WO2011050106A2 - Anti-cd3 antibody dosing in autoimmune disease - Google Patents

Anti-cd3 antibody dosing in autoimmune disease Download PDF

Info

Publication number
WO2011050106A2
WO2011050106A2 PCT/US2010/053438 US2010053438W WO2011050106A2 WO 2011050106 A2 WO2011050106 A2 WO 2011050106A2 US 2010053438 W US2010053438 W US 2010053438W WO 2011050106 A2 WO2011050106 A2 WO 2011050106A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
day
fragment
administered
days
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/053438
Other languages
English (en)
French (fr)
Other versions
WO2011050106A3 (en
Inventor
Charlotte Mckee
Paul Ponath
Douglas Ringler
Michael Rosenzweig
Lou Vaickus
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
TolerRx Inc
Original Assignee
TolerRx Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by TolerRx Inc filed Critical TolerRx Inc
Priority to EP10825629.8A priority Critical patent/EP2490714A4/en
Priority to JP2012535347A priority patent/JP2013508392A/ja
Priority to US13/502,618 priority patent/US20120269826A1/en
Priority to CA2778334A priority patent/CA2778334A1/en
Publication of WO2011050106A2 publication Critical patent/WO2011050106A2/en
Publication of WO2011050106A3 publication Critical patent/WO2011050106A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2

