WO2012107566A1 - Verwendung von proteinen/peptiden, welche an grp78 (bip) binden, in labormethoden zum monitoring von thrombozyten-aggregationshemmern - Google Patents

Verwendung von proteinen/peptiden, welche an grp78 (bip) binden, in labormethoden zum monitoring von thrombozyten-aggregationshemmern Download PDF

Info

Publication number
WO2012107566A1
WO2012107566A1 PCT/EP2012/052328 EP2012052328W WO2012107566A1 WO 2012107566 A1 WO2012107566 A1 WO 2012107566A1 EP 2012052328 W EP2012052328 W EP 2012052328W WO 2012107566 A1 WO2012107566 A1 WO 2012107566A1
Authority
WO
WIPO (PCT)
Prior art keywords
grp78
bip
platelets
platelet
proteins
Prior art date
Application number
PCT/EP2012/052328
Other languages
English (en)
French (fr)
Inventor
Beate Kehrel
Martin Brodde
Original Assignee
Oxprotect Gmbh
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Oxprotect Gmbh filed Critical Oxprotect Gmbh
Publication of WO2012107566A1 publication Critical patent/WO2012107566A1/de

Links

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/86—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving blood coagulating time or factors, or their receptors

Definitions

  • the present invention relates to a laboratory method for detecting the individual inhibition of platelet function by ASA and pegylated liposomes.
  • the present invention relates to a method for the monitoring of therapeutic / prophylactic concentrations of aspirin.
  • the method relies on the inhibition of platelet activation elicited by proteins / peptides that bind to GRP78 (BiP).
  • Vascular diseases such as myocardial infarction, stroke, thrombotic occlusion of peripheral vessels are critically responsible for premature morbidity and mortality, especially from the fourth decade of life.
  • the prevalence of arterial disease is estimated at 25 - 60% 1 .
  • About 30% of all men and 15% of all women in Germany develop coronary heart disease during their lifetime.
  • the lifetime prevalence for a stroke in the German population of 18-79 years is 15.5% in men and 17.3% in women 2 .
  • Cardiovascular diseases cause the highest treatment costs, especially the so-called coronary heart disease and the Stroke stroke.
  • Arterial vascular disease increases with increasing age. As a result of demographic change in the population, the positive health trends of recent years are also relativised.
  • the rate of patients suffering from cardiovascular disease is also increasing in non-Western countries. It is estimated that the worldwide death rate due to cardiovascular disease, including stroke, will increase to 25 million a year by 2020 34 . Platelets play a key role in the mentioned disease processes.
  • Atherothrombotic occlusions They cause atherothrombotic occlusions, but are involved in the migration of leukocytes into the inflamed tissue as well as the foam cell formation and proliferation of smooth muscle cells even in the early phase of atherosclerosis, by secreting proinflammatory substances and growth factors and interacting via specific adhesion axes 5 6 .
  • Aspirin acetylsalicylic acid, ASA
  • ASA acetylsalicylic acid
  • ASA prophylaxis many patients experience a first or re-ischemic or thromboembolic vascular event (such as myocardial infarction, stroke, TIA, peripheral obstructive disease).
  • This phenomenon will commonly referred to as aspirin resistance or aspirin non-responsiveness, although pharmacologically it is not a drug resistance.
  • aspirin resistance is the inability to prevent atherothrombotic events despite treatment. Its causes could not yet be clarified clearly, despite several theories 12J3 .
  • antiplatelet agents are the ADP receptor inhibitors, such as clopidogrel and prasugrel.
  • a poor response has also been observed in some patients for platelet aggregation inhibitors from the group of ADP receptor inhibitors with thienopyridine structure 14 .
  • the poor response of platelets to thienopyridine in patients is primarily due to a loss of active metabolites of the drugs in the body 5 .
  • ASS or thienopyridine inhibited aggregation of fibrinogen-coated beads by arachidonic acid and ADP-activated platelets, respectively (Ultegra®-RPFA-ASA, Ultegra®-RPFA-ADP, Accumetrics® VerifyNow, Accumetrics, San Diego, CA, USA) .
  • Previously used "specific" measurement methods are based on the inhibition of thromboxane A2 formation by ASA, which determines the stable metabolic metabolite of A2, the thromboxane B2, in serum or urine.
  • the formation of TXB2 is inhibited by ASA in more than 98% of people US 2010227417 describes the method, composition and kit for measuring TXB2 for monitoring aspirin therapy. numerous studies have shown that high residual platelet aggregation readiness or TXB2 concentration in the urine is associated with a poor clinical prognosis 20 "22 .
  • Thromboembolic diseases are at the forefront of morbidity and mortality in the Western world. Activation of platelets leads to thrombus formation. Thromboembolic diseases in the sense of the invention encompasses all diseases which are attributable to an increased willingness for platelet activation and thrombus formation.
  • Aspirin / ASA is a substance that inhibits platelet activation. Based on the current understanding of the mechanism of action of ASA, the patient's response to ASA prophylaxis or therapy is monitored by laboratory methods which use as platelet agonists substances which are directly or indirectly dependent on cyclooxygenase in their main activation pathway, as directly in arachidonic acid and indirectly in collagen.
  • the object underlying the invention was to find platelet agonists and laboratory methods, which are predominantly cyclooxygenase in their predominant effect, because the Thromboztenmodtechnik not exclusively via thromboxane A2.
  • the part of the activation pathway which is independent of TXA2 must be inhibited by aspirin in an alternative way.
  • kits for using the method will be described.
  • Thienopyridines are inhibitors of the P2Y12 ADP receptor of platelets 28 . Therefore, in previously used test methods for the action of thienopyridines ADP is used as a platelet activator.
  • a further object of the invention was to find platelet agonists which interact directly with the thienopyridienes or their active metabolites and to develop with these platelet agonists laboratory methods suitable for the monitoring of clopidogrel and prasugrel.
  • the agonists should elicit platelet activation in the blood or platelet-rich plasma of humans and / or mammals, and the laboratory method should be applicable to human and / or mammalian blood.
  • the object indicated above is achieved according to the invention by using proteins / peptides which bind to GRP78 (BiP) as platelet agonists in methods and kits for monitoring the action of ASA instead of the classical platelet agonists (such as arachidonic acid, ADP, epinephrine, collagen and mixtures thereof ) be used.
  • the classical platelet agonists such as arachidonic acid, ADP, epinephrine, collagen and mixtures thereof
  • Suitable substances can be readily identified by binding to GRP78, activating platelets, and additionally inhibiting platelet activation by the selected substance by the addition of soluble GRP78.
  • the inhibition of activation with soluble GRP78 is sufficient by one of the many methods.
  • the appropriate agonists must additionally carry chemical groups, but not limited to FDP-lysine, which bind to free thiol groups.
  • the platelet activation can be investigated with the whole range of methods for the investigation of platelet function, which is known to the person skilled in the art 29 .
  • the inhibition of activation with soluble GRP78 is sufficient by one of the many methods.
  • HOCl-modified proteins hereunder modified as sub examples, albumin, antithrombin III, IgG), a C-terminal thrombospondin-1 peptide with the sequence RFYWMWK, amyloid beta (1-42, peptide, HNP-1 to HNP-3, the adhesion protein EAP of S. aureus, AGE-modified proteins (here as subexample AGE-BSAJ, KSCN-modified IgG, and urea (urea) -modified IgG.)
  • AGE-modified proteins here as subexample AGE-BSAJ, KSCN-modified IgG, and urea (urea) -modified IgG.
  • the invention is not limited to these examples Variety of such proteins / peptides can be easily identified by those skilled in the art.
  • GRP78 / BIP proteins / peptides which bind to GRP78 / BIP can activate platelets and that soluble GRP78 / BIP or other GRP78 / BIP inhibitors such as specific antibodies against GRP78 / BIP or ATP are able to inhibit this activation ,
  • EAP and alpha defensin as new platelet activators 31, 32 .
  • GRP78 / (BIP) could be located on the plasma membrane of the platelets (see examples). Platelet activation by the above agonists was inhibited by soluble GRP78 / BIP (see examples).
  • ROS toxic oxygen compounds
  • SOD superoxide dismutase
  • Myeloperoxidase is an enzyme of the azurophilic granules of neutrophilic granulocytes 33 ⁇ 34 . In inflammatory reactions, myeloperoxidase is also secreted into the blood plasma.
  • the heme enzyme myeloperoxidase generates in the presence of hydrogen peroxide (H 2 0 2 ) and in the plasma abundant chloride ions hypochlorites, hypochlorous acid or HOCI; further simplified as HOCI summarized.
  • HOCl-modified proteins described under several names, e.g. "Advanced oxidized protein products” and “immune defense altered proteins (Idea-Ps)" have a prothrombotic effect.
  • HOCI-modified proteins are found in arteriosclerotic lesions 40 .
  • Re and colleagues 1 showed that patients with venous thrombosis have increased HOCI-modified proteins systemically in the plasma. From EP 1 328 289 42 it is known that HOCl-modified proteins activate platelets.
  • Platelet activation leads to platelet aggregation and thrombus formation.
  • HOCI-modified proteins induce activation-dependent adhesion of platelets and fibrinogen binding to platelets. They induce the release of storage granule ingredients, the presentation of granule membrane proteins such as CD62 and CD63 on the plasma membrane of platelets, platelet aggregation, and the association between platelets and leukocytes. The oxidative burst in neutrophilic granulocytes is stimulated, leading to a vicious cycle of mutual activation of leukocytes and platelets. All of these reactions are involved in the development of thromboembolic events 43 . The aggregation of platelets by HOCl-modified albumin was shown by Volf and colleagues 44 and the working group of Adrian Gear 5 confirmed the Platelet activation by HOCl-modified LDL.
  • HOCI-modified proteins activate platelets and inhibit the entry of HI viruses into host cells.
  • WO0232445 and WO0222150 teach the platelet-activating action of HOCl-modified albumin and HOCl-modified antithrombin, respectively.
  • WO2004096368 shows the inhibition of HI virus entry into the host cell by a mixture of HOCl modified plasma proteins.
  • HOCl-modified protein binds to GRP78 / BIP.
  • GRP78 / BIP was discovered by us from the plasma membrane of platelets. Platelet activation by HOCl-modified proteins is inhibited by soluble GRP78 / BIP as shown in the examples of this invention.
  • HOCI-modified proteins are particularly suitable as platelet agonists.
  • HOCl-modified protein hereunder as subexamples human albumin, bovine serum albumin, antithrombin III
  • FIG. 1 shows binding of HOCl-modified HSA to BiP.
  • Figure 2 shows binding of HOCl-modified ATIII to the BiP.
  • Affinity Chromatography b) Binding of AGE (advanced glycation end-products) -modified protein (here as sub-examples AGE-BSA, AGE-hemoglobin, AGE-collagen) to GRP78 / BIP Biacore
  • FIG. 3 shows: GRP78 / BiP binds to the TSP-1 peptide RFYWMWK. d) binding of S. aureus protein EAP to GRP78 / BIP
  • Figure 4 shows binding of EAP to the BiP. e) binding of human alpha defensin (HNP-1) to GRP78 / BIP
  • Figure 5 shows: Defensin binds to GRP78 / BiP. f) binding of KSCN-modified immunoglobulin to GRP78 / BIP
  • Figure 6 shows: SCN - altered IgG binds to GRP78 / BiP g) binding of urea-modified immunoglobulin to GRP78 / BIP
  • Figure 7 shows: Urea-modified IgG binds to GRP78 / BiP. h) binding of amyloid beta peptide (1-42) to GRP78 / BIP
  • GRP78 / BIP binding proteins / peptides as platelet agonists and inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA.
  • HOCl-modified proteins are platelet agonists. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA.
  • Figure 8 shows: Aspirin inhibits HOCl-modified albumin-induced fibrinogen binding to platelets.
  • Figure 9 shows: Aspirin inhibits HOCl-modified albumin-induced P-selectin expression of platelets.
  • FIG. 10 shows that aspirin inhibits the HOCl-modified ATIII-induced fibrinogen binding to platelets.
  • Figure 11 shows: Aspirin inhibits HOCl-modified ATIII-induced P-selectin expression of platelets
  • Figure 12 shows: Aspirin inhibits HOCI-modified BSA-induced fibrinogen binding to platelets.
  • Figure 13 shows: Aspirin inhibits HOCI-modified BSA-induced P-selectin expression of platelets.
  • Figure 14 shows: GRP78 / BiP inhibits HOCl-modified albumin-induced fibrinogen binding to platelets.
  • Figure 15 shows: GRP78 / BiP inhibits HOCl-modified albumin-induced P. selectin expression of platelets.
  • Figure 16 shows: GRP78 / BiP inhibits HOCI-modified ATIII-induced fibrinogen binding to platelets.
  • Figure 17 shows: GRP78 / BiP inhibits HOCI-modified BSA-induced fibrinogen binding to platelets.
  • Figure 18 shows: GRP78 / BiP inhibits HOCI-modified BSA-induced P-selectin expression of platelets.
  • AGE-modified proteins here as subexamples AGE-BSA, AGE-hemoglobin, AGE-collagen
  • Figure 18 shows: GRP78 / BiP inhibits HOCI-modified BSA-induced P-selectin expression of platelets.
  • AGE-modified proteins here as subexamples AGE-BSA, AGE-hemoglobin, AGE-collagen
  • Activation markers as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion c) Thrombospondin-1 peptide with the sequence RFYWMWK is a platelet agonist. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA.
  • Activation markers as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion
  • Figure 19 shows: Aspirin inhibits TSP-1 peptide-induced fibrinogen-FITC binding to platelets.
  • FIG. 20 shows: GRP78 / BiP prevents RFYWMWK-induced fibrinogen binding to platelets.
  • S. aureus protein EAP is a platelet agonist. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA.
  • FIG. 21 shows that aspirin inhibits EAP-induced fibrinogen binding to platelets.
  • Figure 22 shows: Aspirin inhibits EAP-induced P-selectin expression of platelets.
  • FIG. 23 shows: GRP78 / BiP inhibits EAP-induced fibrinogen binding to platelets.
  • Human alpha defensins (here as sub-example HNP-1) are platelet agonists. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA. Activation markers: as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion
  • Figure 24 shows: GRP78 / BiP inhibits defensin-induced fibrinogen binding to platelets.
  • KSCN-modified proteins (hereunder sub-example immunoglobulin) are platelet agonists. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA.
  • Activation markers as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion
  • Figure 25 shows: Aspirin inhibits SCN-IgG-induced fibrinogen binding to platelets
  • Figure 26 shows the effect of aspirin on SCN " -glG-induced P-selectin expression of platelets.
  • Figure 27 shows: GRP78 / BiP inhibits SCN-altered IgG-induced fibrinogen binding to platelets.
  • Urea-modified proteins here as a sub-example immunoglobulin
  • Figure 27 shows: GRP78 / BiP inhibits SCN-altered IgG-induced fibrinogen binding to platelets.
  • Urea-modified proteins here as a sub-example immunoglobulin
  • Inhibition of soluble GRP78 / BIP activation Inhibition of activation by aspirin / ASA.
  • Figure 28 shows: Aspirin inhibits urea IgG-induced fibrinogen binding to platelets.
  • Figure 29 shows: Aspirin inhibits urea IgG-induced P-selectin expression of platelets.
  • Figure 30 shows: GRP78 / BiP inhibits urea-modified IgG-induced fibrinogen binding to platelets.
  • Figure 31 shows: GRP78 / BiP inhibits urea-altered IgG-induced P-selectin expression of platelets.
  • Activation markers as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion h) amyloid beta peptide (1-42) is a platelet agonist. Inhibition of soluble GRP78 / BIP activation. Inhibition of activation by aspirin / ASA. Activation markers: as examples fibrinogen binding to platelets, CD62P presentation on the plasma membrane as a marker for granulase secretion
  • Figure 32 shows: Aspirin inhibits ⁇ -amyloid peptide 1-42-induced fibrinogen-FITC binding to platelets.
  • Figure 33 shows: GRP78 / BiP inhibits ⁇ -amyloid peptide-induced fibrinogen binding to platelets.
  • Figure 34 shows: platelet aggregation induced by EAP; Inhibition by ASA
  • Figure 35 shows: platelet aggregation induced by the TSP-1 peptide RFYWMWK; Inhibition by ASA
  • Figure 36 shows: control: platelet aggregation induced by arachidonic acid; Inhibition by ASA b) ASA inhibits platelet aggregation in plasma and whole blood induced by GRP78 / BIP binding proteins / peptides (impedance method, multiplate)
  • Figure 40 shows: results for urea IgG
  • Electrodes are introduced into hirudin-anticoagulated whole blood.
  • Activation of platelets in the classical test is based on the response to aspirin / ASA by arachidonic acid.
  • activation is by proteins / peptides which bind to GRP78 / BIP. Attachment of the activated platelets to the Electrode increases the electrical resistance. The increase in impedance is reported in "Aggregation Units" (AU), recorded continuously and plotted against time, creating an aggregation curve.
  • AU Aggregation Units
  • the rate of change and the amount of turbidity that occurs by platelet aggregation in whole blood samples are measured.
  • the arachidonic acid is replaced with a protein / peptide that binds to GRP78 / BIP.
  • ASA inhibits the release of granule contents from GRP78 / BIP binding proteins / peptides activated platelets, (here as subexamples: ATP luminescence assay, PF4 ELISA, TSP-1 ELISA)
  • ASS inhibits the activation of GRP78 / BIP binding proteins / peptides activate platelets, increasing the number of subsequently adhered / aggregated platelets in the Impact Cone and Plate (let) Analyzer.
  • ASA inhibits thrombus formation when blood flows through a coated capillary under shear stress conditions (adhesion and aggregation on a collagen membrane apparatus PFA-100 principle) - ASA inhibits the decrease in single platelets caused by platelet aggregation (agonists GRP78 / BIP binding proteins / peptides)
  • ASS inhibits the GRP78 / BIP binding proteins / peptides induced activation-induced changes on platelets, which are measurable by flow cytometry
  • ASS therapy inhibits the ex vivo activation of platelets by GRP78 / BIP binding proteins / peptides a) Subject 1 activation of platelets by GRP78 / BIP binding proteins / peptides prior to intake of ASA, after 325 mg starting dose, after 3 days with a dose of 100 mg / day b) Subject 2 Activation of platelets by GRP78 / BIP binding proteins / peptides prior to intake of ASA, after 325 mg starting dose, after 3 days at a dose of 100 mg / day c) Subject 3 activation of platelets by GRP78 / BIP binding proteins / peptides before taking ASA, after 325 mg starting dose, after 3 days at a dose of 100 mg / day
  • Thienopyridine therapy inhibits ex vivo activation of platelets by GRP78 / BIP binding proteins / peptides carrying chemical groups that interact with free thiol groups.
  • Another drug that inhibits platelet activation by GRP78 / BIP binding proteins / peptides are pegylated liposomes (Patent Application No. 10 2010 043 733.6)
  • Neutrophil alpha-defensins activate platelets via the cell surface chaperones PDI and BiP (Grp78) - inhibition by staphylokinase, tissue plasminogen activator and serpins, submitted for publication
  • EAP extracellular adherence protein
  • EP1328289 Kehrel B and Brodde M. Inhibition of the interaction between oxidized proteins and CD36 or the mechanism Jurk K, Kehrel BE. The role of platelets in haemostasis, thrombosis, immune defense and inflammation. Dtsch Med Klischr. 2008 May; 133 (21): 1 130-5

