WO2011161466A1 - Plant eukaryotic translation initiation factor 4e - Google Patents
Plant eukaryotic translation initiation factor 4e Download PDFInfo
- Publication number
- WO2011161466A1 WO2011161466A1 PCT/GB2011/051192 GB2011051192W WO2011161466A1 WO 2011161466 A1 WO2011161466 A1 WO 2011161466A1 GB 2011051192 W GB2011051192 W GB 2011051192W WO 2011161466 A1 WO2011161466 A1 WO 2011161466A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- iso
- eif
- eif4e
- plant
- variant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6827—Hybridisation assays for detection of mutation or polymorphism
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H1/00—Processes for modifying genotypes ; Plants characterised by associated natural traits
- A01H1/04—Processes of selection involving genotypic or phenotypic markers; Methods of using phenotypic markers for selection
- A01H1/045—Processes of selection involving genotypic or phenotypic markers; Methods of using phenotypic markers for selection using molecular markers
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H1/00—Processes for modifying genotypes ; Plants characterised by associated natural traits
- A01H1/06—Processes for producing mutations, e.g. treatment with chemicals or with radiation
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H3/00—Processes for modifying phenotypes, e.g. symbiosis with bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/01—Preparation of mutants without inserting foreign genetic material therein; Screening processes therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8283—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for virus resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6806—Preparing nucleic acids for analysis, e.g. for polymerase chain reaction [PCR] assay
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
- C12Q1/6816—Hybridisation assays characterised by the detection means
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6844—Nucleic acid amplification reactions
- C12Q1/686—Polymerase chain reaction [PCR]
Definitions
- the invention relates to plants, and in particular to virus-resistant plants, and to methods of generating such plants.
- the invention extends to eukaryotic translation initiation factor variants and isoforms thereof, and to nucleic acids involved in the splicing of such variant factors, and uses thereof in methods for producing plants that are resistant to viral infections.
- Viruses present a significant problem in agriculture.
- plant viruses in the family Potyviridae represent approximately 30% of plant viruses and are capable of infecting more than 30 different families of plants, leading to extensive crop damage and even death.
- the Solanaceae, Cucurbitaceae and Fabaceae plant families are especially sensitive to infection by potyviruses.
- plant viruses Upon infection of a plant host, plant viruses use some of the host's endogenous proteins to complete their own life cycle.
- potyviruses such as Turnip mosaic virus (TuMV)
- TuMV Turnip mosaic virus
- plant eukaryotic translation initiation factors to bind plant ribosomes to the viral genomic RNA as a pre-requisite to translating their genomes into various viral proteins, including the viral RNA-dependent RNA polymerase that is essential to produce more copies of the virus. Therefore, defects in the plant eukaryotic translation initiation factors may confer viral resistance in plants.
- the eukaryotic translation initiation factors are vital to the survival of plants, defects in the eukaryotic translation initiation factors are detrimental to plants, often resulting in plants that are non- viable.
- potyvirus VPg protein encoded by potyvirus RNA genome
- eIF4E protein encoded by potyvirus RNA genome
- mutations in members of the eIF4E gene family can confer resistance to potyviruses.
- Recessive resistance to infections by potyviruses is believed to arise from base changes in the coding region (i.e. the exons) of the genes encoding eIF4E and/or eIF(iso)4E, thereby resulting in eIF4E and/ or eIF(iso)4E protein variants.
- TuMV Turnip mosaic virus
- eIF(iso)4E eukaryotic translation initiation factor isoform
- Insertional mutagenesis of At.eIF(iso)4E using a defective maize transposon (dSpm) produced a plant line that was able to grow normally, and was resistant to TuMV infection.
- dSpm defective maize transposon
- lsp1 chemically-induced point mutation of the ⁇ . thaliana eIF(iso)4E gene using ethylmethane sulphonate (EMS) named lsp1 also conferred resistance to TuMV infection.
- EMS ethylmethane sulphonate
- Dominant plant R genes predominantly provide strain-specific resistance to plant viruses, for example TuRBOI provides resistance to pathotype 1 isolates of TuMV, but is overcome by TuMV isolates belonging to other pathotypes including, 3, 4 and 12.
- TuRBOI provides strain-specific resistance to plant viruses
- TuMV isolates belonging to other pathotypes including, 3, 4 and 12.
- Most examples of recessive resistance associated with mutations in eIF4E and eIF(iso)4E are also strain-specific and mutations in viral VPg and occasionally other viral proteins result in strains able to overcome such resistance.
- viruses are constantly mutating and genotypes able to overcome strain- specific and broad spectrum resistance are generated in susceptible plants and selected for by the cultivation of resistant plants.
- Most plant viruses have RNA genomes and RNA is known to have a particularly high mutation rate due to infidelity in the proof-reading mechanism. Consequently, new sources of broad spectrum resistance are required, particularly based on new
- plant resistance to viruses such as potyviruses
- plant eIF4E or eIF(iso)4E protein variants that are produced from mis-splicing processes compared to that of the wild-type or native protein.
- eIF4E eukaryotic translation initiation factor 4E
- eIF(iso)4E an isoform thereof
- eIF4E is also known as eukaryotic translation initiation factor 4E, which is a key component in the initiation of protein synthesis.
- eIF4E forms a complex eIF4F (consisting of eIF4E and eIF4G).
- the precise biochemical role of a plant eIF4E protein in virus infection has yet to be identified.
- the plant eIF4E may be capable of binding to the 5' cap structure (or a mimic) of the viral RNA, or the plant eIF4E may interact with the viral RNA directly.
- eIF4E may be involved in the cell-to-cell movement of the infecting virus in the host plant.
- eIF(iso)4E refers to an isoform of eIF4E, and eIF(iso)4E has a similar function as eIF4E.
- eIF4E and eIF(iso)4E proteins from Arabidopsis thaliana are 44% - 49% identical at the amino acid level. This is similar to values found for Brassica rapa line R-o-18 (47 - 50% identity) and Brassica rapa line Chiifu (43 - 50 % identity).
- the virus life cycle is totally dependent on using the host plant's translation machinery to turn viral nucleic acid into proteins. Without the viral proteins produced by the host translation machinery, no viral replicase protein is produced and so no more copies of the virus are made either.
- a number of viruses have been shown to be dependent on the host plant's translation complex and virus interactions with the plant eIF4E and/ or eIF(iso)4E proteins have been demonstrated (the version used depends on the particular combination of virus species and plant species).
- mis-splicing can produce the eIF4E or eIF(iso)4E variant of the first aspect, which can therefore be described as being an alternatively spliced variant, compared to the wild-type or native eIF4E or eIF(iso)4E proteins.
- the genomic sequence of a gene such as that encoding eIF4E or eIF(iso)4E, comprises coding regions (i.e. exons) and non-coding regions (i.e. introns).
- the introns and exons are transcribed into RNA termed "primary transcript, precursor to mRNA" (or "pre-mRNA").
- the introns must be removed from the pre-mRNA so that the native protein encoded by the exons can be produced.
- the term "native protein" can mean the naturally occurring, wild-type or functional protein.
- the removal of the introns from the pre-mRNA and subsequent ligation of the exons to each other is carried out in the splicing process.
- the splicing process usually consists of a series of reactions, mediated by splicing factors, which is carried out on the RNA after transcription, but before translation.
- a "pre-mRNA” is an RNA molecule which contains both exons and intron(s)
- an "mRNA” is an RNA in which the intron(s) have been removed and the exons have been joined together sequentially so that the protein can then be translated therefrom by the ribosomes.
- Introns are defined by a set of "splice elements" which are relatively short, conserved RNA segments which bind the various splicing factors that carry out the splicing reactions. Thus, each intron is defined by a 5' splice site, a 3' splice site, and a branch point situated there between.
- the protein variant of the first aspect may be caused by modifications in the splice element of the native DNA and/ or pre-mRNA of eIF4E or eIF(iso)4E, which create a new, aberrant, splice element (compared to the wild-type). Therefore, in an embodiment of the invention, the mis- spliced gene encoding eIF4E or eIF(iso)4E may arise from a modification in a splice element, thereby producing an aberrant splice element.
- the aberrant splice element may cause altered splice patterns of the eIF4E or eIF(iso)4E pre-mRNA, giving rise to altered mRNA.