Definitions

  • Antibodies against the CD3 molecule have been tested for efficacy in the treatment of certain immune-related diseases in humans such as diabetes and psoriasis. Cytokine release syndrome and other negative effects are persistent problems in antibody-based therapeutic approaches, including therapeutic approaches involving anti-CD3 antibodies. Methods of administering anti-CD3 antibodies that overcome such problems would be advantageous.
  • the methods can cause modulation in the activity or numbers of one or both of antigen-specific effector (Teff) or antigen-specific regulatory (Treg) T cells, e.g., the number of antigen-specific T regulatory cells can be enhanced.
  • the mean levels of CD3/ TCR complexes on CD4+ and on CD8+ T-cells are decreased by at least 20% (e.g., at least: 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%), 65%), 70%), 75%o, 80%>, or 85%>) and less than 90%> as compared to the mean baseline levels.
  • the amount of anti-CD3 antibody or antigen binding antibody fragment thereof administered is about 0.1 mg on day one, about 0.2 mg on day two, about 0.3 mg on day three, and about 0.75 mg on each of days four through eight. In certain embodiments, the amount of anti-CD3 antibody or fragment thereof administered is about 0.1 mg on day one; about 0.2 mg on day two, about 0.3 mg on day 3, about 0.75 mg on day four, about 1.0 mg on day five, about 1.25 mg on day six, about 1.5 mg on day seven, and about 1.75 mg on day eight.
  • the anti-CD3 antibody or antigen binding fragment thereof is administered with a pharmaceutically acceptable carrier or diluent. In certain embodiments, the anti-CD3 antibody or fragment is administered in conjunction with another therapeutic agent.
  • Fig. 26 is a line graph showing the absolute numbers (xl0 9 /L) of CD8+ T cells during anti-CD3 mAb treatment in a clinical study in age groups 17 and younger (square symbol) and 18 and older (triangle symbol). The line with the diamond symbol indicates the average of the two age groups.
  • Fig. 56 is a line graph showing the time in days for which CD4+ and CD8+ T cells had surface levels of free receptors (FR) of 10%> to 40%> and 20%> to 30%> of baseline levels after various daily doses of otelixizumab in TTEDD CH4.
  • Fig. 57 is a line graph showing the time in days for which CD4+ and CD8+ T cells had surface levels of free receptors (FR) of 10% to 40% and 20%> to 30%> of baseline levels after various daily doses of otelixizumab in TTEDD CH5.
  • a given antibody also comprises one of two types of light chains, called kappa or lambda, the categorization of which is based on the amino acid sequence of the light chain constant domains.
  • Antigen binding fragment “antigen binding antibody fragment”, and “fragment” as the terms are used herein refer to an antigen binding molecule that is not an antibody as defined above, but that has at least one antigen binding site of an antibody.
  • Antigen binding fragments can include, for example, Fab fragments, F(ab') 2 fragments, scFv (single chain Fv) fragments, diabodies, linear antibodies, multispecific antibody fragments such as bispecific, trispecific, and multispecific antibodies (e.g., diabodies, triabodies, tetrabodies), minibodies, chelating recombinant antibodies, tribodies or bibodies, intrabodies, nanobodies, small modular immunopharmaceuticals (SMIP), binding-domain immunoglobulin fusion proteins, camelized antibodies, and V HH containing antibodies.
  • Fab fragments fragments, F(ab') 2 fragments, scFv (single chain Fv) fragments, diabodies, linear antibodies, multispecific antibody fragments such as bispecific, trispecific, and multispecific antibodies (e.g., diabodies, triabodies, tetrabodies), minibodies, chelating recombinant antibodies, tribodies or bibo
  • a dosing regimen may include a given number of days of treatment.
  • an anti-CD3 dosing regimen may include administering an anti-CD3 antibody to an animal for a minimum number of days, a maximum number of days, or a specific number of days.
  • an anti-CD3 antibody may be administered to an animal over a regimen of five days, eight days, or any number of days in between or beyond.
  • An anti-CD3 dosing regimen may be as short as one day, although as will be apparent from the remainder of the present specification, multiple day dosing regimens permit administration of higher amounts of antibody on later days while significantly reducing cytokine release syndrome and other negative effects.
  • Regimens are generally 21 days or less (e.g., 18 days or less, 14 days or less, 12 days or less, 10 days or less, 8 days or less, 5 days or less, 3 days or less, 2 days or less, or 1 day) in length. Regimens can be separated by relatively short periods of time (e.g., 5 days, 10 days, 15 days, 20 days, 25 days, 30 days, 1.5 months, 2 months, 3 months, or 4 months) or longer periods of time (e.g., 6 months, 9 months, 12 months, 18 months. 2 years, 3 years, 4 years, 5 years, 10 years, 15 years, or 20 years). Additionally and/or alternatively, a regimen may include a given amount of therapeutic agent administered per day. For example, an anti-CD3 antibody or fragment may be administered to an animal in a minimum amount on one or more days of the regimen, in a maximum amount on one or more days of the regimen, or in a specific amount on one or more days of the regimen.
  • an anti-CD3 antibody or fragment may be administered to an
  • an anti-CD3 antibody or antigen binding fragment thereof is administered on consecutive days during a given dosing regimen.
  • the anti-CD3 antibody or fragment is not administered on consecutive days of a dosing regimen.
  • a given dosing regimen may include one or more days in which the anti-CD3 antibody or fragment is not administered.
