WO2010115261A1 - Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor - Google Patents
Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor Download PDFInfo
- Publication number
- WO2010115261A1 WO2010115261A1 PCT/CA2010/000423 CA2010000423W WO2010115261A1 WO 2010115261 A1 WO2010115261 A1 WO 2010115261A1 CA 2010000423 W CA2010000423 W CA 2010000423W WO 2010115261 A1 WO2010115261 A1 WO 2010115261A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- transcript
- mitochondrial
- fusion
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61B—DIAGNOSIS; SURGERY; IDENTIFICATION
- A61B10/00—Instruments for taking body samples for diagnostic purposes; Other methods or instruments for diagnosis, e.g. for vaccination diagnosis, sex determination or ovulation-period determination; Throat striking implements
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0036—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on NADH or NADPH (1.6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/112—Disease subtyping, staging or classification
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/156—Polymorphic or mutational markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y106/00—Oxidoreductases acting on NADH or NADPH (1.6)
Definitions
- the invention relates to the identification and use of mitochondrial genome fusion transcripts and translation products, as well as probes that hybridize thereto.
- Mitochondrial Genome [0004] The mitochondrial genome is a compact yet critical sequence of nucleic acids. Mitochondrial DNA, or "mtDNA”, comprises a small genome of 16,569 nucleic acid base pairs (bp) (Anderson et al., 1981 ; Andrews et al., 1999) in contrast to the immense nuclear genome of 3.3 billion bp (haploid). Its genetic complement is substantially smaller than that of its nuclear cell mate (0.0005%).
- Mitochondrial Proteome About 3,000 nuclear genes are required to construct, operate and maintain mitochondria, with only thirty-seven of these coded by the mitochondrial genome, indicating heavy mitochondrial dependence on nuclear loci.
- the mitochondrial genome codes for a complement of 24 genes, including 2 rRNAs and 22 tRNAs that ensure correct translation of the remaining 13 genes which are vital to electron transport (see Figure 1).
- the mitochondrial genome is dependent on seventy nuclear encoded proteins to accomplish the oxidation and reduction reactions necessary for this vital function, in addition to the thirteen polypeptides supplied by the mitochondrial genome.
- Mitochondrial Fusion Transcriptome/Proteome The mitochondrial genome is unusual in that it is a circular, intron-less DNA molecule. The genome is interspersed with repeat motifs which flank specific lengths of sequences. Sequences between these repeats are prone to deletion under circumstances which are not well understood. Given the number of repeats in the mitochondrial genome, there are many possible deletions.
- mtDNA deletions can have severe consequences on the cell's ability to produce energy in the form of ATP as a result of missing gene sequences necessary for cellular respiration, it is not anticipated that these deleted mitochondrial molecules may be a component of downstream pathways, have an intended functional role, and possibly may be more aptly viewed as alternate natural forms of the recognized genes of the mitochondria. [0009]
- the sequence dynamics of mtDNA are important diagnostic tools. Mutations in mtDNA are often preliminary indicators of developing disease. For example, it has been demonstrated that point mutations in the mitochondrial genome are characteristic of tumour foci in the prostate. This trend also extends to normal appearing tissue both adjacent to and distant from tumour tissue (Parr et al. 2006).
- mitochondrial mutations occur early in the malignant transformation pathway.
- the frequency of a 3.4kb mitochondrial deletion has excellent utility in discriminating between benign and malignant prostate tissues (Maki et al. 2008).
- an investigation of the disease associated deletions and the novel sequences, created through re-closure of the molecule identifies many open reading frames, suggesting the possibility of unique mitochondrial fusion proteins.
- Mitochondrial fusion transcripts have been reported previously in the literature, first in soybeans (Morgens et al. 1984) and then later in two patients with Kearns-Sayre Syndrome, a rare neuromuscular disorder (Nakase et al 1990).