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Hematology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Urology & Nephrology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

Zur Untersuchung des Einflusses von Medikamenten auf die Thrombozytenfunktion werden erfindungsgemäß Proteine oder Peptide eingesetzt, welche an GRP78/BIP binden.

Description

Verwendung von Proteinen/Peptiden, welche an GRP78 (BIP) binden, in Labormethoden zum Monitoring von Thrombozyten-Aggregations- hemmern
Beschreibung
Erfindungsgebiet:
Die vorliegende Erfindung betrifft eine Labormethode zur Erfassung der individuellen Hemmung der Thrombozytenfunktion durch ASS und pegylierte Liposomen.
Die vorliegende Erfindung betrifft insbesondere eine Methode für das Monitoring von therapeutischen/prophylaktischen Konzentrationen von Aspirin. Die Methode beruht auf der Hemmung der durch Proteine/Peptide, welche an GRP78 (BiP) binden, ausgelösten Thrombozytenaktivierung.
Hintergrund der Erfindung:
Vaskuläre Erkrankungen wie Herzinfarkt, Schlaganfall, thrombotischer Verschluss peripherer Gefäße sind für eine vorzeitige Morbidität und Mortalität insbesondere ab der vierten Lebensdekade entscheidend mitverantwortlich. Die Prävalenz von arteriellen Erkrankungen wird auf 25 - 60 % geschätzt 1. Etwa 30 % aller Männer und 15 % aller Frauen in Deutschland erkranken im Laufe ihres Lebens an einer koronaren Herzkrankheit. Die Lebenszeit-Prävalenz für einen Schlaganfall in der deutschen Bevölkerung von 18 - 79 Jahren beträgt insgesamt 15,5 % bei Männern und 17,3 % bei Frauen 2.
Herz-Kreislauf-Erkrankungen verursachen die höchsten Behandlungskosten, wobei vor allem die so genannte koronare Herzkrankheit sowie der Schlaganfall zu Buche schlagen. Arterielle Gefäßerkrankungen nehmen mit steigendem Lebensalter zu. Durch den demografischen Wandel in der Bevölkerung relativieren sich daher auch die positiven Gesundheitstrends der letzten Jahre. Auch in Ländern des nichtwestlichen Kulturkreises steigt die Rate der Patienten, welche an einer Herz-Kreislauf-Erkrankung leiden. Man geht davon aus, dass die Sterberate weltweit infolge von Herz- Kreislauf-Erkrankung incl. Schlaganfall bis 2020 auf 25 Millionen pro Jahr steigen wird 34. Thrombozyten spielen bei den erwähnten Krankheitsprozessen eine Schlüsselrolle. Sie verursachen atherothrombotische Gefäßverschlüsse, sind aber auch schon in der frühen Phase der Arteriosklerose an der Auswanderung von Leukozyten in das entzündete Gewebe sowie an der Schaumzellbildung und Proliferation glatter Muskelzellen beteiligt, indem sie proinflammatorische Substanzen und Wachstumsfaktoren sezernieren und über spezifische Adhäsionsachsen interagieren 5 6.
Entzündungsreaktionen und thromboembolische Erkrankungen sind in ihrer Genese eng miteinander verwoben. Libby und Simon 2001 7 sowie Wagner und Burger 8 verdeutlichen in ihren Übersichtsartikeln die Bedeutung der Thrombozyten bei Entzündungsreaktionen und für thromboembolische Erkrankungen. Huo und Kollegen 9 beschrieben, dass aktivierte Thrombozyten arteriosklerotische Gefäßveränderungen verstärken.
Aspirin (Acetylsalicylsäure, ASS) ist das am häufigsten verordnete Medikament zur Verhinderung von Gefäßthromben. Der Nutzen einer Sekundärprophylaxe kardiovaskulärer Ereignisse mittels ASS ist unstrittig Die kardiovaskuläre Wirkung des Medikaments wird bisher allgemein auf die Blockierung der Synthese von Thromboxan A2 durch irreversible Inaktivierung der Cyclooxygenase-1 in Thrombozyten zurückgeführt 10, 11.
Trotz ASS-Prophylaxe erleiden viele Patienten ein erstes oder erneutes ischämisches oder thromboembolisches Gefäßereignis (wie Herzinfarkt, Schlaganfall, TIA, periphere Verschlusskrankeit). Dieses Phänomen wird allgemein als Aspirinresistenz oder «aspirin non-responsiveness» bezeichnet, obwohl es sich pharmakologisch nicht um eine Medikamentenresistenz handelt. Klinisch ist Aspirinresistenz das Unvermögen atherothrombotische Ereignisse trotz Behandlung zu verhindern. Seine Ursachen konnten bisher trotz mehrerer Theorien noch nicht eindeutig geklärt werden 12J3.
Eine andere Gruppe von so genannten Thrombozytenaggregationshemmern sind die ADP-Rezeptor-Hemmer, wie zum Beispiel Clopidogrel und Prasugrel.
Auch für die Thrombozytenaggregationshemmer aus der Gruppe der ADP- Rezeptor-Hemmer mit Thienopyridinstruktur ist bei einigen Patienten ein schlechtes Ansprechen beobachtet worden 14. Das schlechte Ansprechen der Thrombozyten auf Thienopyridine in Patienten beruht in erster Linie auf einem Verlust von aktiven Metaboliten der Medikamente im Körper 5.
Insbesondere Patienten mit Diabetes mellitus zeigen eine verstärkte Aktivierungsbereitschaft der Thrombozyten und ein schlechteres Ansprechen auf eine Therapie mit Thienopyridinen als Patienten, welche nicht an Diabetes leiden 16. Um diejenigen Patienten zu identifizieren, welche mit der üblichen Konzentration von ASS oder ADP-Rezeptorhemmern der Gruppe der Thienopyridine vermutlich nicht ausreichend vor thromboembolischen Ereignissen geschützt sind, wurden unterschiedliche, kommerziell genutzte Labormethoden entwickelt.
So existieren relativ unspezifische Globalmethoden wie
- der Plättchen reaktivitätsindex nach Grotemeyer 17· 18,
- die residuale Arachidonsäure oder ADP induzierte Thrombozytenaggregation nach Born (Prinzip Lichttransmission) 19,
- die durch ASS oder Thienopyridine vermittelte Verhinderung der durch Thrombozytenaggregation (Agonisten ADP oder Arachidonsäure) ausgelösten Abnahme von singulären Thrombozyten (z.B. "plateletworks") oder als Impedanzmethode, z.B. mit dem "Multiplate" („ASPItest" Pentapharm GmbH, München),
- die Verminderung der Adhäsion/Aggregation von Thrombozyten an die Wände einer mit Kollagen plus Adrenalin oder Kollagen plus ADP beschichteten Kapillare unter Scherstressbedingungen im PFA 100 (Siemens Healthcare Diaqnostics),
- das ASS bzw. Thienopyridin inhibierte Zusammenballen von mit Fibrinogen beschichteten Kügelchen durch mit Arachidonsäure, bzw. ADP aktivierte Thrombozyten (Ultegra®-RPFA-ASA, Ultegra®-RPFA- ADP, Accumetrics® VerifyNow, Accumetrics, San Diego, CA, USA),
- die ASS oder Thienopyridin induzierte Reduktion der Adhäsion und Aggregation durch Arachidonsäure bzw. ADP voraktivierte Thrombozyten und
- die Hemmung der Reduktion durch ASS im Impact „Cone and Plate(let) Analyzer" (Matis Medical Inc, Beersei, Belgium).
Mittels Durchflusszytometrie sind nach Aktivierung von Thrombozyten mit Arachidonsäure, bzw. ADP Aktivierungsmarker, wie z.B. Fibrinogenbindung, Aktivierungszustand des GPIIb/llla Rezeptors, Presentation von Granulamembranproteinen auf der Plasmamembran, wie DC63 und CD62P, Assoziation von Thrombozyten mit Leukozyten, messbar. Die Hemmung der Aktivierung durch ASS kann quantitativ evaluiert werden. US 2005255534 beschreibt ein Methode Thrombozyten mit einem Cyclooxygenase abhängigen Agonisten, wie die Arachidonsäure, zu aktivieren und dann sezerniertes ATP zu bestimmen.
Bisher genutzte„spezifische" Messmethoden beruhen auf der Hemmung der Thromboxan A2 Bildung durch ASS. Dabei wird der stabile Stoffwechselmetabolit des A2, das Thromboxan B2, im Serum oder im Urin bestimmt. Die Bildung von TXB2 wird bei über 98% der Menschen durch ASS gehemmt. US 2010227417 beschreibt die Methode, Zusammensetzung und einen Kit für die Messung von TXB2 zum Monitoring einer Aspirintherapie. in zahlreichen Studien konnte gezeigt werden, dass eine hohe verbleibende Plättchenaggregationsbereitschaft oder TXB2 Konzentration im Urin mit einer schlechten klinischen Prognose vergesellschaftet ist 20"22.
Es ist daher wichtig, die Wirkung von ASS im individuellen Patienten zu monitoren. Es gilt aber noch wichtige Probleme zu klären. Unterschiedliche Tests zur Wirkung von Aspirin korrelieren nur schwach miteinander. Die Rate der mit diesen Labormethoden identifizierten Patienten schwankt stark. So wurden ASS-Resistenzraten zwischen 5 % 23 optische Thrombozytenaggregationsanalyse mit Arachidonsäure und ADP als Agonisten) und über 50 % 24. PFA 100) berichtet. Auch gibt es eine Gruppe von Patienten, deren Thrombozyten trotz kompletter Inhibition der TXA2 Bildung aggregierbar sind (Pseudo-Aspirin-Resistenz) 25.
Der Mechanismus, welcher der„Aspirinresistenz" zugrunde liegt, ist bis heute nicht gefunden worden. Ein multifunktionelles Geschehen wird diskutiert.
Bei der Auswahl von Labormethoden zur Erfassung der Wirkung von ASS auf Thrombozyten wird aber bisher stets auf die Hemmung des Arachidonsäure/Thromboxane Stoffwechselweges abgezielt. So empfehlen Svenstrup et al., dass "Zitat: bei allen Untersuchungen des Thrombozyten- inhibitorischen Effekts von Aspirin der Agonist und dessen Konzentration mit größter Sorgfalt gewählt werden. Mehr spezifisch sollten Arachidonsäure, Kollagen, Epinephrin (Adrenalin) und niedrig-dosiertes Adenosin-Diphosphat (ADP) gewählt werden" 26·27.
Auch der Mechanismus der Thienopyridinresistenz, oft auch nach einem Vertreter der Medikamentenklasse "Clopidogrelresistenz" genannt, ist trotz großer Bemühungen noch nicht beschrieben worden. Analog wie für Aspirin/ASS beschrieben, ist auch das Monitoring von Patienten, welche Thienopyridine zur Prophylaxe oder Therapie einnehmen, zur optimalen Behandlung hilfreich.
Um die Wirkung der Therapie mit Aspirin/ASS und Thienopyridine auf Thrombozyten besser monitoren zu können, muss eine Methode gefunden werden, welche auf einem neuen zusätzlichen Wirkmechanismus von ASS und von Thienopyridinen beruht.
Probleme, welche durch die Erfindung gelöst werden:
Thromboembolische Erkrankungen stehen an der Spitze der Ursachen für Morbidität und Mortalität in der westlichen Welt. Aktivierung von Thrombozyten führt zur Thrombusbildung. Thromboembolische Erkrankungen im Sinne der Erfindung umfasst alle Erkrankungen, die auf eine erhöhte Bereitschaft zur Thrombozytenaktivierung und zur Thrombusbildung zurückzuführen sind. Aspirin/ASS ist eine Substanz, welche die Thrombozytenaktivierung hemmt. Aufgrund der zur Zeit gültigen Vorstellung über den Wirkmechanismus von ASS wird das Ansprechen eines Patienten auf eine ASS-Prophylaxe oder -Therapie über Labormethoden gemonitort, welche als Thrombozyten Agonisten Substanzen einsetzen, welche in ihrem Hauptaktivierungsweg direkt oder indirekt von der Cyclooxygenase abhängig sind, wie dies direkt bei der Arachidonsäure und indirekt beim Kollagen der Fall ist.
Die der Erfindung zugrunde liegenden Aufgabe war es, Thrombozytenagonisten und Labormethoden zu finden, welche in ihrer überwiegenden Wirkung Cyclooxygenase unabhängig sind, weil die Thromboztenaktivierung nicht ausschließlich über Thromboxan A2 verläuft. Der Teil des Aktivierungsweges, welcher TXA2 unabhängig ist, muss durch Aspirin auf einem alternativen Weg gehemmt werden. Mit Hilfe der Thrombozytenagonisten dieser Erfindung sollen Kits zur Anwendung der Methode beschrieben werden. Thienopyridine sind Inhibitoren des P2Y12-ADP-Rezeptors der Thrombozyten 28. Daher wird in bisher genutzten Testmethoden zur Wirkung der Thienopyridine ADP als Thombozytenaktivator eingesetzt.