  • a dosing regimen comprises one, two, three, four, five, six, seven or more days in which the anti-CD3 antibody or fragment is not administered.
  • the anti-CD3 antibody or fragment is administered every other day of a dosing regimen.
  • the anti-CD3 antibody or fragment is administered every third day, or every fourth day.
  • the anti-CD3 antibody or fragment is administered in an amount that does not exceed about 0.5 mg per day during the early portion of a dosing regimen.
  • the anti-CD3 antibody or fragment may be administered in an amount that does not exceed about 0.5 mg per day on the first one, two and/or three days of the regimen.
  • the amount of the anti-CD3 antibody or fragment administered on the first two days of the dosing regimen does not exceed about 0.5 mg per day.
  • the amount of the anti-CD3 antibody or fragment administered on the first day of the dosing regimen does not exceed about 0.5 mg.
  • the amount of the anti-CD3 antibody or fragment administered on day four of the dosing regimen may be less than about 0.55 mg greater, about 0.5 mg greater, about 0.45 mg greater, about 0.4 mg greater, about 0.35 mg greater, about 0.3 mg greater, about 0.25 mg greater, about 0.2 mg greater, about 0.15 mg greater, about 0.1 mg greater, about 0.09 mg greater, about 0.08 mg greater, about 0.07 mg greater, about 0.06 mg greater, about 0.05 mg greater, about 0.04 mg greater, about 0.03 mg greater, about 0.02 mg greater, about 0.01 mg greater, or less than on day three.
  • the anti-CD3 antibody or fragment is administered according to the following dosing regimen: about 0.1 mg on day one, about 0.2 mg on day two, about 0.3 mg on day three, about 0.75 mg day four, about 1.0 mg on day five, about 1.25 mg on day six, about 1.5 mg on day seven, and about 1.75 mg on day eight.
  • the anti-CD3 antibody or fragment is administered according to the following dosing regimen: about 0.1 mg on day one, about 0.2 mg on day two, about 0.3 mg on day three, about 0.75 mg day four, about 1.0 mg on day five, about 1.25 mg on day six, about 1.5 mg on day seven, and about 3.75 mg on day eight.
  • the anti-CD3 antibody or fragment is administered according to the following dosing regimen: about 0.2 mg on day one, about 0.4 mg on day two, about 0.8 mg on day three, about 1.4 mg on day four, and about 1.6 mg on day five. In certain embodiments, the anti-CD3 antibody or fragment is administered according to the following dosing regimen: about 0.1 mg on day one, about 0.3 mg on day two, about 0.6 mg on day three, about 1.2 mg on day four, and about 2.2 mg on day five.
  • the anti-CD3 antibody or fragment is administered to a patient by a route other than an intravenous route.
  • the anti-CD3 antibody or fragment may be administered to a patient orally, rectally, intramuscularly, intravenously, intranasally, subcutaneously, intraocularly, transdermally, by direct injection into an affected organ or tissue site, or inhaled.
  • the anti- CD3 antibody or fragment is administered as a continuous infusion (e.g., by a microinfusion pump or slow-release patch) rather than a fixed dose.
  • the patient self- administers the antibody or fragment.
  • a single daily dose may be administered to a patient over a period of fifteen minutes, thirty minutes, forty-five minutes, one hour, two hours, three hours, four hours, five hours, six hours, seven hours, eight hours, nine hours, ten hours, eleven hours, twelve hours, or more.
  • Such embodiments are useful when, for example, the patient experiences adverse side effects from administering the anti-CD3 antibody or fragment over a relatively short period of time.
  • Administration of the anti-CD3 antibody or fragment to a patient over a period of time may be accomplished in any of a variety of ways such as, without limitation, intravenous administration.
  • a pre-ramp day can be one or more days (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7, or more, 8 or more, nine or more, 10 or more, 11 or more, 12 or more, 13 or more, or 14 or more) before the first day of a ramp.
  • days e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7, or more, 8 or more, nine or more, 10 or more, 11 or more, 12 or more, 13 or more, or 14 or more
  • a ramping period comprises the following characteristics: the anti-CD3 antibody or antigen binding fragment thereof is administered in an amount greater than about 0.1 mg and less than about 0.5 mg on ramp day one; the amount of the antibody or fragment administered on ramp day two is less than about 0.5 mg greater than the amount of the antibody or fragment administered on ramp day one; the amount of the antibody or fragment administered on ramp day three is less than about 0.55 mg greater than the amount of the antibody or fragment administered on ramp day two; the amount of the antibody or fragment administered on ramp day four is less than about 0.6 mg greater than the amount of the antibody or fragment administered on ramp day three; the amount of the antibody or fragment administered on ramp day four is more than 0.3 mg greater than the amount of the antibody or fragment administered on ramp day one; and the amount of the antibody or fragment administered at least one ramp day is at least about 0.5 mg.
  • Juveniles have a lower body surface area than that of the typical adult.
  • a juvenile patient may have a body surface area of 1.3 square meters.
  • the juvenile patient may be administered 153.85 ⁇ g of the anti-CD3 antibody or fragment.
  • anti-CD3 antibodies or antigen binding fragments thereof can be administered without regard to the molecular weight of the anti-CD3 antibody or fragment, or to the number of antigen binding sites in a given anti-CD3 antibody or fragment.