- the resulting eIF4E protein variant or eIF(iso)4E protein variant of the first aspect is not functional for the virus in a plant, such that the plant is substantially resistant to viral infection.
- the inventor has demonstrated that alterations in an intron of the gene encoding eIF4E or eIF(iso)4E (rather than in an exon) result in mis-splicing occurring, which results in a eIF4E variant or eIF(iso)4E variant protein being produced, which is non-functional for a virus, and thus confers virus resistance when present in a plant.
- the aberrant splice element may alter the native splice site at the 5'- or 3'-end of the intron (i.e. at the 5' native splice site or at the 3' native splice site of the intron), which creates a new, aberrant, splice site.
- the difference between the genomic DNA sequence and the sequence of mature message RNA defines the introns.
- the 5' and 3' ends of the introns define the native splice sites of a gene.
- the aberrant splice site may be upstream or downstream of the native splice site.
- the term “upstream” means towards the 5' end of the DNA or pre-mRNA molecule and may be denoted by the symbol It would also be appreciated by the skilled technician that the term “downstream” means towards the 3' end of the DNA or pre-mRNA molecule, and may be denoted by the symbol "+”.
- the aberrant splice site may be 10 nucleotides upstream from the 5' native splice site of intron 1, the aberrant splice site may also be referred to as "-10 bp relative to the 5' splice site of intron 1".
- the aberrant splice site is upstream of the 5' native splice site of an intron
- some of the exon that is upstream of the intron may be excised during the splicing process. Therefore, the resulting mRNA may lack nucleotides of the excised exon.
- the aberrant splice site is downstream of the 5' native splice site of an intron
- some of the intron may be retained during the splice event. Therefore, the resulting mRNA may comprise nucleotides of the retained intron.
- the aberrant splice site is downstream of the 3' native splice site of an intron
- some of the exon downstream of the intron may be excised during the splicing process. Therefore, the resulting mRNA may lack nucleotides of the excised exon.
- the aberrant splice site is upstream of the 3' native splice site of an intron
- some, or all of the intron may be retained during the splice event. Therefore, the resulting mRNA may contain the retained intron nucleotides.
- the altered splice pattern may comprise retaining at least one intron.
- the resultant mRNA molecule i.e. mRNA variant
- the amino acid sequence translated from the retained at least one intron, or part thereof may comprise a stop codon.
- the resulting protein i.e. protein variant
- the stop codon that is introduced by the retained intron may be referred to as a premature stop codon because it causes translation of the mRNA to cease prematurely (the first wild-type stop codon of the gene being located further downstream). Therefore, the protein variant may have lack of function or an altered function compared to the wild-type or the native protein.
- the protein variant may be non-functional for a virus.
- the codon reading frame of the retained at least one intron, or part thereof, may be in- frame or out-of-frame with the coding reading frame of the neighbouring exon(s).
- the resulting mRNA may encode an altered amino acid sequence, and hence, produce a protein variant.
- the protein variant may have lack of function or an altered function compared to the wild type or the native protein.
- the protein variant may be nonfunctional for a virus.
- the resulting protein may contain altered amino acid sequences may be truncated due to a premature stop codon.
- the resultant protein variant may have lack of function or an altered function compared to the wild type or the native protein.
- the protein variant may be non- functional for a virus.
- the resulting mRNA may encode an altered amino acid sequence, and hence, produce a protein variant.
- the altered amino acid sequence may contain a premature stop codon.
- the protein variant may have lack of function, or an altered function compared to the wild type or the native protein.
- the protein variant may be non- functional for a virus.
- the altered function of the eIF4E variant or eIF(iso)4E variant may comprise a decrease in its activity for translation initiation.
- this may result in extremely truncated versions of the protein, or versions where most of the protein is completely different to functional versions. Not bound by theory, this may have a number of consequences, as it is highly unlikely to bind to other components of the eukaryotic initiation complex, particularly eIF4G or eIF(iso)4G and also unlikely to bind to the viral protein VPg, or messenger RNA cap. This will result in lack of translation of messenger RNA and/ or viral RNA.
- B. rapa contains three eIF(iso)4E loci, and thus, has three protein isoforms of eIF(iso)4E, the protein isoforms being denoted eIF(iso)4E.a, eIF(iso)4E.b and eIF(iso)4E.c. He therefore investigated eIF(iso)4E.a in two plant lines.
- the first plant line referred to herein as "R-o-18"
- TuMV Turnip Mosaic virus
- RLR22 is resistant to viral infection.
- the inventor has determined the genomic, mRNA and polypeptide sequences for the eIF(iso)4E.a isoform of B. rapa, as discussed below.
- SEQ ID No. 1 The genomic DNA sequence encoding the native or wild type Brassica rapa eIF(iso)4E.a isoform, BraA.eIF(iso)4E.a, in line R-o-18 (sensitive to viral infection), is provided herein as SEQ ID No. 1, as follows:
- SEQ ID No: 1 shows exons 1 to 5, with the introns being represented in bold.
- the mRNA sequence of the native or wild type BraA.eIF(iso)4E.a in line R-o-18 (sensitive to viral infection), is provided herein as SEQ ID No. 2, as follows:
- SEQ ID No: 2 Figure 3 illustrates schematically that the exons of BmA.eIF(iso)4E.a are ligated together to form the mRNA of SEQ ID No: 2.
- polypeptide sequence of the native or wild type BraA.eIF(iso)4E.a in line R-o-18 (sensitive to viral infection), is provided herein as SEQ ID No. 3, as follows:
- SEQ ID No: 3 The genomic DNA sequence encoding the Brassica rapa eIF(iso)4E.a isoform
- BraA.eIF(iso)4E.a variant, in line RLR22 (resistant to viral infection), is provided herein as SEQ ID No. 4, as follows:
- SEQ ID No: 4 shows the int ons being represented in bold, and a guanine insertion at position +1 of the 5' splice site of intron 1 (underlined in the sequence above). This mutation is referred to herein as "insertion/ deletion” mutation or “indel”.
- the inventor has surprisingly observed that the DNA sequence represented as SEQ ID No.4, in some embodiments, can give rise to several different forms of mRNA sequence, each of which may produce the variant of the eIF4E or eIF(iso)4E protein of the first aspect.
- the inventor has named the allele (BraA.eIF(iso)4E.d) from the virus- resistant line (RLR22) "retrOI", which is believed to be recessive.
- a first embodiment of an mRNA sequence of Br A.eIF(iso)4E.a variant in line RLR22 (resistant to viral infection), is provided herein as SEQ ID No. 5, as follows:
- SEQ ID No: 5 As can be seen, the effect of the nucleic acid modification in SEQ ID No.4 (i.e.
- intron 1 which is fully retained, and which is represented in bold.
- Figure 4 illustrates schematically that an altered splice pattern of eIF4E DNA or pre- mRNA resulting in the mRNA of SEQ ID No: 5.
- the polypeptide sequence corresponding to the first embodiment of mRNA (i.e. SEQ ID No. 5) of BraA.eIF(iso)4E.a variant in line RLR22, is provided herein as SEQ ID No. 6, as follows:
- a second embodiment of an mRNA sequence of BmA.eIF(iso)4E.a variant in line RLR22 (resistant to viral infection), is provided herein as SEQ ID No. 7, as follows:
- SEQ ID No: 7 The mRNA variant shown in SEQ ID No: 7 results from an altered 3' splice site of intron 1.
- the altered splice site is at position +48 relative to the 5' end of intron 1 (i.e. 15 bp upstream of the native 3' splice site of intron 1).
- the retained intron sequence (15 nucleotides) is represented in bold. Figure 5 illustrates this splice event
- polypeptide sequence corresponding to the second embodiment of mRNA variant (i.e. SEQ ID No. 7) of BraA.eIF(iso)4E. a variant in line RLR22, is provided herein as SEQ ID No. 8, as follows: MATEDVNEALAAAEVPATETTEKQPADKLERKWS W DNQSKPKQGAAWGASLRKAYT DTVQDFWGIFF CSLHETIFIPSKLTPNAEIHMFKAGVEPKWEDPECANGGKWTFVVTSNRKPALDKAWLETLMALVGEQFD EADEICGVVASVRPKQDKLSLWTRTKSNEAVLMGIGKKWKEILDVTDKITFTNHDDSRRTRFTV.