Eine weitere Aufgabe der Erfindung war es, Thrombozytenagonisten zu finden, welche direkt mit den Thienopyridienen oder ihren aktiven Metaboliten wechselwirken und mit diesen Thrombozytenagonisten Labormethoden zu entwickeln, die für das Monitoring von Clopidogrel und Prasugrel geignet sind.
Die Agonisten sollten im Blut oder Plättchen reichem Plasma von Menschen und/oder Säugetieren eine Thrombozytenaktivierung hervorrufen und die Labormethode sollte mit Blut von Menschen und/oder Säugetieren angewendet werden können.
Offenbarung der Erfindung:
Gelöst wird die vorstehend aufgezeigte Aufgabe erfindungsgemäß dadurch, dass Proteine/Peptide, welche an GRP78 (BiP) binden, als Thrombozytenagonisten in Methoden und Kits zum Monitoring der Wirkung von ASS anstelle der klassischen Thrombozytenagonisten (wie Arachidonsäure, ADP, Adrenalin, Kollagen und Gemischen daraus) verwendet werden.
Geeignete Substanzen können dadurch leicht identifiziert werden, dass sie an GRP78 binden, dass sie Thrombozyten aktivieren und dass zusätzlich die Thrombozytenaktivierung durch die ausgewählte Substanz durch Zusatz von löslichem GRP78 gehemmt werden kann.
Im Sinne der Erfindung reicht die Hemmung der Aktivierung mit löslichem GRP78 durch eine der vielen Methoden. Für das Monitoring der Therapie mit Thienopyridinen müssen die geeigneten Agonisten zusätzlich chemische Gruppen, wie aber nicht beschränkt auf FDP-Lysin tragen, welche an freie Thiolgruppen binden.
Die Thrombozytenaktivierung kann dabei mit der ganzen Palette der Methoden zur Untersuchung der Thrombozytenfunktion, welche dem Fachmann bekannt ist 29 untersucht werden. Im Sinne der Erfindung reicht die Hemmung der Aktivierung mit löslichem GRP78 durch eine der vielen Methoden aus.
Als Beispiele für derartige Substanzen wurden von uns HOCI-modifizierte Proteine (hier als Unterbeispiele modifiziertes Albumin, Antithrombin III, IgG), ein C-terminales Thrombospondin-1 Peptid mit der Sequenz RFYWMWK, Amyloid beta (1 -42; Peptid, HNP-1 bis HNP-3, das Adhäsionsprotein EAP von S aureus, AGE-modifizierte Proteine (hier als Unterbeispiel AGE-BSAJ, KSCN-modifiziertes IgG, und Harnstoff (Urea)-modifiziertes IgG gefunden. Die Erfindung beschränkt sich aber nicht auf diese Beispiele. Eine Vielzahl derartiger Proteinen/Peptide kann sehr leicht vom Fachmann identifiziert werden.
Die US-Patentanmeldung US 20080220446 beschreibt die Identifizierung von Proteinen mit einer„Cross-beta" Struktur.
Herczenik et al. zeigte 2007, dass Thrombozyten durch die in Ihrer Konformation veränderten Proteine Amyloid-beta
(DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGW; 1-40), amyloidogenic peptide of Herpes Simplex virus, genannt glycoprotein B, (GDVGRAVGKWMGIVGGWSA), Glyciertes Haemoglobin (Hb-AGE) and Rinderserumalbumin (BSA-AGE Hb-AGE, BSA-AGE), Fibrin alpha Kettenpeptid 12 (148KRLEVDIDIKIR15), aktiviert werden können 30.
Die Autoren beschreiben eine Aktivierung der Thrombozyten über die Rezeptoren CD36 und GPIb. Außerdem wurde im Rahmen der vorliegenden Erfindung festgestellt, dass die Aktivierung von Thrombozyten durch missgefaltete Proteine/Peptide durch pegylierte Liposomen inhibiert werden kann.
Untersuchungen im Rahmen der vorliegenden Erfindung konnten zeigen, dass Proteine/Peptide, welche an GRP78/BIP binden, Thrombozyten aktivieren können und dass lösliches GRP78/BIP oder andere GRP78/BIP Inhibitoren wie spezifische Antikörper gegen GRP78/BIP oder ATP diese Aktivierung zu hemmen vermögen. So identifizierten wir EAP und alpha Defensin als neue Thrombozytenaktivatoren 31, 32. GRP78/(BIP) konnte von uns auf der Plasmamembran der Thrombozyten lokalisiert werden (siehe Beispiele). Die Thrombozytenaktivierung durch die oben genannten Agonisten wurde durch lösliches GRP78/BIP gehemmt (siehe Beispiele).
Die Freisetzung von Entzündungsmediatoren und vasoaktiven Substanzen sind für die Entstehung von thrombotischen und thromboembolischen Gefäßverschlüssen von entscheidender Bedeutung. Auch eine Unterversorgung des Gewebes mit Blut und anschließende Öffnung der Gefäße führt zu Entzündungsreaktionen und verursacht die Ischämie- Reperfusionsverletzung. Dabei kommt es zu einer Anflutung von toxischen Sauerstoffverbindungen (ROS), die von den Entgiftungsenzymen Superoxiddismutase (SOD) und Katalase nicht mehr vollständig neutralisiert werden können. Die Myeloperoxidase ist ein Enzym der azurophilen Granula der neutrophilen Granulozyten 33· 34. Bei Entzündungsreaktionen wird Myeloperoxidase auch ins Blutplasma sezerniert. So fanden Baldus und Kollegen und Brennan und Kollegen, dass eine erhöhte Konzentration von Myeloperoxidase im Serum 35, bzw. Plasma 36 ein ausgezeichneter prognostischer Marker für ein bevorstehendes thrombotisches Koronarereignis ist. Bei Patienten mit Entzündungen in periphären Gefäßen hat sich die Myeloperoxidase als prognostischer Marker für Herzinfarkte und Schlaganfälle herausgestellt 37 und erhöhte Myeloperoxidasekonzentrationen im Plasma zeigen eine Schädigung des Endothels an 38. Der Übersichtsartikel von Libby 39 zeigt die molekularen Mechanismen zur Entstehung von arteriellen Thrombosen auf.
Das Häm-Enzym Myeloperoxidase generiert in Gegenwart von Wasserstoff- Peroxid (H202) und im Plasma reichlich vorhandenen Chlorid-Ionen Hypochlorite, hypochlorige Säure oder auch HOCI; im weiteren vereinfacht als HOCI zusammengefasst.
Durch HOCI modifizierte Proteine, welche unter mehreren Namen beschrieben wurden, wie z.B. „advanced oxidised protein products" und „immune defense altered proteins (Idea-Ps)", wirken prothrombotisch.
HOCI modifizierte Proteine, insbesondere HOCI-oxLDL, werden in arteriosklerotischen Läsionen gefunden 40. Re und Kollegen 1 zeigten, dass Patienten mit venösen Thrombosen vermehrt HOCI-modifizierte Proteine systemisch im Plasma aufweisen. Aus EP 1 328 289 42 ist bekannt, dass HOCI modifizierte Proteine Thrombozyten aktivieren.
Thrombozytenaktivierung führt zur Aggregation der Thrombozyten und zur Thrombusbildung.
HOCI modifizierte Proteine induzieren die aktivierungsabhängige Adhäsion von Thrombozyten und die Fibrinogenbindung an Thrombozyten. Sie induzieren die Freisetzung der Speichergranulainhaltsstoffe, die Präsentation von Granulamembranproteinen, wie CD62 und CD63 auf der Plasmamembran der Thrombozyten, die Plättchenaggregation und die Assoziation zwischen Thrombozyten und Leukozyten. Der oxidative Burst in neutrophilen Granulozyten wird angeregt und so kommt es zu einem Teufelskreis der gegenseitigen Aktivierung von Leukozyten und Thrombozyten. All diese Reaktionen sind an der Entstehung von thromboembolischen Ereignissen beteiligt 43. Die Aggregation von Thrombozyten durch HOCI modifiziertes Albumin wurde von Volf und Kollegen 44 gezeigt und die Arbeitsgruppe von Adrian Gear 5 bestätigte die Thrombozytenaktivierung durch HOCl modifiziertes LDL. HOCI-modifizierte Proteine aktivieren Thrombozyten und hemmen den Eintritt von HI-Viren in Wirtszellen. WO0232445 und WO0222150 lehren die Thrombozyten- aktivierende Wirkung von HOCl modifiziertem Albumin bzw. von HOCl modifiziertem Antithrombin. WO2004096368 zeigt die Hemmung des HI- Virus Eintritts in die Wirtszelle durch ein Gemisch aus HOCl modifizierten Plasmaproteinen.
Die Ausführungen zeigen, dass HOCI-modifizierte Proteine in vivo an der Entstehung von thrombotischen Ereignissen beteiligt sind.
Wie in dieser Erfindungsmeldung gezeigt, bindet HOCI-modifiziertes Protein an GRP78/BIP. GRP78/BIP wurde von uns aus der Plasmamembran von Thrombozyten entdeckt. Die Thrombozytenaktivierung durch HOCI- modifizierte Proteine wird, wie in den Beispielen zu dieser Erfindung gezeigt, durch lösliches GRP78/BIP gehemmt.
Überraschenderweise konnte die Aktivierung von Thrombozyten durch alle getesteten GRP78 bindende Proteine/Peptide durch ASS vollständig gehemmt werden. Diese Hemmung beruht zum überwiegenden Teil darauf, dass ASS die Bindung dieser Proteine an GRP78 verdrängt.
Durch Ersatz des/der konventionellen Thrombozytenagonisten in Methoden und Kits zum Monitoring der ASS-Therapie und ASS-Prophylaxe durch Proteine/Peptide, welche an GRP78/Bip binden, konnten die Wirkung von ASS auf den neu entdeckten Mechanismus gemessen und so neue Methoden zum Monitoring von ASS entwickelt werden. Die aktiven Metabolite der Thienopyridine tragen freie SH-Gruppen, welche irreversibel an den P2Y12 ADP-Rezeptor der Thrombozyten binden. (Metabolism and disposition of the thienopyridine antiplatelet druqs ticlopidine, Clopidogrel, and prasuqrel in humans. Farid NA, Kurihara A, Wrighton SA. J Clin Pharmacol. 2010 Feb;50(2):126-42.) Wir konnten zeigen, dass HOCI-modifizierte Proteine mit freien SH-Gruppen reagieren. So hemmt zugesetztes Glutathion dosisabhängig und vollständig die Thrombozyten aktivierende Wirkung von HOCI-modifizierten Proteinen (siehe Beispiel).
Zum Monitoring von Thienopyridintherapien eignen sich daher HOCI- modifizierte Proteine als Thrombozytenagonisten in ganz besonderer Weise.
Beispiele
Die Erfindung wird nun durch die folgenden Beispiele, die in keiner Weise den Umfang der Erfindung begrenzen, beschrieben. Die folgenden Beispiele erläutern die Erfindung. Sie schließen für den Fachmann geläufige Abwandlungen ein.
1. Beispiel
Identifizierung von geeigneten Thrombozyten-Agonisten gemäß Erfindung a) Bindung von HOCI-modifiziertem Protein (hier als Unterbeispiele Human- Albumin, RinderSerumalbumin, Antithrombin III) an GRP78/BIP
Figur 1 zeigt: Bindung von HOCI-modifiziertem HSA an die BiP.
Figur 2 zeigt: Bindung von HOCI-modifiziertem ATIII an die BiP.
Biacore
Elisa-Verfahren
Affinitätschromatographie b) Bindung von AGE (advanced glycation end-products)-modifiziertem Protein (hier als Unterbeispiele AGE-BSA, AGE-Hämoglobin, AGE-Kollagen) an GRP78/BIP Biacore
Elisa-Verfahren
Affinitätschromatographie c) Bindung von Thrombospondin-1 Peptid mit der Sequenz RFYWMWK an GRP78/BIP
Biacore
Elisa-Verfahren
Affinitätschromatographie
Figur 3 zeigt: GRP78/BiP bindet an das TSP-1 Peptid RFYWMWK. d) Bindung von S.aureus Protein EAP an GRP78/BIP
Biacore
Elisa-Verfahren
Affinitätschromatographie
Figur 4 zeigt: Bindung von EAP an die BiP. e) Bindung von humanem alpha Defensin (HNP-1 ) an GRP78/BIP
Biacore
Elisa-Verfahren
Affinitätschromatographie
Figur 5 zeigt: Defensin bindet an GRP78/BiP. f) Bindung von KSCN-modifiziertem Immunglubulin an GRP78/BIP
Biacore
Elisa-Verfahren
Äff i n itätsch rom atog ra p h ie
Figur 6 zeigt: SCN - verändertes IgG bindet an GRP78/BiP g) Bindung von Urea-modifiziertem Immunglobulin an GRP78/BIP
Biacore
Elisa-Verfahren
Affinitätschromatographie