- Nuclear Fusion Proteome There is important nuclear precedence for fusion proteins and their resulting effects on cancer. Nuclear MLL gene partner translocations are well established in correlation with high risk acute leukemia and therapy-related acute myeloid leukemias following treatment with agents that target topoisomerase Il (Libura et al., 2005). Currently, around 50 translocations of the human MLL gene are known to be associated with these cancers (Meyer et al., 2005). Break points for these mutations, whether partial tandem duplications or translocations, for the majority of these events, occur within nuclear specific repetitive motifs such as AIu I.
- Mitochondrial fusion proteins may be assumed to have similar attributes to nuclear fusion proteins, especially since mitochondria and mitochondrial proteins play similar roles in signalling and apoptosis.
- An object of the present invention to provide aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor.
- an isolated mitochondrial fusion transcript associated with cancer In accordance with an aspect of the invention, there is provided an isolated mtDNA encoding a fusion transcript of the invention.
- a hybridization probe having a nucleic acid sequence complementary to at least a portion of a mitochondrial fusion transcript or an mtDNA of the invention.
- a method of detecting a cancer in a mammal comprising assaying a tissue sample from the mammal for the presence of at least one mitochondrial fusion transcript associated with cancer by hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of a mitochondrial fusion transcript according to the invention.
- a method of detecting a cancer in a mammal comprising assaying a tissue sample from the mammal for the presence of at least one aberrant mtDNA associated with cancer by hybridizing the sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of an mtDNA according to the invention.
- a kit for conducting an assay for detecting the presence of a cancer in a mammal said kit comprising at least one hybridization probe complementary to at least a portion of a fusion transcript or an mtDNA of the invention.
- a mitochondrial fusion protein the protein having an amino acid sequence resulting from the translation of a mitochondrial fusion transcript of the invention.
- a method of detecting a cancer in a mammal comprising assaying a tissue sample from the mammal for the presence of at least one mitochondrial fusion protein, the protein having an amino acid sequence resulting from the translation of a mitochondrial fusion transcript according to the invention.
- Figure 1 is an illustration showing mitochondrial protein coding genes.
- Figure 2 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 3.4kb deletion.
- Figure 3 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 4977kb common deletion.
- Figure 4 shows polyadenalated fusion transcripts in breast samples invoked by the loss of the 3.4 kb segment from the mtgenome.
- Figures 5a and 5b show an example of a mitochondrial DNA region before and after splicing of genes.
- Figures 6a to 6g illustrate the results for transcripts 2, 3, 8, 9, 10, 11 and 12 of the invention in the identification of colorectal cancer tumours.
- Figures 7a to 7d illustrate the results for transcripts 6, 8, 10 and 20 of the invention in the identification of lung cancer tumours.
- Figures 8a to 8j illustrate the results for transcripts 6, 10, 11 , 14, 15, 16 and 20 of the invention in the identification of melanomas.
- Figures 9a to 9h illustrate the results for transcripts 1 , 2, 3, 6, 11 , 12, 15 and 20 of the invention in the identification of ovarian cancer.
- Figures 10 to 18 illustrate the results for transcripts 2, 3, 4, 11 , 12, 13, 15, 16 and 20 of the invention in the identification of testicular cancer.
- Figure 19 illustrates the SDS PAGE gel of cytosolic and mitochondrial fractions of RWPE1 and WPE1-NA22 celll lines conducted during the fusion protein discovery phase.
- Figure 20a illustrates the identified protein of fusion transcript P0026 based on the peptides ILYMTDEVNDPSLT ⁇ K and STPYECGFDPMSP.
- Figure 20b illustrates the wild-type CO2 protein identified in mitochondrial NA22 cell line gel slice 5 of Figure 19 after searching the Human (SwissProt) database.
- Figure 21 a illustrates the identified protein of fusion transcript P0062 based on the peptides KGPNVVGPYGLLQPFADAMK, YDQLM HLLWK and LITTQQWLIK.
- Figure 21 b illustrates the identified peptides of ND1 identified in gel slice 5 of Figure 19 after searching the Human (SwissProt) database.
