (en) * 2013-11-25 2016-12-01 シーシーエーエム バイオセラピューティクス リミテッド Composition comprising anti-CEACAM1 and anti-PD antibody for cancer treatment
WO2015075725A1 (en) 2013-11-25 2015-05-28 Ccam Biotherapeutics Ltd. Compositions comprising anti-ceacam1 and anti-pd antibodies for cancer therapy
EP3763387A1 (en) 2013-11-25 2021-01-13 FameWave Ltd Compositions comprising anti-ceacam1 and anti-pd antibodies for cancer therapy
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
EP4026909A1 (en) 2013-12-19 2022-07-13 Novartis AG Human mesothelin chimeric antigen receptors and uses thereof
EP4706773A2 (en) 2013-12-19 2026-03-11 Novartis AG Human mesothelin chimeric antigen receptors and uses thereof
EP3514179A1 (en) 2014-01-24 2019-07-24 Dana-Farber Cancer Institute, Inc. Antibody molecules to pd-1 and uses thereof
EP4324518A2 (en) 2014-01-31 2024-02-21 Novartis AG Antibody molecules to tim-3 and uses thereof
EP3660050A1 (en) 2014-03-14 2020-06-03 Novartis AG Antibody molecules to lag-3 and uses thereof
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
EP3888674A1 (en) 2014-04-07 2021-10-06 Novartis AG Treatment of cancer using anti-cd19 chimeric antigen receptor
EP4406610A2 (en) 2014-04-07 2024-07-31 Novartis AG Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2015157252A1 (en) 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
EP3766902A1 (en) 2014-04-27 2021-01-20 FameWave Ltd. Humanized antibodies against ceacam1
US10550196B2 (en) 2014-04-27 2020-02-04 Famewave Ltd. Humanized antibodies against CEACAM1
CN106573977B (en) * 2014-04-27 2020-08-07 菲姆威有限公司 Humanized antibody against CEACAM1
CN106573977A (en) * 2014-04-27 2017-04-19 希凯姆生物治疗有限公司 Humanized antibodies against CEACAM1
US11866509B2 (en) 2014-04-27 2024-01-09 Famewave Ltd. Humanized antibodies against CEACAM1
JP2017522261A (en) * 2014-04-27 2017-08-10 シーシーエーエム バイオセラピューティクス リミテッド Humanized antibody against CEACAM1
KR20170003937A (en) * 2014-04-27 2017-01-10 씨씨에이엠 바이오세라퓨틱스 리미티드. Humanized antibodies against ceacam1
KR102452349B1 (en) * 2014-04-27 2022-10-11 페임웨이브 리미티드 Humanized antibodies against ceacam1
US11427647B2 (en) 2014-04-27 2022-08-30 Famewave Ltd. Polynucleotides encoding humanized antibodies against CEACAM1
US9753036B2 (en) 2014-04-29 2017-09-05 Edp Biotech Corporation Methods and compositions for screening and detecting biomarkers
WO2015168144A1 (en) * 2014-04-29 2015-11-05 Edp Biotech Corporation Methods and compositions for screening and detecting cancer
WO2016014553A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase synthesized chimeric antigen receptors
WO2016014530A1 (en) 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
EP3722316A1 (en) 2014-07-21 2020-10-14 Novartis AG Treatment of cancer using a cd33 chimeric antigen receptor
EP3660042A1 (en) 2014-07-31 2020-06-03 Novartis AG Subset-optimized chimeric antigen receptor-containing t-cells
EP4205749A1 (en) 2014-07-31 2023-07-05 Novartis AG Subset-optimized chimeric antigen receptor-containing cells
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
EP3712171A1 (en) 2014-08-19 2020-09-23 Novartis AG Treatment of cancer using a cd123 chimeric antigen receptor
WO2016040880A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies of alk inhibitors
EP3659621A1 (en) 2014-09-13 2020-06-03 Novartis AG Combination therapies for cancer
EP3925622A1 (en) 2014-09-13 2021-12-22 Novartis AG Combination therapies
WO2016040892A1 (en) 2014-09-13 2016-03-17 Novartis Ag Combination therapies
WO2016044605A1 (en) 2014-09-17 2016-03-24 Beatty, Gregory Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
EP3967709A1 (en) 2014-09-17 2022-03-16 Novartis AG Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2016054555A2 (en) 2014-10-03 2016-04-07 Novartis Ag Combination therapies
EP3662903A2 (en) 2014-10-03 2020-06-10 Novartis AG Combination therapies
WO2016057705A1 (en) 2014-10-08 2016-04-14 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
WO2016061142A1 (en) 2014-10-14 2016-04-21 Novartis Ag Antibody molecules to pd-l1 and uses thereof
EP4245376A2 (en) 2014-10-14 2023-09-20 Novartis AG Antibody molecules to pd-l1 and uses thereof
WO2016090034A2 (en) 2014-12-03 2016-06-09 Novartis Ag Methods for b cell preconditioning in car therapy
WO2016100882A1 (en) 2014-12-19 2016-06-23 Novartis Ag Combination therapies
US10106608B2 (en) 2015-01-28 2018-10-23 Universitaet Duisburg-Essen Immunostimulatory anti-CEACAM1 antibody
WO2016120331A1 (en) 2015-01-28 2016-08-04 Karl Sebastian Lang Agonistic anti-cd66cd66 antibody for antiviral therapy
WO2016126608A1 (en) 2015-02-02 2016-08-11 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