  • any of the dosing regimens described above can be administered to patient regardless of molecular weight or number of antigen binding sites.
  • T cells that undergo apoptosis as a result of exposure to CD3-binding agents are those that are activated by antigen prior to the exposure (and are progressing through the cell cycle) and are not resting T cells.
  • T cells in the S- G2 phase of the cell cycle are particularly sensitive to this type of apoptosis.
  • the decreases in the numbers of CD4+ and CD8+ T cells that are seen in the first phase appear to reflect retrafficking of T cells (e.g., from the blood to lymphoid tissue and/or target organs) and, to a relatively small extent, the above-described apoptosis.
  • CD3-binding agent-induced anergy induction involves reduction in the relative proportion of cell surface CD3/TCR multimeric clusters to cell-surface monovalent CD3/TCR complexes. It has been shown that CD3/TCR complexes on T cells occur as both monovalent units and as multivalent clusters, the latter existing in a wide range of multiplicities (from two to greater than 20 CD3/TCR monomers), and the monomer in each case containing a TCR a and ⁇ chain (or a TCR ⁇ and ⁇ chain), one CD3 ⁇ , two CD3 ⁇ , one CD3 ⁇ , and two CD3 ⁇ chains (see, e.g.: Alarcon et al.
  • This phenomenon could also explain the "conditioning" effect observed when an animal (e.g., a human) is administered a dosing regimen that includes a ramping period, as disclosed herein. Without wishing to be bound by theory, it is hypothesized that conditioning may result from the lower ramping doses being sufficient to modulate but not activate, so that when subsequent larger activating doses are given later in a dosing regimen, the signal strength is weak or incomplete, leading to relative low responses and anergy. At some critical concentration of CD3-binding agent and/or length of exposure of the T cell to the CD3-binding agent, the T cell will be rendered anergic for an extremely long time, possibly for its lifetime. The relative susceptibility of T cells to anergy induction would depend on a number of factors, including the relative number of multimeric CD3/TCR clusters to monovalent CD3/TCR units and the relative number of monomeric units in the clusters.
  • TGF- ⁇ transforming growth factor ⁇
  • This document also provides methods for treating a human with an anti-CD3 antibody or an antigen binding fragment thereof, the method comprising: administering the antibody or the fragment to the human in a regimen such that: (a) in a regimen of 3 days or more, the daily dose administered is at least 1 mg and no greater than 3 mg in any 24 hour period and on each of at least 3 days of the regimen; (b) in a regimen of 3 days or more, the daily dose administered is at least 1 mg and no greater than 1.75 mg in any 24 hour period and on each of at least 3 days of the regimen; (c) in a regimen of 3 days or more, the daily dose administered is at least 14 ⁇ g/kg and no greater than 42 ⁇ g/kg in any 24 hour period and on each of at least 3 days of the regimen; (d) in a regimen of 3 days or more, the total dose administered is 2.5 mg to 9 mg and no greater than 3 mg on any single day of the regimen; (e) in a regimen of 3 days or more, the total dose administered is 2.5 mg to 6.6
  • the total dose of anti- CD3 antibody or fragment thereof administered is at least 0.5 mg, 1.0 mg, 1.5 mg, 2.0 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 4.5 mg, 5.0 mg, 5.5. mg, 6.0 mg, 6.5 mg, 7.0 mg, 8.0 mg, 8.5 mg, 9.0 mg, 9.5 mg, 10 mg, or more.
  • the dosing regimen can be a follows, (a) the amount of antibody or fragment administered on day one is about 0.1 mg, 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1.0 mg, or more; the amount of antibody or fragment administered on day two is about 0.1 mg, 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1.0 mg, or more; the amount of antibody or fragment administered on day three is about 0.1 mg, 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1.0 mg, or more; the amount of antibody or fragment administered on day four is about 0.1 mg, 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1.0 mg, or more; the amount of antibody or fragment administered on day five is about 0.1 mg, 0.2 mg,
  • the CD3/TCR is down-modulated from T cell surfaces, and the transient trafficking and re-distribution of lymphocytes reduces the total pool of receptors available for binding.
  • the MM elimination was used to approximate observed nonlinearities.
  • the drug is eliminated under linear conditions with a k e i of 1.39 day " 1 and a corresponding half-life of 0.50 day.
  • an antibody fragment is a Fab fragment, a F(ab') 2 fragment, a scFv fragment, a diabody, a linear antibody, a multispecific antibody fragment such as a bispecific, a trispecific, or a multispecific antibody (e.g., a diabody, a triabody, a tetrabody), a minibody, a chelating recombinant antibody, a tribody or bibody, an intrabody, a nanobody, a small modular immunopharmaceutical (SMIP), a binding-domain immunoglobulin fusion protein, a camelid antibody, or a V HH containing antibody.
  • SMIP small modular immunopharmaceutical
  • the anti-CD3 antibody or fragment to be employed in one or more of the dosing regimens disclosed herein comprises the light chain variable region of otelixizumab, as set forth in SEQ ID NO: 4 [DIQLTQPNSVSTSLGSTVKLSCTLSSGNIENNYVHWYQLYEG RSPTTMIYDDDKRPDGVPDRFSGSIDRSSNSAFLTIHNVAIEDEAIYFCHSYVSSFNVFGG GTKLTVLR].
  • binding of the modified antibody or antigen binding fragment thereof to at least one class of Fc (gamma) receptor is reduced as compared to the binding exhibited by the IgGl immunoglobulin molecule produced by the ARH-77 cell line deposited under ATCC catalog number CRL-1621.