Figur 7 zeigt: Harnstoff (Urea)-verändertes IgG bindet an GRP78/BiP. h) Bindung von amyloid beta peptid (1-42) an GRP78/BIP
Biacore
Elisa-Verfahren
Affinitätschromatographie
2. Beispiel
Verwendung von GRP78/BIP bindenden Proteinen/Peptiden als Thrombozytenagonisten und Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
HOCI-modifizierte Proteine (hier als Unterbeispiele Human-Albumin, RinderSerumalbumin, Antithrombin III) sind Thrombozytenagonisten. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Figur 8 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes Albumininduzierte Fibrinogenbindung an Thrombozyten.
Figur 9 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes Albumininduzierte P-Selektin Expression von Thrombozyten.
Figur 10 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes ATlII-induzierte Fibrinogenbindung an Thrombozyten. Figur 11 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes ATlII-induzierte P-Selektin Expression von Thrombozyten
Figur 12 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes BSA-induzierte Fibrinogenbindung an Thrombozyten.
Figur 13 zeigt: Aspirin inhibiert die durch HOCI-modifiziertes BSA-induzierte P-Selektin Expression von Thrombozyten.
Figur 14 zeigt: GRP78/BiP inhibiert die durch HOCI-modifiziertes Albumininduzierte Fibrinogenbindung an Thrombozyten.
Figur 15 zeigt: GRP78/BiP inhibiert die durch HOCI-modifiziertes Albumininduzierte P. Selektin Expression von Thrombozyten.
Figur 16 zeigt: GRP78/BiP inhibiert die durch HOCI-modifiziertes ATlII- induzierte Fibrinogenbindung an Thrombozyten.
Figur 17 zeigt: GRP78/BiP inhibiert die durch HOCI-modifiziertes BSA induzierte Fibrinogenbindung an Thrombozyten.
Figur 18 zeigt: GRP78/BiP inhibiert die durch HOCI-modifiziertes BSA induzierte P-Selektin Expression von Thrombozyten. b) AGE-modifizierte Proteine (hier als Unterbeispiele AGE-BSA, AGE- Hämoglobin, AGE-Kollagen) sind Thrombozytenagonisten. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion c) Thrombospondin-1 Peptid mit der Sequenz RFYWMWK ist ein Thrombozytenagonist. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion
Figur 19 zeigt: Aspirin hemmt die TSP-1 Peptid-induzierte Fibrinogen-FITC- Bindung an Thrombozyten.
Figur 20 zeigt: GRP78/BiP verhindert die RFYWMWK-induzierte Fibrinogenbindung an Thrombozyten. d) S. aureus Protein EAP ist ein Thrombozytenagonist .Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Figur 21 zeigt: Aspirin inhibiert die EAP induzierte Fibrinogenbindung an Thrombozyten.
Figur 22 zeigt: Aspirin inhibiert die EAP-induzierte P-Selektin Expression von Thrombozyten.
Figur 23 zeigt: GRP78/BiP inhibiert die EAP-induzierte Fibrinogenbindung an Plättchen. e) Humanes alpha Defensine (hier als Unterbeispiel HNP-1 ) sind Thrombozytenagonisten. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS. Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion Figur 24 zeigt: GRP78/BiP inhibiert die Defensin-induzierte Fibrinogenbindung an Thrombozyten. f) KSCN-modifizierte Proteine (hier als Unterbeispiel Immunglobulin) sind Thrombozytenagonisten. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion
Figur 25 zeigt: Aspirin inhibiert die SCN -IgG induzierte Fibrinogenbindung an Thrombozyten
Figur 26 zeigt den Einfluss von Aspirin auf die SCN"-lgG induzierte P- Selektin Expression von Thrombozyten.
Figur 27 zeigt: GRP78/BiP inhibiert die durch SCN -verändertes IgG induzierte Fibrinogenbindung an Thrombozyten. g) Urea-modifizierte Proteine (hier als Unterbeispiel Immunglobulin) sind Thrombozytenagonisten. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS.
Figur 28 zeigt: Aspirin inhibiert die Urea-IgG induzierte Fibrinogenbindung an Thrombozyten.
Figur 29 zeigt: Aspirin inhibiert die Urea-IgG-induzierte P-Selektin Expression von Thrombozyten.
Figur 30 zeigt: GRP78/BiP inhibiert die durch Harnstoff-verandertes IgG induzierte Fibrinogenbindung an Thrombozyten. Figur 31 zeigt: GRP78/BiP inhibiert die durch Harnstoff-verändertes IgG induzierte P-Selektin Expression von Thrombozyten.
Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion h) Amyloid beta peptid (1-42) ist ein Thrombozytenagonist. Hemmung der Aktivierung durch lösliches GRP78/BIP. Hemmung der Aktivierung durch Aspirin/ASS. Aktivierungsmarker: als Beispiele Fibrinogenbindung an Thrombozyten, CD62P Präsentation auf der Plasmamembran als Marker für die Granulasekretion
Figur 32 zeigt: Aspirin inhibiert die ß-Amyloid-Peptid 1-42-induzierte Fibrinogen-FITC-Bindung an Thrombozyten.
Figur 33 zeigt: GRP78/BiP inhibiert die durch ß-Amyloid-Peptid-induzierte Fibrinogenbindung an Thrombozyten.
3. Beispiel
Darstellung der Hemmung der Thrombozytenaktivierung durch GRP78/BIP bindende Proteine/Peptide mittels Aspirin/ASS in unterschiedlichen Analysemethoden und Analysegeräten
Allgemeines: Bei Verwendung von Proteinen/Peptiden, welche an GRP78/BIP binden, gemäß dieser Erfindung eignen sich insbesondere Antikoagulantien, welche die Ca++-Konzentration im Blut nicht verändern. Citrat, EDTA, Heparin, Heparinderivate und Heparinoide sind für Anwendungen in Methoden gemäß Erfindung nicht geeignet. Als Antikoagulanz besonders geeignet sind dagegen direkte Thrombininhibitoren wie Hirudin (25 Mg/ml), Melagatran, Dabigatran. Hirudin- Blutentnahmeröhrchen sind für gängige Blutentnahmesysteme verfügbar, z.B. von Sarstaedt. a) ASS hemmt die durch GRP78/BIP bindende Proteine/Peptide ausgelöste Thrombozytenaggregation im Plasma (Lichttransmission, Thrombozytenaggregation nach Born)
Figur 34 zeigt: Thrombozytenaggregation induziert durch EAP; Inhibition durch ASS
Figur 35 zeigt: Thrombozytenaggregation induziert durch das TSP-1 Peptid RFYWMWK; Inhibition durch ASS
Figur 36 zeigt: Kontrolle: Thrombozytenaggregation induziert durch Arachidonsäure; Inhibition durch ASS b) ASS hemmt die durch GRP78/BIP bindende Proteine/Peptide ausgelöste Thrombozytenaggregation im Plasma und Vollblut (Impedanzmethode, Multiplate)
1 ) Figur 37 zeigt: Ergebnisse für EAP
2) Figur 38 zeigt: Ergebnisse für modifiziertes Albumin
3) Figur 39 zeigt: Ergebnisse für SCN -IgG
4) Figur 40 zeigt: Ergebnisse für Urea-IgG
5) Figur 41 zeigt: Ergebnisse für Kontrolle: Arachidonsäure
Bei der Messung werden Elektroden in Hirudin-antikoaguliertes Vollblut eingebracht. Die Aktivierung der Thrombozyten erfolgt im klassischen Test auf das Ansprechen auf Aspirin/ASS durch Arachidonsäure. Gemäß dieser Erfindung erfolgt die Aktivierung durch Proteine/Peptide, welche an GRP78/BIP binden. Anhaftung der aktivierten Thrombozyten an die Elektrode erhöht den elektrischen Widerstand. Der Impedanzanstieg wird in „Aggregation Units" (AU) angegeben, kontinuierlich aufgezeichnet und gegen die Zeit aufgetragen. Dadurch entsteht eine Aggregationskurve.
Vorgehensweise:
Testzelle in die Messposition des „Multiplate,, einsetzen. Sensorkabel anbringen. Je 300 μΙ physiologische Kochsalzlösung und Hirudin- antikoaguliertes Vollblut in die Testzelle einbringen. 3 Minuten für Kalibrierung und Temperaturstabilisierung warten. Thombozytenaktivator (gemäß Erfindung Substanz aus der Gruppe der Proteine/Peptide, welche an GRP78/BIP binden. Beispiele: 20 pg/ml EAP, 10 pg/ml modifiziertes Albumin, 100 pg/ml SCN -behandeltes IgG, 100 pg/ml Harnstoff-behandeltes IgG ) einbringen. Über sechs Minuten den Aggregationskurvenverlauf aufzeichnen. c) ASS hemmt die Agglutination von Fibrinogen ummantelten Kügelchen mit Thrombozyten, welche durch GRP78/BIP bindende Proteine/Peptide aktiviert worden sind.
(Prinzip: Accumetrics Der „VerifyNow™ Aspirin Assay" ist ein turbidimetrisches optisches System, welches die Agglutination von mit Fibrinogen-beschichteten Beads durch stimulierte Plättchen in citratantikoaguliertem Vollblut misst. In den verwendeten Kartuschen fungiert Arachidonsäure als Agonist und die Resultate werden in„Aspirin Reaction Units" (ARU) angegeben.
Gemessen wird die Änderungsrate und der Umfang der Turbidität, die durch Thrombozytenaggregation in Vollblutproben auftritt In einer bevorzugten Ausführung dieser Erfindung wird die Arachidonsäure durch ein Protein/Peptid ausgetauscht, welches an GRP78/BIP bindet.
Da die Accumetrics Testsysteme den nachträglichen Austausch des Agonisten nicht möglich machen, wurde das Prinzip der Methode in einem Turbidimeter nachgestellt. d) ASS hemmt die Freisetzung von Granulainhaltstoffen aus durch GRP78/BIP bindende Proteine/Peptide aktivierten Thrombozyten, (hier als Unterbeispiele: ATP-Lumineszenz-Assay, PF4-ELISA, TSP-1 ELISA) e) ASS hemmt die Aktivierung von durch GRP78/BIP bindende Proteine/Peptide aktivierte Thrombozyten und erhöht damit die Zahl der anschließend adhärierten/aggregierten Thrombozyten im Impact Cone and Plate(let) Analyser.
Es wurden zwei unterschiedliche Methoden gewählt:
1 ) 10 pg/ml HOCI-modifiziertes Albumin, oder 10 Mg/ml EAP, oder 100 pg/ml Urea-behandeltes IgG wurden an den Boden der Cone-and-Plate-Wells für 1 h bei RT gecoatet und anschließend gewaschen. 200 μΙ Hirudin- antikoaguliertes Vollblut in An- und Abwesenheit von 10 mM ASS wurden für 2 Minuten bei einer Scherrate von 1700s-1 geschert. Nach der Scherung wurde das Well dreimal mit PBS-Puffer gewaschen und die Thrombozyten mit May-Grünwald-Färbung gefärbt. Ausgewertet wurde die prozentuale Oberflächenbedckung.
2) 200 pg/ml Hirudin-antikoaguliertes Vollblut wurde mit 10 Mg/ml HOCI- modifiziertem Albumin +/- 20 mM ASS, oder 10 pg/ml EAP +/- 20 mM ASS, oder 100 pg/ml Urea-behandeltes IgG +/- 20 mM ASS für 3 Minuten vorinkubiert und anschließend in die Cone-and-Plate-Wells pipettiert. Das Blut wurde für 2 Minuten bei 1700 s 1 geschert. Nach der Scherung wurde das Well dreimal mit PBS-Puffer gewaschen und die Thrombozyten mit May- Grünwald-Färbung gefärbt. Ausgewertet wurde die prozentuale Oberflächenbedckung. f) ASS hemmt die Thrombusbildung bei Durchfluss von Blut durch eine beschichtete Kapillare unter Scherstressbedingungen (Adhäsion und Aggregation an einer Aparatur einer Kollagenmembran PFA-100 Prinzip) - ASS hemmt die durch Thrombozytenaggregation (Agonisten GRP78/BIP bindende Proteine/Peptide) ausgelöste Abnahme von singulären Thrombozyten
- ASS hemmt die durch GRP78/BIP bindende Proteine/Peptide ausgelösten aktivierungsbedingten Veränderungen an Thrombozyten, welche mit Hilfe der Durchflusszytometrie messbar sind
(Unterbeispiele, Fibrinogenbindung, CD63 Präsentation auf der Plasmamembran, CD62P Präsentation auf der Plasmamembran, Assoziation von Thrombozyten mit a) Monozyten, b) Granulozyten (PMNL), c) Endothelzellen, d) Tumorzellen)
4. Beispiel