- a third embodiment of an mRNA sequence of BraA.eIF(iso)4E.a variant in line RLR22 (resistant to viral infection), is provided herein as SEQ ID No. 9, as follows:
- SEQ ID No: 9 The mRNA variant shown in SEQ ID No: 9 results from an altered 5' splice site of intron 1.
- the altered splice site is at position -3 (i.e. 3 bp upstream) relative to the 5' native splice site of intron 1.
- the excised exon sequence (3 nucleotides) is represented by the symbol " ⁇ ".
- Figure 6 illustrates this splice event schematically.
- the polypeptide sequence corresponding to the third embodiment of mRNA (i.e. SEQ ID No. 9) of BraA.eIF(iso)4E.a variant in line RLR22, is provided herein as SEQ ID No.
- phenylalanine (F)-tryptophan(W) -glycine (G) at positions 75-77 have been replaced by cysteine(C). Having lost one amino acid and had another substituted may result in a protein that is non- functional for the virus.
- the eIF4E or eIF(iso)4E protein variant of the first aspect may comprise an amino acid sequence substantially as set out in SEQ ID No: 6, 8 or 10, or a variant or fragment thereof.
- the nucleic acid, which encodes the eIF4E or eIF(iso)4E protein may comprise a sequence substantially as set out in SEQ ID No: 4, 5, 7 or 9, or a variant or fragment thereof.
- the mis- splicing of the nucleic acid encoding the eIF4E or eIF(iso)4E protein variant of the first aspect may be caused by a modification in said nucleic acid sequence. It is preferred that the modification occurs in a non-coding region of the gene.
- the modification may be located in a splice element in the nucleic acid sequence encoding eIF4E or eIF(iso)4E protein to produce an aberrant splice element.
- the modification may be present upstream or downstream of the exon-intron junction or native splice site. Preferably, the modification is present between the position -10 and +10 of the native splice site.
- the modification is present between the position -5 and +5 of the native splice site. Most preferably, the modification is present at position -1 to +1 of the native splice site.
- the native splice site may be at or towards the 5'- or 3'-end of an intron.
- the splice element may comprise a 3' splice site, a 5' splice site and a branch site, all of which are required for accurate removal of the intron during production of mature message RNA. Modifications in one, or more of these components may result in failure to remove some, or all of the intron, or removal of exon sequence. This in turn results in truncated or elongated proteins which are highly unlikely to be functional or would be less functional than the native protein.
- the modification may be located in an intron in the nucleic acid sequence encoding eIF4E or eIF(iso)4E protein.
- the modification may be in intron 1, 2, 3 or 4 of the nucleic acid sequence encoding eIF4E or eIF(iso)4E proteins.
- Intron 1 corresponds to bases 201 to 263 of SEQ ID No. 1
- intron 2 corresponds to bases 439 to 509 of SEQ ID No.
- intron 3 corresponds to bases 636 to 1187 of SEQ ID No. 1
- intron 4 corresponds to bases 1254 to 1339 of SEQ ID No. 1
- the modification is in intron 1 of the nucleic acid sequence encoding eIF4E or eIF(iso)4E protein.
- the modification may comprise an insertion, deletion, substitution or any combination of these, of at least one nucleic acid base anywhere in the nucleic acid sequence encoding eIF4E or eIF(iso)4E protein, preferably in an intron, more preferably in intron 1.
- the insertion may be a purine (adenine or guanine) or a pyrimidine (cytosine or thymine).
- the modification comprises a guanine insertion.
- the modification may result in a frameshift of the codon reading frame relative to that of the native protein.
- the modification may result in the formation of a premature stop codon.
- the modification may result in no frameshift, or no premature stop codon, but with the addition or deletion of amino acids.
- the modification comprises an insertion at position 201 of SEQ ID No. 1, which insertion is preferably a guanine.
- the inventor believes that it may be possible to modify the plant genome to produce mutations that would result in mis-splicing of eIF4E and/ or eIF(iso)4E, or other proteins essential for the completion of virus life-cycles by artificial means known in the art.
- the artificial means may include inducing / promoting recombination, site-directed mutagenesis through a number of means, Targeted Induced Local Lesions in Genomes (TILLING), or other means known in the art.
- the inventor has found that the eIF4E or eIF(iso)4E variant protein of the first aspect is non-functional for Turnip mosaic virus (TuMV).
- TuMV Turnip mosaic virus
- the inventor believes that the eIF4E or eIF(iso)4E protein of the first aspect is non- functional for a wide variety of viruses, which can otherwise infect plants.
- the eIF4E or eIF(iso)4E may be non-functional for any plant viruses that are dependent on them for completion of their life cycle.
- the variant eIF4E or eIF(iso)4E is non- functional for any plant virus, in the family Potyviridae.
- suitable potyviruses for which the eIF4E or eIF(iso)4E may be non- functional include Pepper veinal mottle virus (PVMP), Bean common mosaic virus (BCMV), Potato virus Y (PVY), or A ⁇ ukinin mosaic virus (AzMV), or any other virus that is dependent on eIF4E and / or eIF(iso)4E.
- PVMP Pepper veinal mottle virus
- BCMV Bean common mosaic virus
- PVY Potato virus Y
- AzMV A ⁇ ukinin mosaic virus
- the eIF4E or eIF(iso)4E protein of the first aspect is nonfunctional for a range of viruses in Brassica rapa.
- the inventor believes that the eIF4E or eIF(iso)4E protein of the first aspect is non- functional for viruses in a wide range of different plant species.
- the eIF4E or eIF(iso)4E may be non- functional for a virus in a plant of the family Solanaceae, such as potato (all species), tomato, pepper or egg plant, Cucurbits, such as melons, squash and cucumbers, Cruciferous crops, particularly Brassica napus such as oilseed rape, Brassica rapa such as Chinese cabbage, and even more particularly Brassica oleracea such as broccoli, cauliflower, cabbage, savoy cabbage, Brussels sprouts, red cabbage, and the like etc., Fabaceae peas, beans, pulses etc. and also any monocotyledonous crops, including rice, maize, wheat, barley etc.
- the plant may be Brassica spp, preferably B. rapa and/ or Brassica oleracea.
- an isolated nucleic acid sequence encoding an alternatively spliced variant of a plant eukaryotic translation initiation factor 4E
- eIF4E or an isoform thereof (eIF(iso)4E), wherein the nucleic acid sequence is mis- spliced such that the eIF4E or eIF(iso)4E is non- functional for a virus.
- the isolated nucleic acid sequence of the second aspect may comprise DNA, cDNA, RNA or mRNA.
- the nucleic acid sequence may comprise a nucleotide sequence substantially as set out in any one of SEQ ID No: 4, 5, 7 or 9, or a variant or fragment thereof.
- the eIF4E or eIF(iso)4E encoded by the nucleic acid sequence may comprise an amino acid sequence substantially as set out in any one of SEQ ID No: 6, 8 or 10, or a variant or fragment thereof.
- a recombinant vector comprising the nucleic acid sequence of the second aspect.
- the recombinant vector may be a plasmid, cosmid or phage. Such recombinant vectors are highly useful for transforming host cells with the nucleic acid molecules of the second aspect.
- the skilled technician will appreciate that genetic constructs of the invention may be combined with many types of backbone vector for expression purposes.
- the backbone vector may be a binary vector, for example one which can replicate in both E. coli and Agrobacterium tumefaciens.
- a suitable vector may be a pBIN plasmid, such as pBIN19.
- Recombinant vectors may include a variety of other functional elements in addition to the nucleic acid sequence of the invention, including a promoter.
- the recombinant vector may be designed such that it autonomously replicates in the cytosol of a host cell, which may be a plant cell. In this case, elements which induce or regulate DNA replication may be required in the recombinant vector.
- the recombinant vector may be designed such that it integrates into the genome of a host cell. In this case, DNA sequences which favour targeted integration (e.g. by
- the recombinant vector may also comprise DNA coding for a gene that may be used as a selectable marker in the cloning process, i.e. to enable selection of cells that have been transfected or transformed, and to enable the selection of cells harbouring vectors incorporating heterologous DNA.
- the selectable marker gene may be in a different vector to be used simultaneously with vector containing the gene of interest.