WO2016164580A1 (en) 2015-04-07 2016-10-13 Novartis Ag Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives
EP4234685A2 (en) 2015-04-17 2023-08-30 Novartis AG Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
WO2016168595A1 (en) 2015-04-17 2016-10-20 Barrett David Maxwell Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
WO2016172583A1 (en) 2015-04-23 2016-10-27 Novartis Ag Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
WO2017015427A1 (en) 2015-07-21 2017-01-26 Novartis Ag Methods for improving the efficacy and expansion of immune cells
EP3964528A1 (en) 2015-07-29 2022-03-09 Novartis AG Combination therapies comprising antibody molecules to lag-3
WO2017019897A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to tim-3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
EP3878465A1 (en) 2015-07-29 2021-09-15 Novartis AG Combination therapies comprising antibody molecules to tim-3
EP4378957A2 (en) 2015-07-29 2024-06-05 Novartis AG Combination therapies comprising antibody molecules to pd-1
WO2017040930A2 (en) 2015-09-03 2017-03-09 The Trustees Of The University Of Pennsylvania Biomarkers predictive of cytokine release syndrome
EP4424322A2 (en) 2015-12-17 2024-09-04 Novartis AG Antibody molecules to pd-1 and uses thereof
WO2017106656A1 (en) 2015-12-17 2017-06-22 Novartis Ag Antibody molecules to pd-1 and uses thereof
WO2017106630A1 (en) 2015-12-18 2017-06-22 The General Hospital Corporation Polyacetal polymers, conjugates, particles and uses thereof
WO2017103895A1 (en) 2015-12-18 2017-06-22 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2017112741A1 (en) 2015-12-22 2017-06-29 Novartis Ag Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
EP4643874A2 (en) 2015-12-22 2025-11-05 Novartis AG Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
WO2017149515A1 (en) 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
EP3487878A1 (en) 2016-07-20 2019-05-29 University of Utah Research Foundation Cd229 car t cells and methods of use thereof
US11365252B2 (en) 2016-07-20 2022-06-21 University Of Utah Research Foundation CD229 CAR T cells and methods of use thereof
WO2018019380A1 (en) * 2016-07-28 2018-02-01 Universität Duisburg-Essen Immunostimulatory anti-ceacam1 antibodies
WO2018067992A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
WO2018102786A1 (en) 2016-12-03 2018-06-07 Juno Therapeutics, Inc. Methods for modulation of car-t cells
WO2018106738A1 (en) 2016-12-05 2018-06-14 Massachusetts Institute Of Technology Brush-arm star polymers, conjugates and particles, and uses thereof
WO2018201056A1 (en) 2017-04-28 2018-11-01 Novartis Ag Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
WO2018201051A1 (en) 2017-04-28 2018-11-01 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
WO2018223101A1 (en) 2017-06-02 2018-12-06 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
US11413310B2 (en) 2017-06-02 2022-08-16 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
US12583904B2 (en) 2017-06-02 2026-03-24 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
US11944647B2 (en) 2017-06-02 2024-04-02 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
WO2018229715A1 (en) 2017-06-16 2018-12-20 Novartis Ag Compositions comprising anti-cd32b antibodies and methods of use thereof
WO2019006427A1 (en) 2017-06-29 2019-01-03 Juno Therapeutics, Inc. Mouse model for assessing toxicities associated with immunotherapies
WO2019081983A1 (en) 2017-10-25 2019-05-02 Novartis Ag Antibodies targeting cd32b and methods of use thereof
WO2019089969A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for b-cell maturation antigen
US11623961B2 (en) 2017-11-01 2023-04-11 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for B-cell maturation antigen
WO2019089858A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
US11066475B2 (en) 2017-11-01 2021-07-20 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
US12428486B2 (en) 2017-11-01 2025-09-30 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
US12031975B2 (en) 2017-11-01 2024-07-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
WO2019090003A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Chimeric antigen receptors specific for b-cell maturation antigen (bcma)
WO2019118937A1 (en) 2017-12-15 2019-06-20 Juno Therapeutics, Inc. Anti-cct5 binding molecules and methods of use thereof
WO2019152743A1 (en) 2018-01-31 2019-08-08 Celgene Corporation Combination therapy using adoptive cell therapy and checkpoint inhibitor
WO2019210153A1 (en) 2018-04-27 2019-10-31 Novartis Ag Car t cell therapies with enhanced efficacy