  • the anti-CD3 antibody or fragment to be employed in one or more of the dosing regimens disclosed herein exhibits at least 25% reduced binding to at least one class of Fc (gamma) receptor as compared to the binding that would be observed with the IgGl antibody produced by the ARH-77 cell line deposited under ATCC catalog number CRL-1621.
  • an anti-CD3 antibody or antigen binding fragment thereof that exhibits reduced binding to at least one class of Fc (gamma) receptor comprises a modification that results in the reduced binding.
  • such an anti-CD3 antibody or fragment may be modified at one or more amino acid residues within a heavy chain, a light chain, or both.
  • the glycosylation state of an antibody or fragment may affect its binding to one or more classes of Fc (gamma) receptor.
  • glycosylation of an anti- CD3 antibody or fragment is altered by modifying one or more amino acid residues within a heavy chain, a light chain, or both.
  • any of a variety of moieties may be covalently or non-covalently linked to the anti-CD3 antibody or fragment to prevent binding to at least one class of Fc (gamma) receptor.
  • moieties that can be linked to an antibody or fragment, and will be able to employ such moieties in accordance with the teachings herein.
  • moieties that can be linked to an antibody or fragment, and will be able to employ such moieties in accordance with the teachings herein.
  • Those of ordinary skill in the art will be aware of other anti-CD3 antibodies and antigen binding fragments thereof that exhibit reduced binding to at least one class of Fc (gamma) receptor, which antibodies and fragments can be employed in one or more of the dosing regimens disclosed herein.
  • compositions suitable for injectable use typically include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition should be sterile and should be fluid to the extent that easy syringability exists.
  • Pharmaceutical formulations are ideally stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the relevant carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the anti-CD3 antibody or antigen binding fragment thereof in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the purified anti-CD3 antibody or fragment into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • exemplary methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the anti-CD3 antibody or antigen binding fragment thereof and a delivery agent are preferably delivered in the form of an aerosol spray from a pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • the present disclosure particularly contemplates delivery of the compositions using a nasal spray, inhaler, or other direct delivery to the upper and/or lower airway.
  • Intranasal administration of DNA vaccines directed against influenza viruses has been shown to induce CD8+ T cell responses, indicating that at least some cells in the respiratory tract can take up DNA when delivered by this route, and the delivery agents of the invention will enhance cellular uptake.
  • the anti-CD3 antibody or fragment and a delivery agent are formulated as large porous particles for aerosol administration.
  • compositions as described herein can be included in a container, pack, or dispenser together with instructions for administration.
  • Anti-CD3 antibodies and antigen binding fragments thereof can be administered according to one or more dosing regimens disclosed herein in combination with one or more other therapeutic agents.
  • Therapeutic agents that can be administered in combination with an anti-CD3 antibody or fragment thereof include, but are not limited to, peptides, polypeptides, conjugates, nucleic acid molecules (e.g., DNA or R A), small molecules, mimetic agents, synthetic drugs, inorganic molecules, and organic molecules.
  • immunomodulatory agents include, but are not limited to, methotrexate, leflunomide, cyclophosphamide, Cytoxan, Immuran, cyclosporine A, minocycline, azathioprine, antibiotics (e.g., FK506 (tacrolimus)), methylprednisolone (MP), corticosteroids, steroids, mycophenolate mofetil, rapamycin (sirolimus), mizoribine, deoxyspergualin, brequinar, malononitriloamindes (e.g., leflunamide).
  • an immunomodulatory agent is a chemotherapeutic agent.
  • an immunomodulatory agent is an immunomodulatory agent other than a chemotherapeutic agent.
  • Absolute counts for each lymphocyte subset per liter were calculated based on CD markers by multiplying the absolute number of lymphocytes per liter by the percentage of lymphocytes in the lymphocyte flow cytometry gate (as determined using forward and side light scatter parameters) bearing the CD marker of interest. To facilitate accurate enumeration of lymphocyte populations that occur at low frequencies, 50,000 events were collected by flow cytometry. The absolute number of lymphocytes was determined by multiplying the total white blood cell (WBC) count (from a hematology sample taken at the same time as the flow cytometry sample) by the percentage of lymphocytes as determined by the WBC differential cell count. Absolute counts and percentages were calculated for each parameter, and changes from baseline were determined for each post- baseline assessment.
  • WBC white blood cell
  • Binding of this antibody is not blocked by otelixizumab bound to the CD3 surface molecule when otelixizumab serum levels are below 1 ⁇ g/mL. Serum levels of otelixizumab greater than 1 ⁇ g/mL were not detected in any of subjects described in this example.
  • the MESF of the anti-TCR antibody was used to quantify the number of CD3/TCR complexes present on T cells. Free otelixizumab binding sites (unoccupied by previously administered otelixizumab) were detected by staining with biotinylated otelixizumab and fluorophore-conjugated streptavidin. The MESF of bound biotinylated otelixizumab is directly proportional to the availability of free otelixizumab binding sites.