- the vector may also comprise DNA involved with regulating expression of the coding sequence, or for targeting the expressed polypeptide to a certain part of the host cell, e.g. the chloroplast.
- the vector of the third aspect may comprise at least one additional element selected from a group consisting of: a selectable marker gene (e.g. an antibiotic resistance gene); a polypeptide termination signal; and a protein targeting sequence (e.g. a chloroplast transit peptide).
- marker genes include antibiotic resistance genes such as those conferring resistance to Kanamycin, Geneticin (G418) and Hygromycin (npt-II, hyg-B); herbicide resistance genes, such as those conferring resistance to phosphinothricin and sulphonamide based herbicides (bar and s l respectively; EP-A-242246, EP-A- 0249637); and screenable markers such as beta-glucuronidase (GB2197653), luciferase and green fluorescent protein (GFP).
- antibiotic resistance genes such as those conferring resistance to Kanamycin, Geneticin (G418) and Hygromycin (npt-II, hyg-B)
- herbicide resistance genes such as those conferring resistance to phosphinothricin and sulphonamide based herbicides (bar and s l respectively; EP-A-242246, EP-A- 0249637)
- screenable markers such as beta-glucuronidase (GB2197653), luciferase
- the marker gene may be controlled by a second promoter, which allows expression in cells, which may or may not be in the seed, thereby allowing the selection of cells or tissue containing the marker at any stage of development of the plant.
- Suitable second promoters are the promoter of nopaline synthase gene of Agrobacteritim and the promoter derived from the gene which encodes the 35S cauliflower mosaic virus (CaMV) transcript.
- CaMV 35S cauliflower mosaic virus
- any other suitable second promoter may be used.
- Various embodiments of the vector of the invention may be prepared using a suitable cloning procedure, and which may be summarised as follows.
- a host cell comprising the vector of the third aspect.
- the host cell may be a plant cell.
- the host cell may be a bacterium or a virus.
- the vector may be transformed into the host cell using techniques known to the skilled technician.
- the inventor has found that it is possible to detect plants, which are resistant to infection from viruses.
- a method for detecting, in a test plant, the presence of a plant eukaryotic translation initiation factor 4E (eIF4E) variant, or an isoform thereof (eIF(iso)4E), which is non- functional for a virus, wherein nucleic acid encoding the eIF4E or eIF(iso)4E is mis-spliced comprising the steps of:
- step (ii) producing cDNA from the RNA isolated in step (i) using primers specific for eIF4E or eIF(iso)4E;
- step (iv) comparing the cDNA sequence determined in step (iii) with the cDNA
- step (iii) compared to the wild-type sequence indicates that the nucleic acid encoding the eIF4E or eIF(iso)4E in the test plant is mis-spliced and is a variant of eIF4E or eIF(iso)4E.
- the detection steps of (i) to (iv) involve molecular techniques that are known in the art, such as in Sambrook et al.
- the method may comprise a step of obtaining a sample from the test plant, from the RNA may be isolated, preferably mRNA.
- the cDNA may be obtained by reverse transcription polymerase chain reaction (RT-PCR) of eIF4E and/or eIF(iso)4E RNA utilising primers complementary to these genes.
- RT-PCR reverse transcription polymerase chain reaction
- the skilled technician would employ techniques known in the art to design the location of the RT-PCR primers.
- the RT-PCR primers are designed such that the resulting amplified product
- the reverse transcription primer may be selected from a group consisting of:
- AGAAAGCTGGGT TCAGACAGTGAACCTAGTTCTTC SEQ ID No. 14
- AGAAAGCTGGGT TCAGACAGTGAACCGAGTTCTTC SEQ ID No. 15
- the method of the fifth aspect may further comprise a step of identifying the modification in the plant genome that causes mis-splicing of eIF4E or eIF(iso)4E, wherein said identification step may comprise breeding the test plant such that it is homozygous for eIF4E or eIF(iso)4E gene.
- the method may comprise determining the genomic sequence of said gene.
- the method may comprise comparing the determined genomic sequence with the genomic sequence of wild type eIF4E or eIF(iso)4YL to identify the modification that causes mis-splicing of eIF4E or eIF(iso)4E.
- test plant is heterozygous for eIF4E or eIF(iso)4E
- homozygosity may obtained by self-crossing the test plant.
- the inventor has found that it is possible to generate and select plants, which resistant to infection from viruses.
- a method for selecting a virus-resistant plant comprising detecting, in a test plant, the presence of:- (i) a plant eukaryotic initiation factor 4E (eIF4E) variant or an isoform thereof
- eIF4E variant or an isoform thereof (eIF(iso)4E) of the first aspect or the nucleic acid of the second aspect, for inducing viral-resistance in a plant.
- a method for producing a virus-resistant plant comprising crossing a parent plant that expresses a plant eukaryotic initiation factor 4E (eIF4E) variant or an isoform thereof (eIF(iso)4E) of the first aspect with a recipient plant, the recipient comprising at least one trait, selected from a group consisting of an agronomic advantage, a commercial advantage, and/ or suitability for a particular climate or soil.
- eIF4E plant eukaryotic initiation factor 4E
- eIF(iso)4E eukaryotic initiation factor 4E
- the recipient plant is a commercially useful plant, such as a crop (e.g. rice, wheat etc) or a vegetable (e.g. a tomato etc).
- a crop e.g. rice, wheat etc
- a vegetable e.g. a tomato etc.
- the recipient plant (which may be B. rapa) may be crossed with a parent plant which is resistant to viral infections, because it expresses the eIF4E or eIF4(iso)4E variant of the first aspect.
- the method may further comprise back-crossing the progeny of the first cross with the recipient parent (i.e. recurrent plant line). Between 1 and 10 rounds of back-crossing may be required.
- the method according to the fifth aspect may be used to ensure that the variant allele of eIF4E or eIF(iso)4E (which confers virus resistance) is present in the non-recurrent plants in each cross.
- the method may comprise a step of self-pollinating or selfing virus resistant plants derived from the back-crossing programme. Plants in the subsequent generation that are homozygous for the modified splice site (which confers virus resistance) may then be identified.
- two inbred parent plant lines derived from back-crossing programmes and homozygous for the eIF4E or eIF(iso)4E of the first aspect may be used to generate a Fi hybrid. These two inbred parental lines may then be crossed together to generate virus-resistant Fi hybrids homozygous for the eIF4E or eIF(iso)4E of the first aspect.
- the parent plant used in the method may express at least one copy of wild-type eIF4E or eIF(iso)4E, wherein the wild-type copy of eIF4E or eIF(iso)4E may be used by the plant, but not by a virus.
- the invention provides a virus-resistant plant produced by or obtainable by the method of the eighth aspect.
- the invention provides a virus-resistant plant comprising the plant eukaryotic translation initiation factor 4E (eIF4E) variant or an isoform thereof (eIF(iso)4E) of the first aspect, or the nucleic acid encoding an alternatively spliced variant of eIF4E or eIF(iso)4E of the second aspect.
- eIF4E plant eukaryotic translation initiation factor 4E
- the plant of the ninth and tenth aspects expresses at least one copy of wild- type eIF4E or eIF(iso)4E, wherein the wild-type copy of eIF4E or eIF(iso)4E can be used by the plant but not by a virus.
- the plant may comprise a modification or mutation in a non-coding region of the gene encoding eIF4E or eIF(iso)4E.
- the modification may be within a splice- element of eIF4E or eIF(iso)4E nucleic acid.
- the use, method or plant may comprise use of eIF(iso)4E.a, eIF(iso)4E.b or eIF(iso)4E.c, preferably eIF(iso)4E.
- the plant may be of the family Solanaceae, such as potato, all species, tomato, pepper or egg plant, Cucurbits, such as melons, squash and cucumbers, Cruciferous crops, particularly Brassica napus such as oilseed rape, Brassica rapa such as Chinese cabbage, and even more particularly Brassica oleracea such as broccoli, cauliflower, cabbage, savoy cabbage, Brussels sprouts, red cabbage, and the like etc., Fabaceae peas, beans, pulses etc. and also any monocotyledonous crops, including rice, maize, wheat, barley etc.
- the plant may be Brassica spp, preferably B. rapa and/ or Brassica oleracea.