WO2019213282A1 (en) 2018-05-01 2019-11-07 Novartis Ag Biomarkers for evaluating car-t cells to predict clinical outcome
WO2019241426A1 (en) 2018-06-13 2019-12-19 Novartis Ag Bcma chimeric antigen receptors and uses thereof
WO2020069405A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies
WO2020069409A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd19 chimeric antigen receptor (car) and cd22 car combination therapies
WO2020092854A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
WO2020092848A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Methods for treatment using chimeric antigen receptors specific for b-cell maturation antigen
US12473345B2 (en) 2018-11-01 2025-11-18 Juno Therapeutics, Inc. Methods for treatment using chimeric antigen receptors specific for B-cell maturation antigen
WO2020102770A1 (en) 2018-11-16 2020-05-22 Juno Therapeutics, Inc. Methods of dosing engineered t cells for the treatment of b cell malignancies
WO2020113194A2 (en) 2018-11-30 2020-06-04 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
EP4427810A2 (en) 2018-11-30 2024-09-11 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
EP3898694A4 (en) * 2018-12-20 2023-02-15 Albert Einstein College of Medicine CEACAM1 (CD66A) HUMAN IMMUNE CHECKPOINT ANTAGONIST ANTIBODIES AND THEIR FORMULATIONS, KITS AND METHODS OF USE
US12145989B2 (en) 2018-12-20 2024-11-19 Albert Einstein College Of Medicine Antagonist antibodies against human immune checkpoint CEACAM1 (CD66a) and formulations, kits, and methods of use thereof
KR102166982B1 (en) * 2019-01-24 2020-10-16 가톨릭대학교 산학협력단 Correlation of CEACAM1 and EpCAM in liver cancer and Methods for providing information for liver cancer therapeutic effect using using the same
KR20200092091A (en) * 2019-01-24 2020-08-03 가톨릭대학교 산학협력단 Correlation of CEACAM1 and EpCAM in liver cancer and Methods for providing information for liver cancer therapeutic effect using using the same
WO2020160050A1 (en) 2019-01-29 2020-08-06 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ror1)
US12268741B2 (en) 2019-01-29 2025-04-08 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ROR1)
WO2021025177A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021108613A1 (en) 2019-11-26 2021-06-03 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2021207689A2 (en) 2020-04-10 2021-10-14 Juno Therapeutics, Inc. Methods and uses related to cell therapy engineered with a chimeric antigen receptor targeting b-cell maturation antigen
EP3909601A1 (en) 2020-05-11 2021-11-17 LeukoCom GmbH A novel antibody binding specifically to human ceacam1/3/5 and use thereof
WO2021228746A1 (en) 2020-05-11 2021-11-18 Leukocom Gmbh A novel antibody binding specifically to human ceacam1/3/5 and use thereof
EP4652997A2 (en) 2020-05-19 2025-11-26 Pharmacosmos Holding A/s Cyclin-dependent kinase inhibiting compounds for the treatment of medical disorders
WO2021236650A1 (en) 2020-05-19 2021-11-25 G1 Therapeutics, Inc. Cyclin-dependent kinase inhibiting compounds for the treatment of medical disorders
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022066774A1 (en) 2020-09-23 2022-03-31 Achillion Pharmaceuticals, Inc. Pharmaceutical compounds for the treatment of complement mediated disorders
WO2022136255A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136257A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022254337A1 (en) 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023250400A1 (en) 2022-06-22 2023-12-28 Juno Therapeutics, Inc. Treatment methods for second line therapy of cd19-targeted car t cells
WO2024031091A2 (en) 2022-08-05 2024-02-08 Juno Therapeutics, Inc. Chimeric antigen receptors specific for gprc5d and bcma
WO2024100663A1 (en) 2022-11-10 2024-05-16 Famewave Ltd. Anti carcinoembryonic antigen-related cell adhesion molecule 1 (ceacam1) antibodies for inhibition of neutrophil extracellular traps (net)-mediated activities
WO2024129778A2 (en) 2022-12-13 2024-06-20 Juno Therapeutics, Inc. Chimeric antigen receptors specific for baff-r and cd19 and methods and uses thereof
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024165403A1 (en) 2023-02-06 2024-08-15 Philogen S.P.A. Anti-cea antibodies
WO2024213096A1 (en) * 2023-04-13 2024-10-17 Suzhou Neologics Bioscience Co., Ltd. Ceacam1-targeting antibodies and uses thereof
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025120867A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025121444A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2026033885A1 (en) 2024-08-08 2026-02-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2