  • IL6 interleukin 6
  • TNF-alpha tumor necrosis factor-alpha
  • Otelixizumab was administered intravenously to a cohort of 35 patients diagnosed with Type I diabetes according to the following dosing schedule: 0.1 mg on day 1, 0.2 mg on day 2, 0.3 mg on day 3, and 0.75 mg on days 4-8. Daily doses were administered approximately 24 hours apart, and each dose was administered by intravenous infusion over a course of between about fifteen minutes and about two hours.
  • CD4+FoxP3+ T cells, CD8+FoxP3+ T cells, and CD4+CD25+FoxP3+ T cells were determined based on CD markers as described above. Absolute counts and percentages were calculated for each parameter, and changes from baseline were determined for each post-baseline assessment.
  • CD4+FoxP3+ T cell results for dosing regimen CH2 are shown in Fig. 1.
  • CD8+FoxP3+ T cell results for dosing regimen CH2 are shown in Fig. 2.
  • CD4+CD25+FoxP3+ T cell results for dosing regimen CH2 are shown in Fig. 3. As shown in Figs.
  • Figs. 6 and 10 show results for dosing regimen CH2 in the lines indicated by square data points, labeled as CH2.
  • Fig. 6 shows percent CD3/TCR sites compared to baseline.
  • Fig. 10 shows the number of CD3/TCR sites expressed as MESF units.
  • the number of free CD3 sites on CD4+ T cells was determined using biotinylated otelixizumab as described above. Results for dosing regimen CH3 are shown in Fig. 7, in the line indicated by triangle data points, labeled as CH3. As can be seen, a transient decrease in the number of free CD3 sites was observed during dosing. When the infusions of otelixizumab were stopped after Day 8, the number of free CD3 sites returned to baseline between week 2 and week 3. [00259] Absolute counts for CD4+ T cells were determined based on CD markers as described above. Results for dosing regimen CH3 are shown in Fig. 8, in the line indicated by triangle data points, labeled as CH3. As shown in Fig. 8, a transient decrease of CD4+ T cells in peripheral blood was observed during dosing. The number of CD4+ T cells recovered to baseline levels between week 2 and week 3.
  • This Example shows that the CH3 dosing regimen results in partial modulation of CD3/TCR sites during dosing and that regulatory T cells are induced after dosing. These effects were more pronounced in subjects administered the CH3 dosing regimen that in subjects administered the CH2 dosing regimen. This example also shows that lymphopenia is sustained throughout the course of the dosing regimen, but rebounds to baseline levels in the weeks following the end of the regimen.
  • PK Pharmacokinetic
  • PD pharmacodynamic
  • otelixizumab on CD4+ T cells was determined using anti-human IgG antibody reagents, and fluorescence intensity was quantified by using standard MESF units as described above (Fig. 22). Data for all the subjects, subjects 17 years of age and younger, and subjects 18 years of age and older in the CH5 study are separately shown. When the infusions of otelixizumab were stopped after Day 5, the levels CD4+ T cell bound otelixizumab returned to baseline after dosing ended.
  • Serum levels of otelixizumab were determined by ELISA assay as described above. Data for adolescent subjects (17 years of age and younger) and adult subjects (18 years of age and older) in the CH5 study are separately shown (Fig. 27). The LOQ (limit of quantification) is shown in the figure. Serum levels of otelixizumab rose after each daily administration, and then dropped back to baseline by the next day.
  • otelixizumab Final concentrations of otelixizumab tested were 10, 1, 0.1, 0.01, 0.001, 0.0001 and 0 ⁇ g/mL. 100 ⁇ of otelixizumab, 50 ⁇ of responder cells and 50 ⁇ of stimulator cells were added to the wells of 96-well round-bottomed tissue culture plates (Corning 3799). Triplicate wells were also plated containing responder alone (50 ⁇ of responder cells with 50 ⁇ of media and 100 ⁇ of otelixizumab) as controls. Plates were incubated at 37°C with 5% C0 2 for 5 days.
  • mice BALB/c mice (Harlan, Boston, MA) were used in Study A.
  • Otelixizumab-treated subjects had improved beta-cell function as compared with placebo for as long as 18 months after dosing ⁇ Id.) and follow-up data showed a significant decrease in exogenous insulin use up to 48 months after dosing ⁇ Id.; You, S., Candon, S., Kuhn, C, Bach, J.F. & Chatenoud, L. CD3 antibodies as unique tools to restore self-tolerance in established autoimmunity their mode of action and clinical application in type 1 diabetes. Adv Immunol 2008; 100: 13-37, incorporated herein by reference in its entirety).
  • Cohort C also referred to as Cohort RT-C
  • Cohort CHI also referred to as TTEDD CHI
  • Cohort CH2 also referred to as TTEDD CH2
  • Cohort CH3 also referred to as TTEDD CH3
  • Cohort CH4 also referred to as TTEDD CH4
  • Cohort CH5 also referred to as TTEDD CH5
  • the FR4max (the maximum level of free receptors on CD4+ T cells), the FR4min (the minimum level of free receptors on CD4+ T cells), the FR8max (the maximum level of free receptors on CD8+ T cells), the FR8min (the minimum level of free receptors on CD8+ T cells), the DR4min (the minimum level of drug bound receptors on CD4+ T cells), DR4max (the maximum level of drug bound receptors on CD4+ T cells), DR8min (the minimum level of drug bound receptors on CD8+ T cells) and DR8max (the maximum level of drug bound receptors on CD8+ T cells) after every dose in the following studies were calculated: Cohort C (also referred to as Cohort RT-C), Cohort CHI (also referred to as TTEDD CHI), Cohort CH2 (also referred to as TTEDD), Cohort CH3 (also referred to as TTEDD CH3), Cohort CH4 (also referred to as TTEDCTED