- any one of the fifth, sixth or eighth aspects, the use of the seventh aspect, or the plant of the ninth aspect may comprise the use of a transgenic plant.
- any of the plants described herein may be transgenic, i.e. produced using recombinant DNA technology.
- the scenario described above explains virus resistance in plants that possess a single copy of eIF4E and/ or eIF(iso)4E, which a virus can use to complete its life-cycle and cause an infection.
- the plant is homozygous for eIF4E and/ or eIF(iso)4E, which encodes the alternatively spliced variant of a plant eukaryotic translation initiation factor 4E (eIF4E), or an isoform thereof (eIF(iso)4E), which is non- functional for a virus.
- eIF4E plant eukaryotic translation initiation factor 4E
- eIF(iso)4E an isoform thereof
- Brassica rapa has three copies of both eIF4E and eIF(iso)4E (i.e. BraA.eIF4E.a, b and c; and BraA.elF (iso)4E. a, b and c), and a virus may be able to use any of these genes to complete its life cycle, and cause a viral infection in the host plant.
- the alleles of eIF4E and/ or eIF(iso)4E at each of these other loci are also non-functional for the virus.
- BraA.eIF4E.c but heterozygous at the BraA.eIF(iso)4E.c locus. BiSi plants derived from this particular individual were then phenotyped and genotyped. Surprisingly, plants homozygous for the RLR22 allele of BraA.elF (iso)4E.c were completely resistant to Turnip mosaic virus (TuMV), heterozygotes were only slightly susceptible to virus infection, whereas plants that were homozygous for the R-o-18 allele of
- BraA.eIF(iso)4E.c were completely susceptible to viral infections. Accordingly, the inventors have identified a second locus involved in the broad- spectrum resistance to the virus in B. rapa as BraA.eIF(iso)4E.c on chromosome A8. This second locus is referred to herein as ConTROI . The inventors believe that, for broad- spectrum virus resistance, a plant requires the second gene (i.e. ConTROI , the RLR22 allele of BraA.eIT(iso)4E.c) in addition to the first gene (i.e. retrOI , the RLR22 allele of BraA.eIT(iso)4E.a).
- ConTROI the second gene
- retrOI the RLR22 allele of BraA.eIT(iso)4E.a
- the R-o-18 allele of BraA.eIT4E.a which TuMV cannot use in B. rapa, has the following mRNA sequence:
- the R-o-18 allele of BraA.eIF4E.a which TuMV cannot use in B. rapa, codes for the following polypeptide sequence:
- the RLR22 allele of BmA.eIF4E.a located on chromosome Al which TuMV cannot use in B. rapa has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the RLR22 allele of BraA.eIF4E.a which TuMV cannot use in B. rapa has the following mRNA sequence:
- the RLR22 allele of BmA.eIF4E.a which TuMV cannot use in B. rapa codes for the following polypeptide sequence:
- R-o-18 BraA.eIF4E.b located on chromosome A3 is non-functional.
- the R-o-18 allele of BraA.eIF4E.b which is non- functional has the following genomic DNA sequence (exons 1 to 3, with the introns shown in bold and premature stop codons being underlined) :
- the R-o-18 allele of BmA.eIF4E.b which is non- functional has the following mRNA sequence:
- the R-o-18 allele of BraA.eIF4E.c located on chromosome A8 which TuMV cannot use in B. rapa has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the R-o-18 allele of BraA.eIF4E.cwhich TuMV cannot use in B. rapa has the following mRNA sequence:
- the RLR22 allele of BraA.eIF4E.c located on chromosome A8 which TuMV cannot use in B. rapa has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the RLR22 allele of BraA.eIF4E.cwhich TuMV cannot use in B. rapa has the following mRNA sequence:
- the RLR22 allele of BraA.eIF4E.cwhich TuMV cannot use in B. rapa codes for the following polypeptide sequence:
- the R-o-18 allele of BraA.eIF(iso)4E.b located on chromosome A5 which TuMV cannot use in B. rapa has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the R-o-18 allele of BraA.eIF(iso)4E.b which TuMV cannot use in B. rapa has the following mRNA sequence:
- the RLR22 allele of BraA.eIF(iso)4E.b located on chromosome A5 which TuMV cannot use in B. rapa has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the RLR22 allele of BraA.eIF(iso)4E.b which TuMV cannot use in B. rapa has the following mRNA sequence:
- the RLR22 allele of BraA.eIF(iso)4E.b which TuMV cannot use in B. rapa codes for the following polypeptide sequence (same as R-o-18 BraA.eIF(iso)4E.b):
- the R-o-18 allele of BraA.eIF(iso)4E.c located on chromosome A8 which TuMV can use in B. rapa and confers susceptibility on plants has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the R-o-18 allele of BraA.eIF(iso)4E.c which TuMV can use in B. rapa and confers susceptibility on plants has the following mRNA sequence:
- the R-o-18 allele of BraA.eIF(iso)4E.c which TuMV can use in B. rapa and confers susceptibility on plants codes for the following polypeptide sequence:
- the RLR22 allele of BraA.eIF(iso)4E.c located on chromosome A8 which TuMV cannot use in B. rapa and is necessary for resistance has the following genomic DNA sequence (exons 1 to 5, with the introns shown in bold):
- the RLR22 allele of BraA.eIF(iso)4E.c which TuMV cannot use in B. rapa and is necessary for resistance has the following mRNA sequence:
- an isolated nucleic acid sequence encoding a plant eukaryotic translation initiation factor 4E (eIF4E), or an isoform thereof (eIF(iso)4E), wherein the eIF4E or eIF(iso)4E is non- functional for a virus, and wherein the nucleic acid sequence comprises a nucleotide sequence substantially as set out in SEQ ID No: 4, 5, 7, 9, 34, 35, 37, 38, 40, 41, 43, 44, 46, 47, 49, 50, 52, 53, 58 or
- the vector of the third aspect, the host cell of the fourth aspect, the method of any one of the fifth, sixth or eighth aspects, the use of the seventh aspect or the plant of the ninth aspect may comprise any of the sequences described herein which are non- functional for a virus, i.e. as defined in the tenth aspect.
- the vectors, cells, methods, uses or plants of the invention may comprise a nucleotide sequence substantially as set out in SEQ ID No: 4, 5, 7, 9, 34, 35, 37, 38, 40, 41 , 43, 44, 46, 47, 49, 50, 52, 53, 58 or 59, or a variant or fragment thereof.
- the vectors, cells, methods, uses or plants of the invention may comprise an eIF4E or eIF(iso)4E protein variant, as defined in the eleventh aspect.
- the vectors, cells, methods, uses or plants comprise an eIF4E or eIF(iso)4E protein variant which comprises an amino acid sequence substantially as set out in SEQ ID No: 6, 8, 10, 36, 39, 42, 45, 48, 51, 54 or 60, or a variant or fragment thereof.
- the vectors, cells, methods, uses or plants of the invention comprise the use of a nucleotide sequence substantially as set out in SEQ ID No: 58 or 59, or a variant or fragment thereof, or the use of an eIF4E or eIF(iso)4E protein variant which comprises an amino acid sequence substantially as set out in SEQ ID No: 60, or a variant or fragment thereof.
- nucleic acid or peptide or variant, derivative or analogue thereof which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including (functional) variants or (functional) fragments thereof.
- substantially the amino acid/ polynucleotide/ polypeptide sequence can be a sequence that has at least 40% sequence identity with the amino acid/ polynucleotide/ polypeptide sequences of any one of the sequences referred to herein.
- amino acid/ polynucleotide/ polypeptide sequences with a sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to are also envisaged.
- sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to are also envisaged.
- amino acids referred to amino acids
- acid/ polynucleotide/ polypeptide sequence has at least 85% identity with any of the sequences referred to, more preferably at least 90% identity, even more preferably at least 92% identity, even more preferably at least 95% identity, even more preferably at least 97% identity, even more preferably at least 98% identity and, most preferably at least 99% identity with any of the sequences referred to herein.
- the skilled technician will appreciate how to calculate the percentage identity between two amino acid/ polynucleotide/ polypeptide sequences. In order to calculate the percentage identity between two amino acid/ polynucleotide/ polypeptide sequences, an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value.
- the percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FAST A, Smith- Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants.