Also Published As

Publication number Publication date
JP2015502138A (en) 2015-01-22
CA2851762A1 (en) 2013-04-18
HK1199646A1 (en) 2015-07-10
AU2012322272A1 (en) 2014-04-10
WO2013054320A1 (en) 2013-04-18
JP6170926B2 (en) 2017-07-26
IL231931B (en) 2019-06-30
US20140271618A1 (en) 2014-09-18
BR112014008893A2 (en) 2017-11-28
ES2661488T3 (en) 2018-04-02
KR20140069206A (en) 2014-06-09
PL3360899T3 (en) 2023-07-10
IL231931A0 (en) 2014-05-28
US20210070884A1 (en) 2021-03-11
CN103987729A (en) 2014-08-13
LT2744829T (en) 2018-03-26
EP3360899B1 (en) 2023-01-25
RU2014118773A (en) 2015-11-20
US20170355781A1 (en) 2017-12-14
US11891453B2 (en) 2024-02-06
AU2012322272C1 (en) 2017-11-02
AU2012322272B2 (en) 2017-08-17
CN103987729B (en) 2017-05-31
BR112014008893B1 (en) 2022-04-26
EP2744829A4 (en) 2015-06-03
CA2851762C (en) 2021-11-30
ES2942314T3 (en) 2023-05-31
EP2744829B1 (en) 2017-12-13
IN2014MN00873A (en) 2015-07-03
WO2013054331A8 (en) 2014-04-10
US9771431B2 (en) 2017-09-26
PL2744829T3 (en) 2018-06-29
EP3360899A1 (en) 2018-08-15
RU2650869C2 (en) 2018-04-17
KR102189409B1 (en) 2020-12-14
EP2744829A1 (en) 2014-06-25

Similar Documents

Publication Publication Date Title
US11891453B2 (en) Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
US12121579B2 (en) Antibodies specific to human t-cell immunoglobulin and ITIM domain (TIGIT)
RU2745707C2 (en) Fgfr2 inhibitors separately or in combination with immunostimulating agents in cancer treatment
AU2020207664B2 (en) Antibodies specific to human Nectin-2
EA037613B1 (en) Humanized antibodies against ceacam1
CN113396160A (en) Methods and pharmaceutical compositions for treating cancer resistant to immune checkpoint therapy
KR20230159823A (en) Antibodies to CD112R and uses thereof
EP2833900A1 (en) Extracellular matrix metalloproteinase inducer (emmprin) peptides and binding antibodies
CN114630679A (en) Combination of anti-GARP antibodies and immunomodulators
HK1199646B (en) Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
RU2820275C2 (en) Human nectin-2 specific antibodies
CA2997130C (en) Antibodies specific to human t-cell immunoglobulin and itim domain (tigit)
HK40060175B (en) Antibodies specific to human nectin-2

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12840002

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 231931

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2014535228

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2012322272

Country of ref document: AU

Date of ref document: 20121010

Kind code of ref document: A

Ref document number: 2851762

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14350970

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20147010511

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014118773

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014008893

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112014008893

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014008893

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140411