ASS-Therapie hemmt die ex vivo Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide a) Proband 1 Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide vor Einnahme von ASS, nach 325 mg Einstiegsdosis, nach 3 Tagen mit einer Dosis von 100 mg/Tag b) Proband 2 Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide vor Einnahme von ASS, nach 325 mg Einstiegsdosis, nach 3 Tagen mit einer Dosis von 100 mg/Tag c) Proband 3 Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide vor Einnahme von ASS, nach 325 mg Einstiegsdosis, nach 3 Tagen mit einer Dosis von 100 mg/Tag
Marker der Thrombozytenaktivierung (Fibrinogenbindung, CD62P Präsentation auf der Plasmamembran, Impedanzaggregometrie, Transmissionsaggregometrie) 5. Beispiel
Thienopyridin-Therapie hemmt die ex vivo Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide, welche chemische Gruppen tragen, die mit freien Thiolgruppen wechselwirken.
Proband 1 Aktivierung von Thrombozyten durch GRP78/BIP bindende Proteine/Peptide, welche mit freien Thiolen wechselwirken (hier als Unterbeispiel HOCI-modifiziertes Albumin) vor Einnahme von Clopidogrel, nach 300 mg Ladedosis, nach Behandlung über 10 Tage mit einer Dosis von 75 mg/Tag
6. Beispiel
Ein anderes Medikament, welches die Thrombozytenaktivierung durch GRP78/BIP bindende Proteine/Peptide hemmt, sind Pegylierte Liposomen (Patentantrag Nr. 10 2010 043 733.6)
Auch die Hemmung der GRP78/BIP bindende Proteine/Peptide induzierten Thrombozytenaktivierung durch Pegylierte Liposomen ist durch Nutzung von GRP78/BIP bindenden Proteinen/Peptiden in Methoden und Kits zur Untersuchung der Thrombozytenfunktion messbar. a) Proband 1
Vor Applikation von pegylierten Liposomen, 30 min nach Applikation von pegylierten Liposomen, 60 min nach Applikation von Pegylierten Liposomen
Marker der Thrombozytenaktivierung (Fibrinogenbindung, CD62P Präsentation auf der Plasmamembran, Impedanzaggregometrie, Transmissionsaggregometrie) Referenzen:
1. Touze E, Varenne O, Priollet P, Alperovitch A, Mas JL. Prevalence of asymptomatic atherothrombotic lesions and risk of vascular events in patients with a stroke. Arch Mal Coeur Vaiss. 2005 Oct;98 Spec No 4:15-30. Review.
2. Robert-Koch-Institut. Ausgewählte gesundheitspolitisch relevante nicht übertragbare Krankheiten und deren Risiken. 01.04.2010
3. World Health Organization 2004. Atlas of Heart Disease and Stroke.
4. Available from www. thegeorgeinstitute.org/library/b30064_3.pdf.
Accessed September 14, 2009. )
5. Jurk J, Kehrel BE. Platelets: physiology and biochemistry. Semin Thromb Hemost. 2005;31(4):381-92. Review.
6. Langer HF, Bigalke B, Seizer P, Stellos K, Fateh-Moghadam S, Gawaz M. Interaction of platelets and inflammatory endothelium in the development and progression of coronary artery disease. Semin Thromb Hemost. 2010 Mar;36(2):131-8. Epub 2010 Apr 22. Review.
7. Libby P, Simon DI. Inflammation and thrombosis: the clot thickens.
Circulation. 2001 Apr 3;103(13):1718-20
8. Wagner DD, Burger PC. Platelets in inflammation and thrombosis.
Arterioscler Thromb Vase Biol. 2003 Dec;23(12):2131-7
9. Huo Y, Schober A, Forlow SB, Smith DF, Hyman MC, Jung S, Littman DR, Weber C, Ley K. Circulating activated platelets exaeerbate atherosclerosis in mice deficient in apolipoprotein E. Nat Med. 2003 Jan;9(1 ):61-7
10. Roth GJ, Stanford N, Majerus PW. Acetylation of Prostaglandin synthase by aspirin. Proc Natl Acad Sei U S A. 1975 Aug;72(8):3073- 6
11. Catella-Lawson F, Reilly MP, Kapoor SC, Cucchiara AJ, DeMarco S, Tournier B, Vyas SN, FitzGerald GA. Cyclooxygenase Inhibitors and the antiplatelet effects of aspirin. N Engl J Med. 2001 Dec 20;345(25):1809-17. Sweeny JM, Gorog DA, Fuster V. Antiplatelet drug 'resistance'. Part 1 : mechanisms and clinical measurements. Nat Rev Cardiol. 2009 Apr;6(4):273-82. Review.
Adriana Mendez, Roberto Herklotz, Andreas R. Huber. Aspirinresistenz - ein komplexes.aber ernstzunehmendes Phänomen. Schweiz Med Forum 2006;6:898-904.
S. E. Ghannudi, P. Ohlmann, N. Meyer, M.-L. Wiesel, B. Radulescu, M. Chauvin, P. Bareiss, C. Gachet, and O. Morel Impact of P2Y 12 Inhibition by Clopidogrel on Cardiovascular Mortality in Unselected Patients Treated by Percutaneous Coronary Angioplasty: A Prospective Registry J. Am. Coli. Cardiol. Intv., June 1 , 2010; 3(6): 648 - 656.
Erlinge D, Varenhorst C,Braun OÖ, James S, Winters KJ, Jakubowski JA, Brandt JT, Sugidachi A, Siegbahn A, Wallentin L. Patients With Poor Responsiveness to Thienopyridine Treatment or With Diabetes Have Lower Levels of Circulating Active Metabolite, but Their Platelets Respond Normally to Active Metabolite Added Ex Vivo. J Am Coli Cardiol, 2008; 52:1968-1977.
Angiolillo DJ, Badimon JJ, Saucedo JF, Freiinger AL, Michelson AD, Jakubowski JA, Zhu B, Ojeh CK, Baker BA, Effron MB. A pharmacodynamic comparison of prasugrel vs. high-dose Clopidogrel in patients with type 2 diabetes mellitus and coronary artery disease: results of the Optimizing anti-Platelet Therapy In diabetes Mellitus (OPTIMUS)-3 Trial. Eur Heart J. 2011 Jan 20
Grotemeyer KH. The platelet-reactivity-test-a useful "by-product" of the blood-sampling procedure? Thromb Res. 1991 Feb 15;61 (4):423- 31.
Grotemeyer KH, Scharafinski HW, Husstedt IW. Two-year follow-up of aspirin responder and aspirin non responder. A pilot-study including 180 post-stroke patients. Thromb Res. 1993 Sep 1 ;71 (5):397-403. Geisler(z.B. Geisler T, Eur Heart J 2009),
Gum PA, Kottke-Marchant K, Welsh PA, White J, Topol EJ. A prospective, blinded determination of the natural history of aspirin resistance among stable patients with cardiovascular disease. J Am Coli Cardiol. 2003 Mar 19;41 (6):961-5. Erratum in: J Am Coli Cardiol. 2006 Nov 7;48(9):1918.
Sanderson S, Emery J, Baglin T, Kinmonth AL. Narrative review: aspirin resistance and its clinical implications. Ann Intern Med. 2005 Mar 1 ;142(5):370-80.
Eikelboom JW, Hirsh J, Weitz Jl, Johnston M, Yi Q, Yusuf S. Aspirin- resistant thromboxane biosynthesis and the risk of myocardial infarction, stroke, or cardiovascular death in patients at high risk for cardiovascular events. Circulation. 2002 Apr 9;105(14):1650-5.
Gum PA, Kottke-Marchant K, Welsh PA, White J, Topol EJ. A prospective, blinded determination of the natural history of aspirin resistance among stable patients with cardiovascular disease. J Am Coli Cardiol. 2003 Mar 19;41 (6):961-5. Erratum in: J Am Coli Cardiol. 2006 Nov 7;48(9):1918.
Hezard N, Metz D, Nazeyrollas P, Droulle C, Potron G, Nguyen P. PFA-100 and flow cytometry: can they challenge aggregometry to assess antiplatelet agents, other than GPIIbllla blockers, in coronary angioplasty? Thromb Res. 2002 Oct 1 ;108(1 ):43-7.
Weber AA, Przytulski B, Schanz A, Hohlfeld T, Schrör K. Towards a definition of aspirin resistance: a typological approach. Platelets. 2002 Feb;13(1 ):37-40.
Tina Svenstrup Poulsena, Soren Risom Kristenseb, Dan Atar, Hans Mickley. Kardiovaskuläre Medizin 2005;8:346-360, Das Phänomen der Aspirin-Resistenz: eine kritische Beurteilung der vorliegenden Evidenz.
Cattaneo M. Aspirin and Clopidogrel: efficacy, safety, and the issue of drug resistance. Arterioscler Thromb Vase Biol. 2004 Nov;24(11 ): 1980-7. Epub 2004 Sep 23. Review.
Foster CJ, Prosser DM, Agans JM, Zhai Y, Smith MD, Lachowicz JE, Zhang FL, Gustafson E, Monsma FJ Jr, Wiekowski MT, Abbondanzo SJ, Cook DN, Bayne ML, Lira SA, Chintala MS. Molecular Identification and characterization of the platelet ADP reeeptor targeted by thienopyridine antithrombotic drugs. Clin Invest. 2001 Jun;107(12):1591-8.
Brodde MF, Kehrel BE, Thrombozytenfunktionsuntersuchungen Seite 845 bis 849 in Pötsch, Madiener (Herausgeber) Haemostaseologie Springer Verlag, Berlin Heidelberg 2010
Herczenik E, Bouma B, Korporaal SJ, Strangi R, Zeng Q, Gros P, Van Eck M, Van Berkel TJ, Gebbink MF, Akkerman JW. Activation of human platelets by misfolded proteins. Arterioscler Thromb Vase Biol. 2007 Jul;27(7):1657-65. Epub 2007 May 17.
Meike Horn, Anne Bertling, Martin F. Brodde, Anja Schulte, Joachim Roth, Christina Stürzel, Christine Heilmann, Georg Peters, Kerstin Jurk, and Beate E. Kehrel. Neutrophil alpha-defensins activate platelets via the cell surface chaperones PDI and BiP (Grp78) - Inhibition by staphylokinase, tissue Plasminogen activator and serpins, zur Publikation eingereicht
Anne Bertling, Silke Niemann, Muzaffar Hussain, Martin F. Brodde, Silke Pohl, Tina Schifferdecker, Joachim Roth, Kerstin Jurk, Anja Schulte, Christina Stürzel, Georg Peters, Christine Heilmann and Beate E. Kehrel. Staphylococcal extracellular adherence protein (Eap) activates platelets via interaction with cell surface chaperones PDI and BiP, zur Publikation eingereicht.
Klebanoff SJ. Myeloperoxidase. Proc Assoc Am Physicians. 1999 Sep-Oct;111 (5):383-9.
Klebanoff SJ. Myeloperoxidase: friend and foe. J Leukoc Biol. 2005 May; 77(5):598-625
Baldus S, Heeschen C, Meinertz T, Zeiher AM, Eiserich JP, Münzel T, Simoons ML, Hamm CW; CAPTURE Investigators. Myeloperoxidase serum levels predict risk in patients with acute coronary Syndromes. Circulation. 2003 Sep 23;108(12):1440-5
Brennan ML, Penn MS, Van Lente F, Nambi V, Shishehbor MH, Aviles RJ, Goormastic M, Pepoy ML, McErlean ES, Topol EJ, Nissen SE, Hazen SL. Prognostic value of myeloperoxidase in patients with ehest pain. N Engl J Med. 2003 Oct 23;349(17):1595-604 Brevetti G, Schiano V, Laurenzano E, Giugliano G, Petretta M, Scopacasa F, Chiariello M. Myeloperoxidase, but not C-reactive protein, predicts cardiovascular risk in peripheral arterial disease. Eur Heart J. 2008 Jan;29(2):224-30
Vita JA, Brennan ML, Gokce N, Mann SA, Goormastic M, Shishehbor MH, Penn MS, Keaney JF Jr, Hazen SL. Serum myeloperoxidase levels independently predict endothelial dysfunction in humans. Circulation. 2004 Aug 31 ;110(9):1 134-9
Libby P. The molecular mechanisms of the thrombotic complications of atherosclerosisJournal of Internal Medicine. J Intern Med. 2008 May;263(5):517-27
Hazell LJ, Arnold L, Flowers D, Waeg G, Malle E, Stocker R. Presence of hypochlorite-modified proteins in human atherosclerotic lesions. J Clin Invest. 1996 Mar 15;97(6): 1535-44
Re G, Lanzarini C, Vaona I, Pazzaglia M, Palareti G, Bassein L, Guarnieri C. Systemically circulating oxidative species in human deep venous thrombosis. Eur J Emerg Med. 1998 Mar;5(1 ):9-12
EP1328289: Kehrel B and Brodde M. Inhibition of the interaction between oxidized proteins and CD36 or the mechanism thereof Jurk K, Kehrel BE. The role of platelets in haemostasis, thrombosis, immune defense and inflammation. Dtsch Med Wochenschr. 2008 May;133(21 ):1 130-5
Volf I, Bielek E, Moeslinger T, Koller F, Koller E. Modification of protein moiety of human low density lipoprotein by hypochlorite generates strong platelet agonist. Arterioscler Thromb Vase Biol. 2000 Aug;20(8):20 1 -8
Coleman LG Jr, Polanowska-Grabowska RK, Marcinkiewicz M, Gear AR. LDL oxidized by hypochlorous acid causes irreversible platelet aggregation when combined with low levels of ADP, thrombin, epinephrine, or macrophage-derived chemokine (CCL22). Blood. 2004 Jul 15;104(2):380-9