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Diabetes (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Rheumatology (AREA)
  • Obesity (AREA)
  • Neurology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Neurosurgery (AREA)
  • Dermatology (AREA)
  • Biomedical Technology (AREA)
  • Pain & Pain Management (AREA)
  • Emergency Medicine (AREA)
  • Ophthalmology & Optometry (AREA)
  • Transplantation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2010/053438 2009-10-20 2010-10-20 Anti-cd3 antibody dosing in autoimmune disease Ceased WO2011050106A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP10825629.8A EP2490714A4 (en) 2009-10-20 2010-10-20 ASSAY OF ANTI-CD3 ANTIBODIES IN AUTOIMMUNE DISEASES
JP2012535347A JP2013508392A (ja) 2009-10-20 2010-10-20 自己免疫疾患における抗cd3抗体の投薬
US13/502,618 US20120269826A1 (en) 2009-10-20 2010-10-20 Anti-cd3 antibody dosing in autoimmune disease
CA2778334A CA2778334A1 (en) 2009-10-20 2010-10-20 Anti-cd3 antibody dosing in autoimmune disease

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US25348209P 2009-10-20 2009-10-20
US61/253,482 2009-10-20

Publications (2)

Publication Number Publication Date
WO2011050106A2 true WO2011050106A2 (en) 2011-04-28
WO2011050106A3 WO2011050106A3 (en) 2011-08-04

Family

ID=43900947

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/053438 Ceased WO2011050106A2 (en) 2009-10-20 2010-10-20 Anti-cd3 antibody dosing in autoimmune disease

Country Status (5)

Country Link
US (1) US20120269826A1 (cg-RX-API-DMAC7.html)
EP (1) EP2490714A4 (cg-RX-API-DMAC7.html)
JP (1) JP2013508392A (cg-RX-API-DMAC7.html)
CA (1) CA2778334A1 (cg-RX-API-DMAC7.html)
WO (1) WO2011050106A2 (cg-RX-API-DMAC7.html)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014155135A1 (en) * 2013-03-28 2014-10-02 Ucl Business Plc Methods for the treatment of autoimmune diseases
US11066483B2 (en) 2010-11-30 2021-07-20 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US11485790B2 (en) 2014-04-07 2022-11-01 Chugai Seiyaku Kabushiki Kaisha Immunoactivating antigen-binding molecule
US11505605B2 (en) 2014-05-13 2022-11-22 Chugai Seiyaku Kabushiki Kaisha T cell-redirected antigen-binding molecule for cells having immunosuppression function
US11649293B2 (en) 2015-11-18 2023-05-16 Chugai Seiyaku Kabushiki Kaisha Method for enhancing humoral immune response
US11660340B2 (en) 2015-11-18 2023-05-30 Chugai Seiyaku Kabushiki Kaisha Combination therapy using T cell redirection antigen binding molecule against cell having immunosuppressing function
WO2023133595A2 (en) 2022-01-10 2023-07-13 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023150518A1 (en) 2022-02-01 2023-08-10 Sana Biotechnology, Inc. Cd3-targeted lentiviral vectors and uses thereof
WO2023193015A1 (en) 2022-04-01 2023-10-05 Sana Biotechnology, Inc. Cytokine receptor agonist and viral vector combination therapies
WO2024044655A1 (en) 2022-08-24 2024-02-29 Sana Biotechnology, Inc. Delivery of heterologous proteins
WO2024119157A1 (en) 2022-12-02 2024-06-06 Sana Biotechnology, Inc. Lipid particles with cofusogens and methods of producing and using the same
WO2024220597A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Digital droplet based assay for detecting replication competent lentiviral vector
WO2024243340A1 (en) 2023-05-23 2024-11-28 Sana Biotechnology, Inc. Tandem fusogens and related lipid particles
WO2025184529A1 (en) 2024-03-01 2025-09-04 Sana Biotechnology, Inc. Viral particles with fusogen display and related compositions and methods

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016001810A1 (en) 2014-07-01 2016-01-07 Pfizer Inc. Bispecific heterodimeric diabodies and uses thereof
CN116617387A (zh) * 2016-08-29 2023-08-22 迪赞纳生命科学公开有限公司 抗cd3抗体制剂
WO2018106945A1 (en) 2016-12-07 2018-06-14 Progenity Inc. Gastrointestinal tract detection methods, devices and systems
WO2018183929A1 (en) 2017-03-30 2018-10-04 Progenity Inc. Treatment of a disease of the gastrointestinal tract with an immune modulatory agent released using an ingestible device
WO2019246312A1 (en) 2018-06-20 2019-12-26 Progenity, Inc. Treatment of a disease of the gastrointestinal tract with an immunomodulator
WO2019246317A1 (en) 2018-06-20 2019-12-26 Progenity, Inc. Treatment of a disease or condition in a tissue originating from the endoderm
EP3883635A1 (en) 2018-11-19 2021-09-29 Progenity, Inc. Methods and devices for treating a disease with biotherapeutics
JP2022526640A (ja) * 2019-04-10 2022-05-25 マクロジェニクス,インコーポレーテッド 血液悪性腫瘍の治療における二重特異性cd123×cd3ダイアボディの投薬レジメン
WO2020232247A1 (en) 2019-05-14 2020-11-19 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
CN115666704B (zh) 2019-12-13 2025-09-26 比特比德科有限责任公司 用于将治疗剂递送至胃肠道的可摄取装置
IL298999A (en) 2020-06-11 2023-02-01 Provention Bio Inc Methods and compositions for the prevention of type 1 diabetes
JP2024520444A (ja) 2021-05-24 2024-05-24 プロヴェンション・バイオ・インコーポレイテッド 1型糖尿病を治療するための方法