- the method used to align the sequences for example, ClustalW, BLAST, FAST A, Smith- Waterman (implemented in different programs), or structural alignment from 3D comparison
- the parameters used by the alignment method for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants.
- percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (iv) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance.
- a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to the sequences shown in SEQ ID No's: 1, 2, 4, 5, 7 or 9, or their complements under stringent conditions.
- stringent conditions we mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride / sodium citrate (SSC) at approximately 45°C followed by at least one wash in 0.2x SSC/0.1% SDS at approximately 20-65°C.
- a substantially similar polypeptide may differ by at least 1, but less than 5, 10, 20, 50 or 100 amino acids from the sequences shown in SEQ ID No: 3, 6, 8 or 10.
- a skilled technician will be familiar with highly sensitive techniques for identifying single nucleotide variations or mutations in a nucleic acid sequence.
- nucleic acid sequence described herein could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a (functional) variant thereof.
- Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent change.
- Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change.
- small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine.
- Large non-polar, hydrophobic amino acids include phenylalanine, tryptophan and tyrosine.
- the polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine.
- the positively charged (basic) amino acids include lysine, arginine and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will known the nucleotide sequences encoding these amino acids.
- Figure 1 shows an electrophoretic gel on which RT-PCT products of the Brassica rapa eIF(iso)4E mRNA and Arabidopsis thaliana eIF(iso)4E and eIF(iso)4E mRNA have been separated.
- R-o-18 corresponds to a B. rapa line which is susceptible to infection by TuMV, whereas B. rapa line RLR22 is resistant to infection by TuMV.
- the mRNA from virus-resistant line RLR22 (SEQ ID No.5) is larger than that of the susceptible line R- o-18 (SEQ ID No. 2).
- Col-0 eIF4E and Col-0 eIF(iso)4E are controls and correspond to wild-type Arabidopsis thaliana eIF4E and eIF(iso)4E, respectively;
- Figure 2 is a schematic representation of the gene encoding Brassica rapa eIF(iso)4E.a. The exons are shown as black boxes, and are numbered, and the introns are shown as white boxes and are not numbered;
- Figure 3 is a schematic representation of the mRNA of Brassica rapa eIF(iso)4E.a in line R-o-18, which can be infected by TuMV.
- the arrow above exon 1 corresponds to the start codon, and the arrow above exon 5 corresponds to the stop codon;
- Figure 4 is a schematic representation of one embodiment (the most common variant) of the mRNA of Brassica rapa eIF(iso)4E.a in line RLR22 (SEQ ID No. 5), which is resistant to viral infection.
- the start and stop codons are represented by arrows.
- the mis-splicing results in the retention of the whole of intron 1 in the mature message RNA and the introduction of a premature stop codon indicated by the red arrow on the left;
- Figure 5 is a schematic representation of another embodiment of the mRNA of Brassica rapa eIF(iso)4E.a in line RLR22 (SED ID No. 7), which is resistant to viral infection.
- the start and stop codons are represented by arrows.
- the mis-splicing results in partial removal of the intron, with only the first 48 nucleotides removed;
- Figure 6 is a schematic representation of another embodiment of the mRNA of Brassica rapa eIF(iso)4E.a in line RLR22 (SEQ ID No. 9), which is resistant to viral infection.
- the start and stop codons are represented by arrows.
- the mis-splicing results in the excision of the last three nucleotides of exon 1 along with the whole of intron 1 ;
- Figure 7 shows a photo of a plant having a modification in intron 1 of Brassica rapa eIF(iso)4E.a in line RLR22, which is resistant to TuMV infection (left) and a Brassica rapa plant lacking this modification which is extremely susceptible to TuMV (right);
- Figure 8 is a schematic representation of a breeding program to generate a plant line that is homozygous for the eIF4E or eIF(iso)4E variant of the invention.
- Figure 9 shows an electrophoretic gel showing the PCR products obtained from DNA of plants R-o-18 and RLR22 using primers BR2 and BR14.
- Example 1 Analysis of eIF(iso)4E sequence conferring virus-resistance and isolation of a first locus conferring virus-resistance. retrOI
- the B. rapa line R-o-18 is an inbred line susceptible to infection by TuMV.
- Line RLR22 has broad-spectrum resistance to all TuMV isolates tested so far.
- Total genomic DNA was extracted from young leaves of lines R-o-18 and RLR22 using a DNeasy plant mini kit (Qiagen) followed by amplification using the GenomiPhi system (GE Healthcare).
- the majority of the genomic coding region of the BraA.eIF(iso)4E.a gene was amplified with standard PCR using Taq DNA polymerase (Invitrogen) and the following primers:- PCR1 (ATGGCGACAGAGGATGTGAACG) - (SEQ ID No. 11) and
- PCR2 (TCTCCTTCCACTTCTTCCCAATAC) - (SEQ ID No. 12).
- the RT-FOR and RT-REV primers encompass the complete coding region of the BraA.eIF(iso)4E.a gene (start and stop codons are shown in bold; an adapter for cloning is in italics).
- RT-FOR AAAAAGCAGGCT CGATGGCGACAGAGGATG (SEQ ID
- RT-REV (R-o-18): ⁇ G,4 ⁇ GCTGGGT TCAGACAGTGAACCTAGTTCTTC (SEQ ID No. 14)
- RT-REV RLR22: AGAAAGCTGGGT TCAGACAGTGAACCGAGTTCTTC (SEQ ID No. 15)
- RNA (about 10 ⁇ g RNA, with and without DNasel treatment) was converted to cDNA with standard reverse transcription reactions using Superscript II (Invitrogen) and the appropriate RT-REV primer.
- cDNA was amplified with standard PCR using Taq DNA polymerase (Invitrogen) or KOD polymerase (Novagen) and the appropriate RT-FOR and RT-REV primer combination.
- RT-PCR products were separated using agarose gel electrophoresis, and extracted from the gel using a Qiaquick gel extraction kit (Qiagen). Products were cloned into plasmid pDONR221 using BP clonase
- Plasmids were amplified using the TempliPhi reaction (GE Healthcare) and then sequenced.
- FIG. 8 illustrates that a plant homozygous for the RLR22 allele of eIF(iso)4E.a is resistant to TuMV infection (left) whereas plants homozygous, or heterozygous for the B. rapa R-o-18 allele of eIF(iso)4E.a, are susceptible to TuMV infection (right).
- Figure 1 shows an electrophoretic gel of RT-PCR products of the Brassica rapa eIF(iso)4E.a mRNA, and as controls, Arabidopsis thaliana eIF4E and eIF(iso)4E mRNA.
- the mRNA of BraA.eIF(iso)4E.a from vims-resistant line, RLR22 is larger than the mRNA of BraA.eIF(iso)4E.a obtained from the infected line, R-o- 18.
- the genomic sequence of Br A.eIF(iso)4E. a in line R-o- 18 is provided as SEQ ID No.l
- the genomic sequence of RLR22 is provided as SEQ ID No.4.
- the inventor has found that the two alleles (in R-o- 18 and RLR22) differ by a base insertion/deletion (i.e. an "indel") at the exon/intron junction.
- a base insertion/deletion i.e. an "indel"
- a single mRNA sequence of the eIF(iso)4E.a allele was found and the mRNA sequence is provided as SEQ ID No.2.
- the mRNA was capable of producing a full-length protein, as represented by the schematic shown in Figure 3, and the protein sequence is provided as SEQ ID No.3.
- mRNA of eIF(iso)4E.a mainly consisted of a product (denoted as SEQ ID No.5) with the first intron still present in the expressed DNA, forming a longer eIF(iso)4E.a protein, and this explains why the fragment is larger in the RLR22 shown in Figure 1.
- SEQ ID No. 7 had most of the first intron removed except for the 3' terminal 15 bases which were retained, as represented in Figure 5.
- B.rapa plants that are resistant to TuMV may be obtained from the following breeding programme and the breeding programme is illustrated in Figure 8.
- the recipient B.rapa plants with desired agronomic traits are crossed with a virus-resistant RLR22 plant and the progeny (Fi) are backcrossed with the recipient parent (recurrent) plant line.