Claims

Ansprüche
1. Verwendung von Proteinen/Peptiden, welche an GRP78/BIP binden, zur Untersuchung des Einflusses von Medikamenten auf die Thrombo- zytenfunktion.
2. Verwendung nach Anspruch 1 in Methoden und Kits zur Untersuchung des Einfluß von Medikamenten auf die Thrombozytenfunktion
3. Verwendung von Proteinen/Peptiden, welche an GRP78/BIP binden, nach Anspruch 1 oder 2,
dadurch gekennzeichnet, dass sie in Methoden und Kits zur Untersuchung des Einflusses von ASS/Aspirin auf die Thrombozytenfunktion genutzt werden.
4. Verwendung von Proteinen/Peptiden, welche an GRP78/BIP binden, nach Anspruch 1 oder 2,
dadurch gekennzeichnet, dass sie in Methoden und Kits zur Untersuchung des Einflusses von Pegylierten Liposomen auf die Thrombozytenfunktion genutzt werden.
5. Verwendung nach Anspruch 2 als Thrombozytenagonist in der Aggregometrie.
6. Verwendung nach Anspruch 5,
dadurch gekennzeichnet, dass es sich um Transmissionsaggregometrieverfahren,
Impedanzaggregometrieverfahren oder Verfahren mittels Zählung der nicht aggregierten Thrombozyten handelt.
7. Verwendung nach Anspruch 2 als Thrombozytenagonist für das Monitoring von Medikamentem in einer Vorrichtung, welche nach dem Prinzip des „Cone and plate(let) analysers" funktioniert.
8. Verwendung nach Anspruch 2 als Thrombozytenagonist für das Monitoring von Medikamenten in einem Gerät mit dem Analyseprinzip des PFA-100.
9. Verwendung nach Anspruch 2 als Thrombozytenagonist für das Monitoring von Medikamenten mittels Durchflusszytometräe.
10. Verwendung nach Anspruch 2 als Thrombozytenagonist für das Monitoring von Medikamenten durch die Quantifizierung von aus aktivierten Thrombozyten freigesetzten Inhaltsstoffen.
PCT/EP2012/052328 2011-02-10 2012-02-10 Verwendung von proteinen/peptiden, welche an grp78 (bip) binden, in labormethoden zum monitoring von thrombozyten-aggregationshemmern WO2012107566A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102011003936.8 2011-02-10
DE102011003936A DE102011003936A1 (de) 2011-02-10 2011-02-10 Verwendung von Proteinen/Peptiden, welche an GRP78 (BIP) binden, in Labormethoden zum Monitoring von Thrombozyten-Aggregationshemmern