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2380127A (en) * 2001-09-26 2003-04-02 Isis Innovation Treatment of chronic joint inflammation
EP1725254A4 (en) * 2004-02-04 2008-02-13 Univ Columbia ANTI-CD3 IMMUNOTHERAPY AND SPECIFIC ANTIGENS FOR THE TREATMENT OF AUTOIMMUNITY
WO2007009064A2 (en) * 2005-07-11 2007-01-18 Macrogenics, Inc. Methods for the treatment of autoimmune disorders using immunosuppressive monoclonal antibodies with reduced toxicity
CN101309703A (zh) * 2005-09-12 2008-11-19 诺维莫尼公司 抗cd3抗体组合物
EP2433650A3 (en) * 2006-06-06 2012-12-19 Tolerrx Inc. Administration of anti-CD3 antibodies in the treatment of autoimmune diseases
SG177907A1 (en) * 2006-06-14 2012-02-28 Macrogenics Inc Methods for the treatment of autoimmune disorders using immunosuppressive monoclonal antibodies with reduced toxicity

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP2490714A4 *

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12479929B2 (en) 2010-11-30 2025-11-25 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US11066483B2 (en) 2010-11-30 2021-07-20 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US12522669B2 (en) 2010-11-30 2026-01-13 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
US10376518B2 (en) 2013-03-28 2019-08-13 Ucl Business Plc Methods for the treatment of autoimmune diseases
WO2014155135A1 (en) * 2013-03-28 2014-10-02 Ucl Business Plc Methods for the treatment of autoimmune diseases
US11485790B2 (en) 2014-04-07 2022-11-01 Chugai Seiyaku Kabushiki Kaisha Immunoactivating antigen-binding molecule
US11505605B2 (en) 2014-05-13 2022-11-22 Chugai Seiyaku Kabushiki Kaisha T cell-redirected antigen-binding molecule for cells having immunosuppression function
US11649293B2 (en) 2015-11-18 2023-05-16 Chugai Seiyaku Kabushiki Kaisha Method for enhancing humoral immune response
US11660340B2 (en) 2015-11-18 2023-05-30 Chugai Seiyaku Kabushiki Kaisha Combination therapy using T cell redirection antigen binding molecule against cell having immunosuppressing function
WO2023133595A2 (en) 2022-01-10 2023-07-13 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023150518A1 (en) 2022-02-01 2023-08-10 Sana Biotechnology, Inc. Cd3-targeted lentiviral vectors and uses thereof
WO2023193015A1 (en) 2022-04-01 2023-10-05 Sana Biotechnology, Inc. Cytokine receptor agonist and viral vector combination therapies
WO2024044655A1 (en) 2022-08-24 2024-02-29 Sana Biotechnology, Inc. Delivery of heterologous proteins
WO2024119157A1 (en) 2022-12-02 2024-06-06 Sana Biotechnology, Inc. Lipid particles with cofusogens and methods of producing and using the same
WO2024220597A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Digital droplet based assay for detecting replication competent lentiviral vector
WO2024243340A1 (en) 2023-05-23 2024-11-28 Sana Biotechnology, Inc. Tandem fusogens and related lipid particles
WO2025184529A1 (en) 2024-03-01 2025-09-04 Sana Biotechnology, Inc. Viral particles with fusogen display and related compositions and methods

Also Published As

Publication number Publication date
US20120269826A1 (en) 2012-10-25
CA2778334A1 (en) 2011-04-28
EP2490714A2 (en) 2012-08-29
JP2013508392A (ja) 2013-03-07
WO2011050106A3 (en) 2011-08-04
EP2490714A4 (en) 2013-11-13

Similar Documents

Publication Publication Date Title
US20120269826A1 (en) Anti-cd3 antibody dosing in autoimmune disease
US20130095121A1 (en) Methods of treating patients with immune-related diseases
TWI875757B (zh) T1dm和胰島炎治療中使用之抗cd40抗體
JP6861301B2 (ja) 移植片拒絶の予防に使用するための抗cd40抗体
AU2014237898B2 (en) Pan-ELR+ CXC chemokine antibodies
MX2008011785A (es) Metodos de tratamiento de lupus utilizando anticuerpos cd4.
KR20200119244A (ko) 이중 특이성 항체
JP7572041B2 (ja) 重症喘息を処置するための組成物および方法
KR20220039720A (ko) 이중 특이성 항체
TW202311293A (zh) 免疫療法之組合及其用途
CA2778331A1 (en) Methods of using anti-cd3 antibodies to prevent weight gain
US20240228654A9 (en) Anti-cd38 antibodies for use in the treatment of antibody-mediated transplant rejection
KR20220030956A (ko) Pd-1/cd3 이중 특이성 단백질에 의한 혈액암 치료
WO2026090536A1 (en) Methods and uses for treating nk cell or t-cell lymphomas or leukemias with anti-cd94 antibodies
CN116997570A (zh) 用于治疗抗体介导的移植排斥的抗cd38抗体
HK40042290A (en) Anti cd6 antibodies for treating severe asthma
HK40000997A (en) Pan-elr+ cxc chemokine antibodies
HK40000997B (en) Pan-elr+ cxc chemokine antibodies

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10825629

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2012535347

Country of ref document: JP

Ref document number: 2778334

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2010825629

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13502618

Country of ref document: US