- Molecular techniques e.g. PCR and sequencing or other specific PCR-based methods to distinguish BraA.eIF(iso)4E.a alleles
- PCR and sequencing or other specific PCR-based methods to distinguish BraA.eIF(iso)4E.a alleles are used to ensure that the allele of BraA.eIF(iso)4E.a derived from RLR22 (which confers virus resistance) is present in the non-recurrent plants in each cross.
- Plants that are resistant to a particular potyvirus may be obtained from the following breeding programme.
- the recipient plant is crossed with plants defective for splicing of eIF4E and/ or eIF(iso)4E and the progeny is backcrossed with the recipient parent (recurrent) plant line.
- Molecular techniques PCR and sequencing or other specific PCR-based tests) are used to ensure that the allele (s) of eIF4E and/ or eIF(iso)4E that is/ are defective in splicing and conferring resistance is/are present in the non- recurrent plants for each cross.
- Plants derived from the backcrossing programme possessing the eIF4E and/or eIF(iso)4E allele that is/ are defective in splicing and conferring resistance are selfed.
- Plants in the subsequent generation that are homozygous for the allele of eIF4E and/ or eIF(iso)4E that is / are defective in splicing are identified using the molecular techniques described above. Finally these plants are selfed to give lines / families that are homozygous for the desired eIF4E / eIF(iso)4E alleles.
- Examples 1-3 The scenario described in Examples 1-3 is sufficient to explain virus resistance in plants that possess just one copy of eIF4E and/ or eIF(iso)4E, which a particular virus is able to utilise to complete its life-cycle.
- someplants have multiple copies/loci of one, or both of these two genes.
- Brassica rapa has three copies of both eIF4E and eIF(iso)4E, and a virus may be able to use any of these genes to complete its life cycle.
- BraA.eIF4E.b (R-o-18 only), BraA.eIF4E.c, BraA.eIF(iso)4E.b and BraA.eIF(iso)4E.c genes were amplified with standard PCR using Taq DNA polymerase (Invitrogen) and the primers listed below. Sections of these products were sequenced, using the BigDye Terminator system and an ABI Prism 3130x1 Genetics Analyzer (Applied Biosystems), in a step-wise manner to determine the complete genomic sequence of the alleles. BraA.eIF4E.b was not sequenced from RLR22, as it is non- functional. A summary of sequences obtained are listed in Table 1.
- Bi plant 16 was identified as homozygous for the RLR22 alleles of BraA.elF (iso)4E.a and BraA.eIF4E.c, but heterozygous at the BraA.eIF(iso)4E.c locus.
- RLR22 and R-o-18 have the same allele at the BraA.eIF(iso)4E.b locus and the R-o-18 allele at BraA.eIF4E.b is a pseudogene giving a much truncated polypeptide, and so these alleles were not determined for this plant.
- BiSi seed derived from Bi plant 16 was sown. Total genomic DNA was extracted from young leaves of the plants that germinated using a DNeasy plant mini kit (Qiagen), followed by amplification using the GenomiPhi system (GE Healthcare) . Plants were then genotyped at the BraA.eIF(iso)4E.c locus using the primers BR2
- the plants were mechanically inoculated with TuMV isolate CDN 1 at the 3-5 leaf stage and infection/ resistance phenotypes determined by visual assessment and ELISA as described by Rusholme et al. (2007).
- the genotypes, phenotypes and ELISA values for the plants are given in Table 2.
- Table 2 The phenotypes of Brassica rapa plants segregating for BraA.elFiisoHE.c from Bi Si family 16. derived from a cross between the Turnip mosaic virus (TuMV)-resistant plant RLR22 and the TuMV- susceptible plant R-o-18
- Genotype of plants at Phenotypes of plants Mean A405 from BraA.eIF(iso)4E.c locus (all following challenge with ELISA on homozygous for RLR22 allele of TuMV as determined by uninoculated leaves BraA.eIF(iso)4E.a and RLR22 visual assessment
- Plants homozygous for the RLR22 allele of BraA.eIF(iso)4E.c were completely resistant to TuMV, heterozygotes showed either no detectable infection, or were only slightly susceptible with the virus spreading from the inoculated leaves to a limited number of uninoculated leaves but then no further. Plants that were homozygous for the R-o-18 allele of BraA.eIF(iso)4E.c were completely susceptible. The results show that TuMV is able to use the R-o-18 allele of BraA.eIF(iso)4E.c and that plants need to be homozygous for this allele in order to establish a full systemic infection.
- results from inoculation of plants that were heterozygous at this locus show that one copy of the R- 0-I8 allele is not sufficient for TuMV to establish a full-blown systemic infection.
- Differences between the phenotypes of heterozygotes probably relate to the necessity for the virus to establish a high enough titre in inoculated leaves in order for systemic spread to take place.
- BraA.eIF(iso)4E. a is retrOI
- BraA.eIF(iso)4E.c is ConTROI .
- Table 3 The ability of Turnip mosaic virus (TuMV) to use the different eIF4E and eIF(iso)4E alleles in Brassica rapa lines RLR22 and R-o-18 to complete its life cycle
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Botany (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Environmental Sciences (AREA)
- Developmental Biology & Embryology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020137000250A KR101879741B1 (ko) | 2010-06-25 | 2011-06-24 | 식물의 진핵생물 번역 개시인자 4e |
| DK11728926.4T DK2585478T5 (da) | 2010-06-25 | 2011-06-24 | Eukaryot plante-translationsinitieringsfaktor 4e |
| EP11728926.4A EP2585478B1 (en) | 2010-06-25 | 2011-06-24 | Plant eukaryotic translation initiation factor 4e |
| JP2013515968A JP6093299B2 (ja) | 2010-06-25 | 2011-06-24 | 植物 |
| PL11728926.4T PL2585478T3 (pl) | 2010-06-25 | 2011-06-24 | Roślinny eukariotyczny czynnik inicjujący translację 4E |
| AU2011268733A AU2011268733B2 (en) | 2010-06-25 | 2011-06-24 | Plant eukaryotic translation initiation factor 4E |
| US13/805,859 US9890422B2 (en) | 2010-06-25 | 2011-06-24 | Plant eukaryotic translation initiation factor 4E |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1010740.7A GB201010740D0 (en) | 2010-06-25 | 2010-06-25 | A plant |
| GB1010740.7 | 2010-06-25 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011161466A1 true WO2011161466A1 (en) | 2011-12-29 |
Family
ID=42583014
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2011/051192 Ceased WO2011161466A1 (en) | 2010-06-25 | 2011-06-24 | Plant eukaryotic translation initiation factor 4e |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US9890422B2 (https=) |
| EP (1) | EP2585478B1 (https=) |
| JP (3) | JP6093299B2 (https=) |
| KR (1) | KR101879741B1 (https=) |
| AU (1) | AU2011268733B2 (https=) |
| DK (1) | DK2585478T5 (https=) |
| GB (1) | GB201010740D0 (https=) |
| HU (1) | HUE064247T2 (https=) |
| PL (1) | PL2585478T3 (https=) |
| WO (1) | WO2011161466A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102703445A (zh) * | 2012-05-31 | 2012-10-03 | 山东省农业科学院蔬菜研究所 | 大白菜eIF4E.a突变位点特异性分子标记及其应用 |
| CN105755011A (zh) * | 2016-04-12 | 2016-07-13 | 浙江大学 | 用于芥菜芜菁花叶病毒病抗性鉴定的分子标记及其用途 |