Publications (1)

Publication Number Publication Date
WO2012107566A1 true WO2012107566A1 (de) 2012-08-16

Family

ID=45688468

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/052328 WO2012107566A1 (de) 2011-02-10 2012-02-10 Verwendung von proteinen/peptiden, welche an grp78 (bip) binden, in labormethoden zum monitoring von thrombozyten-aggregationshemmern

Country Status (2)

Country Link
DE (1) DE102011003936A1 (de)
WO (1) WO2012107566A1 (de)

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002022150A2 (de) 2000-09-12 2002-03-21 Beate Kehrel Arzneimittel enthaltend aktiviertes antithrombin iii
WO2002032445A2 (de) 2000-10-20 2002-04-25 Beate Kehrel Hemmung der interaktion zwischen oxidierte proteine und cd36 oder dessen wirkmechanismus
WO2004096368A1 (de) 2003-04-25 2004-11-11 Hamburger Stiftung Zur Förderung Von Wissenschaft Und Kultur Bekämpfung von hi-virus infektionen mit oxidierten blutproteinen
US20050255534A1 (en) 2004-05-14 2005-11-17 Ericson Daniel G Method and device for monitoring asprin response
WO2007008071A2 (en) * 2005-07-13 2007-01-18 Crossbeta Biosciences B.V. Method for detecting peptides comprising a cross-beta structure
US20100227417A1 (en) 2005-12-09 2010-09-09 Corgenix Medical Corporation Methods and Kits for Detection of Thromboxane A2 Metabolites

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002022150A2 (de) 2000-09-12 2002-03-21 Beate Kehrel Arzneimittel enthaltend aktiviertes antithrombin iii
WO2002032445A2 (de) 2000-10-20 2002-04-25 Beate Kehrel Hemmung der interaktion zwischen oxidierte proteine und cd36 oder dessen wirkmechanismus
EP1328289A2 (de) 2000-10-20 2003-07-23 Beate Kehrel Hemmung der interaktion zwischen oxidierte proteine und cd36 oder dessen wirkmechanismus
WO2004096368A1 (de) 2003-04-25 2004-11-11 Hamburger Stiftung Zur Förderung Von Wissenschaft Und Kultur Bekämpfung von hi-virus infektionen mit oxidierten blutproteinen
US20050255534A1 (en) 2004-05-14 2005-11-17 Ericson Daniel G Method and device for monitoring asprin response
WO2007008071A2 (en) * 2005-07-13 2007-01-18 Crossbeta Biosciences B.V. Method for detecting peptides comprising a cross-beta structure
US20080220446A1 (en) 2005-07-13 2008-09-11 Martijn Frans Ben Gerard Gebbink Method for Detecting and/or Removing Protein and/or Peptide Comprising a Cross-Beta Structure From an Aqueous Solution Comprising a Protein
US20100227417A1 (en) 2005-12-09 2010-09-09 Corgenix Medical Corporation Methods and Kits for Detection of Thromboxane A2 Metabolites

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
"Atlas of Heart Disease and Stroke", 2004, WORLD HEALTH ORGANIZATION
"Krankheiten und deren Risiken", ROBERT-KOCH-INSTITUT
ADRIANA MENDEZ; ROBERTO HERKLOTZ; ANDREAS R. HUBER: "Aspirinresistenz - ein komplexes,aber ernstzunehmendes Phänomen", SCHWEIZ MED FORUM, vol. 6, 2006, pages 898 - 904, XP002484515
ANGIOLILLO DJ; BADIMON JJ; SAUCEDO JF; FRELINGER AL; MICHELSON AD; JAKUBOWSKI JA; ZHU B; OJEH CK; BAKER BA; EFFRON MB: "A pharmacodynamic comparison of prasugrel vs. high-dose clopidogrel in patients with type 2 diabetes mellitus and coronary artery disease: results of the Optimizing anti-Platelet Therapy In diabetes MellitUS (OPTIMUS)-3 Trial.", EUR HEART J., 20 January 2011 (2011-01-20)
ANNE BERTLING; SILKE NIEMANN; MUZAFFAR HUSSAIN; MARTIN F. BRODDE; SILKE POHL; TINA SCHIFFERDECKER; JOACHIM ROTH; KERSTIN JURK; ANJ: "Staphylococcal extracellular adherence protein (Eap) activates platelets via interaction with cell surface chaperones PDI and BiP", ZUR PUBLIKATION EINGEREICHT
BALDUS S; HEESCHEN C; MEINERTZ T; ZEIHER AM; EISERICH JP; MÜNZEL T; SIMOONS ML; HAMM CW: "CAPTURE Investigators. Myeloperoxidase serum levels predict risk in patients with acute coronary syndromes", CIRCULATION, vol. 108, no. 12, 23 September 2003 (2003-09-23), pages 1440 - 5
BRENNAN ML; PENN MS; VAN LENTE F; NAMBI V; SHISHEHBOR MH; AVILES RJ; GOORMASTIC M; PEPOY ML; MCERLEAN ES; TOPOL EJ: "Prognostic value of myeloperoxidase in patients with chest pain", N ENGL J MED., vol. 349, no. 17, 23 October 2003 (2003-10-23), pages 1595 - 604, XP055009475, DOI: doi:10.1056/NEJMoa035003
BREVETTI G; SCHIANO V; LAURENZANO E; GIUGLIANO G; PETRETTA M; SCOPACASA F; CHIARIELLO M: "Myeloperoxidase, but not C-reactive protein, predicts cardiovascular risk in peripheral arterial disease", EUR HEART J., vol. 29, no. 2, January 2008 (2008-01-01), pages 224 - 30
BRODDE MF; KEHREL BE: "Haemostaseologie", 2010, SPRINGER VERLAG, article "Thrombozytenfunktionsuntersuchungen", pages: 845 - 849
CATELLA-LAWSON F; REILLY MP; KAPOOR SC; CUCCHIARA AJ; DEMARCO S; TOURNIER B; VYAS SN; FITZGERALD GA: "Cyclooxygenase inhibitors and the antiplatelet effects of aspirin", N ENGL J MED., vol. 345, no. 25, 20 December 2001 (2001-12-20), pages 1809 - 17, XP001118002, DOI: doi:10.1056/NEJMoa003199
CATTANEO M.: "Aspirin and clopidogrel: efficacy, safety, and the issue of drug resistance", ARTERIOSCLER THROMB VASC BIOL., vol. 24, no. 11, November 2004 (2004-11-01), pages 1980 - 7, XP055140312, DOI: doi:10.1161/01.ATV.0000145980.39477.a9
COLEMAN LG JR; POLANOWSKA-GRABOWSKA RK; MARCINKIEWICZ M; GEAR AR: "LDL oxidized by hypochlorous acid causes irreversible platelet aggregation when combined with low levels of ADP, thrombin, epinephrine, or macrophage-derived chemokine (CCL22", BLOOD, vol. 104, no. 2, 15 July 2004 (2004-07-15), pages 380 - 9
DENG WU-GUO ET AL: "Aspirin and salicylate bind to immunoglobulin heavy chain binding protein (BiP) and inhibit its ATPase activity in human fibroblasts", FASEB JOURNAL, vol. 15, no. 13, November 2001 (2001-11-01), pages 2463 - 2470, XP002671670, ISSN: 0892-6638 *
EIKELBOOM JW; HIRSH J; WEITZ JI; JOHNSTON M; YI Q; YUSUF S: "Aspirinresistant thromboxane biosynthesis and the risk of myocardial infarction, stroke, or cardiovascular death in patients at high risk for cardiovascular events", CIRCULATION, vol. 105, no. 14, 9 April 2002 (2002-04-09), pages 1650 - 5
ERLINGE D; VARENHORST C; BRAUN OÖ; JAMES S; WINTERS KJ; JAKUBOWSKI JA; BRANDT JT; SUGIDACHI A; SIEGBAHN A; WALLENTIN L: "Patients With Poor Responsiveness to Thienopyridine Treatment or With Diabetes Have Lower Levels of Circulating Active Metabolite, but Their Platelets Respond Normally to Active Metabolite Added Ex Vivo", J AM COLL CARDIOL, vol. 52, 2008, pages 1968 - 1977, XP025742065, DOI: doi:10.1016/j.jacc.2008.07.068
ERRATUM, J AM COLL CARDIOL., vol. 48, no. 9, 7 November 2006 (2006-11-07), pages 1918
FARID NA; KURIHARA A; WRIGHTON SA: "Metabolism and disposition of the thienopyridine antiplatelet drugs ticlopidine, clopidogrel, and prasugrel in humans", J CLIN PHARMACOL., vol. 50, no. 2, February 2010 (2010-02-01), pages 126 - 42, XP055183321, DOI: doi:10.1177/0091270009343005
FOSTER CJ; PROSSER DM; AGANS JM; ZHAI Y; SMITH MD; LACHOWICZ JE; ZHANG FL; GUSTAFSON E; MONSMA FJ JR; WIEKOWSKI MT: "Molecular identification and characterization of the platelet ADP receptor targeted by thienopyridine antithrombotic drugs", CLIN INVEST., vol. 107, no. 12, June 2001 (2001-06-01), pages 1591 - 8
GEISLER T, EUR HEART J, 2009
GROTEMEYER KH: "The platelet-reactivity-test--a useful ''by-product'' of the blood-sampling procedure?", THROMB RES., vol. 61, no. 4, 15 February 1991 (1991-02-15), pages 423 - 31, XP022882942, DOI: doi:10.1016/0049-3848(91)90656-H
GROTEMEYER KH; SCHARAFINSKI HW; HUSSTEDT IW: "Two-year follow-up of aspirin responder and aspirin non responder. A pilot-study including 180 post-stroke patients", THROMB RES., vol. 71, no. 5, 1 September 1993 (1993-09-01), pages 397 - 403, XP022879214, DOI: doi:10.1016/0049-3848(93)90164-J
GUM PA; KOTTKE-MARCHANT K; WELSH PA; WHITE J; TOPOL EJ: "A prospective, blinded determination of the natural historv of aspirin resistance among stable patients with cardiovascular disease", J AM COLL CARDIOL., vol. 41, no. 6, 19 March 2003 (2003-03-19), pages 961 - 5
GUM PA; KOTTKE-MARCHANT K; WELSH PA; WHITE J; TOPOL EJ: "A prospective, blinded determination of the natural history of aspirin resistance among stable patients with cardiovascular disease", J AM COLL CARDIOL., vol. 41, no. 6, 19 March 2003 (2003-03-19), pages 961 - 5, XP002497032, DOI: doi:10.1016/S0735-1097(02)03014-0
HAZELL LJ; ARNOLD L; FLOWERS D; WAEG G; MALLE E; STOCKER R: "Presence of hypochlorite-modified proteins in human atherosclerotic lesions", J CLIN INVEST., vol. 97, no. 6, 15 March 1996 (1996-03-15), pages 1535 - 44
HERCZENIK E; BOUMA B; KORPORAAL SJ; STRANG! R; ZENG Q; GROS P; VAN ECK M; VAN BERKEL TJ; GEBBINK MF; AKKERMAN JW: "Activation of human platelets by misfolded proteins", ARTERIOSCLER THROMB VASC BIOL., vol. 27, no. 7, July 2007 (2007-07-01), pages 1657 - 65
HEUM PARK J ET AL: "Differential regulation of anti-inflammatory proteins in human rheumatoid synoviocyte MH7A cell by celecoxib and ibuprofen", LIFE SCIENCES, vol. 78, no. 19, 4 April 2006 (2006-04-04), PERGAMON PRESS, OXFORD, GB, pages 2204 - 2212, XP028050661, ISSN: 0024-3205, [retrieved on 20060404], DOI: 10.1016/J.LFS.2005.09.029 *
HEZARD N; METZ D; NAZEYROLLAS P; DROULLE C; POTRON G; NGUYEN P: "PFA-100 and flow cytometry: can they challenge aggregometry to assess antiplatelet agents, other than GPllbllla blockers, in coronary angioplasty?", THROMB RES, vol. 108, no. 1, 1 October 2002 (2002-10-01), pages 43 - 7, XP027275687
HUO Y; SCHOBER A; FORLOW SB; SMITH DF; HYMAN MC; JUNG S; LITTMAN DR; WEBER C; LEY K: "Circulating activated platelets exacerbate atherosclerosis in mice deficient in apolipoprotein E", NAT MED., vol. 9, no. 1, January 2003 (2003-01-01), pages 61 - 7
JURK J; KEHREL BE: "Platelets: physiology and biochemistry", SEMIN THROMB HEMOST., vol. 31, no. 4, 2005, pages 381 - 92, XP008085356, DOI: doi:10.1055/s-2005-916671
JURK K; KEHREL BE: "The role of platelets in haemostasis, thrombosis, immune defense and inflammation", DTSCH MED WOCHENSCHR., vol. 133, no. 21, May 2008 (2008-05-01), pages 1130 - 5
KLEBANOFF SJ: "Myeloperoxidase", PROC ASSOC AM PHYSICIANS, vol. 111, no. 5, September 1999 (1999-09-01), pages 383 - 9
KLEBANOFF SJ: "Myeloperoxidase: friend and foe", J LEUKOC BIOL., vol. 77, no. 5, May 2005 (2005-05-01), pages 598 - 625
LANGER HF; BIGALKE B; SEIZER P; STELLOS K; FATEH-MOGHADAM S; GAWAZ M: "Interaction of platelets and inflammatory endothelium in the development and progression of coronary artery disease", SEMIN THROMB HEMOST., vol. 36, no. 2, March 2010 (2010-03-01), pages 131 - 8, XP008148152, DOI: doi:10.1055/s-0030-1251496
LIBBY P: "The molecular mechanisms of the thrombotic complications of atherosclerosisJournal of Internal Medicine", J INTERN MED., vol. 263, no. 5, May 2008 (2008-05-01), pages 517 - 27
LIBBY P; SIMON D: "Inflammation and thrombosis: the clot thickens", CIRCULATION, vol. 103, no. 13, 3 April 2001 (2001-04-03), pages 1718 - 20
MANSOUR KHALED ET AL: "Aspirin resistance.", ADVANCES IN HEMATOLOGY, vol. 2009, 937352, February 2009 (2009-02-01), pages 1 - 10, XP002671672, ISSN: 1687-9112 *
MEIKE HORN; ANNE BERTLING; MARTIN F. BRODDE; ANJA SCHULTE; JOACHIM ROTH; CHRISTINA STÜRZEL; CHRISTINE HEILMANN; GEORG PETERS; KER: "Neutrophil alpha-defensins activate platelets via the cell surface chaperones PDI and BiP (Grp78) - inhibition by staphylokinase, tissue plasminogen activator and serpins", ZUR PUBLIKATION EINGEREICHT
MOLINS BLANCA ET AL: "Glucose-regulated protein 78 and platelet deposition: effect of rosuvastatin.", ARTERIOSCLEROSIS, THROMBOSIS, AND VASCULAR BIOLOGY, vol. 30, no. 6, June 2010 (2010-06-01), pages 1246 - 1252+SUPPL, XP002671669, ISSN: 1524-4636 *
OSENDE JULIO I ET AL: "Testing platelet activation with a shear-dependent platelet function test versus aggregation-based tests: Relevance for monitoring long-term glycoprotein IIb/IIIa inhibition", CIRCULATION, vol. 103, no. 11, 20 March 2001 (2001-03-20), pages 1488 - 1491, XP002671671, ISSN: 0009-7322 *
RE G; LANZARINI C; VAONA , PAZZAGLIA M; PALARETI G; BASSEIN L; GUARNIERI C: "Systemically circulating oxidative species in human deep venous thrombosis", EUR J EMERG MED., vol. 5, no. 1, March 1998 (1998-03-01), pages 9 - 12
ROTH GJ; STANFORD N; MAJERUS PW: "Acetylation of prostaglandin synthase by aspirin", PROC NATL ACAD SEI USA, vol. 72, no. 8, August 1975 (1975-08-01), pages 3073 - 6
S. E. GHANNUDI; P. OHLMANN; N. MEYER; M.-L. WIESEL; B. RADULESCU; M. CHAUVIN; P. BAREISS; C. GACHET; O. MOREL: "Impact of P2Y 12 Inhibition by Clopidogrel on Cardiovascular Mortality in Unselected Patients Treated by Percutaneous Coronary Angioplasty: A Prospective Registry", J. AM. COLL. CARDIOL. INTV., vol. 3, no. 6, 1 June 2010 (2010-06-01), pages 648 - 656
SANDERSON S; EMERY J; BAGLIN T; KINMONTH AL: "Narrative review: aspirin resistance and its clinical implications", ANN INTERN MED., vol. 142, no. 5, 1 March 2005 (2005-03-01), pages 370 - 80
SWEENY JM; GOROG DA; FUSTER V: "Antiplatelet drug 'resistance'. Part 1: mechanisms and clinical measurements", NAT REV CARDIOL., vol. 6, no. 4, April 2009 (2009-04-01), pages 273 - 82
TINA SVENSTRUP POULSENA; SOREN RISOM KRISTENSEB; DAN ATAR; HANS MICKLEY: "Das Phänomen der Aspirin-Resistenz: eine kritische Beurteilung der vorliegenden Evidenz", KARDIOVASKULÄRE MEDIZIN, vol. 8, 2005, pages 346 - 360
TOUZE E; VARENNE 0; PRIOLLET P; ALPEROVITCH A; MAS JL: "Prevalence of asymptomatic atherothrombotic lesions and risk of vascular events in patients with a stroke", ARCH MAL COEUR VAISS., vol. 98, no. 4, October 2005 (2005-10-01), pages 15 - 30
TSUTSUMI S ET AL: "Endoplasmic reticulum stress response is involved in nonsteroidal anti-inflammatory drug-induced apoptosis", CELL DEATH AND DIFFERENTIATION, vol. 11, no. 9, 1 September 2004 (2004-09-01), NATURE PUBLISHING GROUP, GB, pages 1009 - 1016, XP008119827, ISSN: 1350-9047, [retrieved on 20040507], DOI: 10.1038/SJ.CDD.4401436 *
VITA JA; BRENNAN ML; GOKCE N; MANN SA; GOORMASTIC M; SHISHEHBOR MH; PENN MS; KEANEY JF JR; HAZEN SL: "Serum myeloperoxidase levels independently predict endothelial dysfunction in humans", CIRCULATION, vol. 110, no. 9, 31 August 2004 (2004-08-31), pages 1134 - 9, XP055009474, DOI: doi:10.1161/01.CIR.0000140262.20831.8F
VOLF , BIELEK E; MOESLINGER T; KOLLER F; KOLLER E: "Modification of protein moiety of human low density lipoprotein by hypochlorite generates strong platelet agonist", ARTERIOSCLER THROMB VASC BIOL., vol. 20, no. 8, August 2000 (2000-08-01), pages 2011 - 8
WAGNER DD; BURGER PC: "Platelets in inflammation and thrombosis", ARTERIOSCLER THROMB VASC BIOL., vol. 23, no. 12, December 2003 (2003-12-01), pages 2131 - 7
WEBER AA; PRZYTULSKI B; SCHANZ A; HOHLFELD T; SCHRÖR K: "Towards a definition of aspirin resistance: a typological approach", PLATELETS, vol. 13, no. 1, February 2002 (2002-02-01), pages 37 - 40

Also Published As

Publication number Publication date
DE102011003936A1 (de) 2012-08-16

Similar Documents

Publication Publication Date Title
Marx et al. Eosinophil-platelet interactions promote atherosclerosis and stabilize thrombosis with eosinophil extracellular traps
Stachon et al. P2X7 deficiency blocks lesional inflammasome activity and ameliorates atherosclerosis in mice
Lip et al. von Willebrand factor: a marker of endothelial dysfunction in vascular disorders?
Briggs et al. Platelet dysfunction and platelet transfusion in traumatic brain injury
Budkowska et al. The circadian rhythm of selected parameters of the hemostasis system in healthy people
Chen et al. P2X7R/cryopyrin inflammasome axis inhibition reduces neuroinflammation after SAH
Monroe et al. Platelets and thrombin generation
Shen et al. Inosine reduces ischemic brain injury in rats
Lippi et al. C-reactive protein and venous thromboembolism: causal or casual association?
Oury et al. P2X1-mediated activation of extracellular signal-regulated kinase 2 contributes to platelet secretion and aggregation induced by collagen
Zidovetzki et al. Nicotine increases plasminogen activator inhibitor-1 production by human brain endothelial cells via protein kinase C–associated pathway
Breddin et al. Spontaneous platelet aggregation as a predictive risk factor for vascular occlusions in healthy volunteers? Results of the HAPARG Study
Mital et al. Prevalence of acquired von Willebrand syndrome during essential thrombocythemia: a retrospective analysis of 170 consecutive patients
Gardner et al. Neonatal levels of acute phase proteins and later risk of non-affective psychosis
Ferreiro et al. Effects of cangrelor in coronary artery disease patients with and without diabetes mellitus: an in vitro pharmacodynamic investigation
Tóth et al. Elevated factor VIII and von Willebrand factor levels predict unfavorable outcome in stroke patients treated with intravenous thrombolysis
Blanchet et al. Inflammatory role and prognostic value of platelet chemokines in acute coronary syndrome
Franchi et al. Pharmacodynamic Effects of Vorapaxar in Prior Myocardial Infarction Patients Treated With Potent Oral P2Y12 Receptor Inhibitors With and Without Aspirin: Results of the VORA‐PRATIC Study
Harenberg et al. Novel methods for assessing oral direct factor Xa and thrombin inhibitors: use of point-of-care testing and urine samples
Giannini et al. Interaction with damaged vessel wall in vivo in humans induces platelets to express CD40L resulting in endothelial activation with no effect of aspirin intake
D'Angelo et al. Protein C in acute stroke.
Misztal et al. The myeloperoxidase product, hypochlorous acid, reduces thrombus formation under flow and attenuates clot retraction and fibrinolysis in human blood
de Moerloose et al. Treatment of congenital fibrinogen disorders
El Ghannudi et al. Impaired inhibition of P2Y12 by clopidogrel is a major determinant of cardiac death in diabetes mellitus patients treated by percutaneous coronary intervention
Kuliczkowski et al. Effect of glycemic control on response to antiplatelet therapy in patients with diabetes mellitus and ST-segment elevation myocardial infarction

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12704757

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 12704757

Country of ref document: EP

Kind code of ref document: A1