| CN109468330A (zh) * | 2018-12-25 | 2019-03-15 | 中国农业科学院作物科学研究所 | 大麦黄花叶病抗性基因eIF4EHOR3298及其鉴定方法和应用 |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106793760B (zh) | 2014-06-27 | 2021-03-09 | 日本烟草产业株式会社 | 病毒抗性烟草及其制备方法 |
| WO2018038249A1 (ja) | 2016-08-26 | 2018-03-01 | 日本たばこ産業株式会社 | ウイルス抵抗性タバコおよびその作出方法 |
| KR102791470B1 (ko) * | 2021-10-01 | 2025-04-08 | 대한민국 | eIF(iso)4E 유전자 교정에 의해 순무 모자이크 바이러스 저항성이 증가된 배추 식물체 및 이의 제조방법 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0242246A1 (en) | 1986-03-11 | 1987-10-21 | Plant Genetic Systems N.V. | Plant cells resistant to glutamine synthetase inhibitors, made by genetic engineering |
| EP0249637A1 (en) | 1985-12-04 | 1987-12-23 | Sundstrand Corporation | Bi-directional overtravel stop |
| GB2197653A (en) | 1986-11-11 | 1988-05-25 | Richard Anthony Jefferson | Gene fusion comprising beta -glucuronidase |
| US20050255455A1 (en) * | 2002-02-08 | 2005-11-17 | Genoplante-Valor | Eif4e gene mutations and potyvirus resistance |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7772462B2 (en) * | 2002-12-17 | 2010-08-10 | Cornell Research Foundation, Inc. | Recessive plant viral resistance results from mutations in translation initiation factor eIF4E |
| WO2010048398A2 (en) * | 2008-10-22 | 2010-04-29 | Cornell University | Mutated eif4e sequences from potato which are useful in imparting virus resistance |
-
2010
- 2010-06-25 GB GBGB1010740.7A patent/GB201010740D0/en not_active Ceased
-
2011
- 2011-06-24 PL PL11728926.4T patent/PL2585478T3/pl unknown
- 2011-06-24 DK DK11728926.4T patent/DK2585478T5/da active
- 2011-06-24 JP JP2013515968A patent/JP6093299B2/ja active Active
- 2011-06-24 WO PCT/GB2011/051192 patent/WO2011161466A1/en not_active Ceased
- 2011-06-24 EP EP11728926.4A patent/EP2585478B1/en active Active
- 2011-06-24 AU AU2011268733A patent/AU2011268733B2/en not_active Ceased
- 2011-06-24 US US13/805,859 patent/US9890422B2/en not_active Expired - Fee Related
- 2011-06-24 HU HUE11728926A patent/HUE064247T2/hu unknown
- 2011-06-24 KR KR1020137000250A patent/KR101879741B1/ko active Active
-
2016
- 2016-07-08 JP JP2016136045A patent/JP6488262B2/ja active Active
-
2018
- 2018-09-11 JP JP2018169500A patent/JP6689929B2/ja active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0249637A1 (en) | 1985-12-04 | 1987-12-23 | Sundstrand Corporation | Bi-directional overtravel stop |
| EP0242246A1 (en) | 1986-03-11 | 1987-10-21 | Plant Genetic Systems N.V. | Plant cells resistant to glutamine synthetase inhibitors, made by genetic engineering |
| GB2197653A (en) | 1986-11-11 | 1988-05-25 | Richard Anthony Jefferson | Gene fusion comprising beta -glucuronidase |
| US20050255455A1 (en) * | 2002-02-08 | 2005-11-17 | Genoplante-Valor | Eif4e gene mutations and potyvirus resistance |
Non-Patent Citations (9)
| Title |
|---|
| ANDREW J MAULE ET AL: "Sources of natural resistance to plant viruses: status and prospects", MOLECULAR PLANT PATHOLOGY, WILEY-BLACKWELL PUBLISHING LTD, GB, vol. 8, no. 2, 1 January 2007 (2007-01-01), pages 223 - 231, XP007916091, ISSN: 1464-6722, [retrieved on 20070209], DOI: 10.1111/J.1364-3703.2007.00386.X * |
| FLORENCE PIRON ET AL: "An Induced Mutation in Tomato eIF4E Leads to Immunity to Two Potyviruses", PLOS ONE, vol. 5, no. 6, 25 June 2010 (2010-06-25), pages E11313, XP055007538, ISSN: 1932-6203, DOI: 10.1371/journal.pone.0011313 * |
| ROBAGLIA ET AL: "Translation initiation factors: a weak link in plant RNA virus infection", TRENDS IN PLANT SCIENCE, ELSEVIER SCIENCE, OXFORD, GB, vol. 11, no. 1, 1 January 2006 (2006-01-01), pages 40 - 45, XP005242590, ISSN: 1360-1385, DOI: 10.1016/J.TPLANTS.2005.11.004 * |
| RUFFEL S ET AL: "A natural recessive resistance gene against potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E)", PLANT JOURNAL, BLACKWELL SCIENTIFIC PUBLICATIONS, OXFORD, GB, vol. 32, no. 6, 1 December 2002 (2002-12-01), pages 1067 - 1075, XP002242998, ISSN: 0960-7412, DOI: 10.1046/J.1365-313X.2002.01499.X * |
| RUSHOLME ET AL., JOURNAL OF GENERAL VIROLOGY, vol. 88, 2007, pages 3177 - 3186 |
| SATO M ET AL: "Selective involvement of members of the eukaryotic initiation factor 4E family in the infection of Arabidopsis thaliana by potyviruses", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 579, no. 5, 14 February 2005 (2005-02-14), pages 1167 - 1171, XP004745623, ISSN: 0014-5793, DOI: 10.1016/J.FEBSLET.2004.12.086 * |
| THOMPSON ET AL., NUCLEIC ACIDS RESEARCH, vol. 22, 1994, pages 4673 - 4680 |
| THOMPSON ET AL., NUCLEIC ACIDS RESEARCH, vol. 24, 1997, pages 4876 - 4882 |
| WALSH ET AL., EUROPEAN JOURNAL OF PLANT PATHOLOGY, vol. 108, 2002, pages 15 - 20 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102703445A (zh) * | 2012-05-31 | 2012-10-03 | 山东省农业科学院蔬菜研究所 | 大白菜eIF4E.a突变位点特异性分子标记及其应用 |
| CN102703445B (zh) * | 2012-05-31 | 2013-07-24 | 山东省农业科学院蔬菜研究所 | 大白菜eIF4E.a突变位点特异性分子标记及其应用 |
| CN105755011A (zh) * | 2016-04-12 | 2016-07-13 | 浙江大学 | 用于芥菜芜菁花叶病毒病抗性鉴定的分子标记及其用途 |
| CN109468330A (zh) * | 2018-12-25 | 2019-03-15 | 中国农业科学院作物科学研究所 | 大麦黄花叶病抗性基因eIF4EHOR3298及其鉴定方法和应用 |
| CN109468330B (zh) * | 2018-12-25 | 2021-06-08 | 中国农业科学院作物科学研究所 | 大麦黄花叶病抗性基因eIF4EHOR3298及其鉴定方法和应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2011268733B2 (en) | 2015-10-22 |
| US9890422B2 (en) | 2018-02-13 |
| JP2019001817A (ja) | 2019-01-10 |
| JP6488262B2 (ja) | 2019-03-20 |
| AU2011268733A1 (en) | 2012-12-20 |
| JP6093299B2 (ja) | 2017-03-08 |
| JP2013531500A (ja) | 2013-08-08 |
| KR20130114072A (ko) | 2013-10-16 |
| DK2585478T5 (da) | 2024-06-24 |
| KR101879741B1 (ko) | 2018-07-18 |
| DK2585478T3 (en) | 2023-12-11 |
| JP6689929B2 (ja) | 2020-04-28 |
| EP2585478A1 (en) | 2013-05-01 |
| GB201010740D0 (en) | 2010-08-11 |
| HUE064247T2 (hu) | 2024-02-28 |
| JP2016172780A (ja) | 2016-09-29 |
| US20130117879A1 (en) | 2013-05-09 |
| PL2585478T3 (pl) | 2024-02-26 |
| EP2585478B1 (en) | 2023-09-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6689929B2 (ja) | 植物 | |
| US12234467B2 (en) | Diplospory gene | |
| US11659807B2 (en) | Virus-resistant tobacco and breeding method therefor | |
| AU2020285344B2 (en) | Gene for parthenogenesis | |
| US12460224B2 (en) | Modified promoter of a parthenogenesis gene | |
| US20050055744A1 (en) | Nucleic acids encoding glucosinolate biosynthesis enzymes and methods of their use | |
| CA2873360A1 (en) | New plant resistance gene | |
| CA2774456C (en) | Cloning and exploitation of a functional r-gene from solanum chacoense | |
| WO2014112875A1 (en) | A new method to provide resistance to bacterial soft rot in plants | |
| BR112018004300B1 (pt) | Gene quimérico, constructo genético, vetor, uso e método para conferir diplosporia em uma planta |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11728926 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011728926 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2011268733 Country of ref document: AU Date of ref document: 20110624 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013515968 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20137000250 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13805859 Country of ref document: US |