- Figure 22 illustrates the identified protein of fusion transcript P0064 based on the peptides KGPNVVGPYGLLQPFADAMK and WAIIEEFTK.
- Figure 23a illustrates the identified protein of fusion transcript P0176 based on the peptides KGPNVVGPYGLLQPFADAMK, VFSWLATLHGSNMK and VLMVEEPSMNLEWLYGCPPPYHTFEEPVYMK.
- Figure 23b illustrates the wild-type CO1 protein identified in mitochondrial NA22 cell line gel slice 4 of Figure 19 after searching the Human (SwissProt) database.
- Figures 24a to 24d illustrate the results of quantitative measurements of fusion transcripts P0026, P0062, P0064 and P0176, respectively.
- the present invention provides novel mitochondrial fusion transcripts, the parent mutated mtDNA molecules, and the resulting translation products that are useful for predicting, diagnosing and/or monitoring cancer.
- the invention further provides hybridization probes for the detection of fusion transcripts and associated mtDNA molecules and the use of such probes.
- biological sample refers to a tissue or bodily fluid containing cells from which a molecule of interest can be obtained.
- the biological sample can be derived from tissue such as prostate, breast, colorectal, lung and skin, or from blood, saliva, cerebral spinal fluid, sputa, urine, mucous, synovial fluid, peritoneal fluid, amniotic fluid and the like.
- the biological sample may be a surgical specimen or a biopsy specimen.
- the biological sample can be used either directly as obtained from the source or following a pre-treatment to modify the character of the sample.
- the biological sample can be pre-treated prior to use by, for example, preparing plasma or serum from blood, disrupting cells, preparing liquids from solid materials, diluting viscous fluids, filtering liquids, distilling liquids, concentrating liquids, inactivating interfering components, adding reagents, and the like.
- a "continuous" transcript is a fusion transcript that keeps the reading frame from the beginning to the end of both spliced genes.
- An “end” transcript is a fusion transcript that results in a premature termination codon before the original termination codon of a second spliced gene.
- mitochondria DNA present in mitochondria.
- mitochondria DNA
- an in-frame protein may be translated from alternate initiation and termination codons within that sequence.
- mitochondrial fusion transcript or “fusion transcript” refers to an RNA transcription product produced as a result of the transcription of a mutated mitochondrial DNA sequence wherein such mutations may comprise mitochondrial deletions and other large-scale mitochondrial DNA rearrangements.
- mitochondrial translation product or “translation product” refers to any amino acid chain derived from a mitochondrial fusion transcript including peptides, polypeptides and proteins. It will be understood that "mitochondrial translation products" comprise "fusion proteins", as defined above.
- mtDNA Mitochondrial DNA
- mtDNA dynamics are an important diagnostic tool. Mutations in mtDNA are often preliminary indicators of developing disease and may act as biomarkers indicative of risk factors associated with disease onset. According to the present invention, mutations in the mitochondrial genome result in the generation of fusion transcripts associated with cancer. Thus, the use of mtDNA encoding such transcripts and probes directed thereto for the detection, diagnosis and monitoring of cancer is provided.
- mtDNA molecules for use in the methods of the present invention may be derived through the isolation of naturally-occurring mutants or may be based on the complementary sequence of any of the fusion transcripts described herein.
- Mutant mtDNA sequences according to the present invention may comprise any modification that results in the generation of a fusion transcript.
- Non-limiting examples of such modifications include insertions, translocations, deletions, duplications, recombinations, rearrangements or combinations thereof. While the modification or change can vary greatly in size from only a few bases to several kilobases, preferably the modification results in a substantive deletion or other large-scale genomic aberration.
- Extraction of DNA to detect the presence of such mutations may take place using art- recognized methods, followed by amplification of all or a region of the mitochondrial genome, and may include sequencing of the mitochondrial genome, as described in Current Protocols in Molecular Biology.
- the step of detecting the mutations can be selected from any technique known in the art.
- analyzing mtDNA can comprise sequencing the mtDNA, amplifying mtDNA by PCR, Southern, Northern, Western South-Western blot hybridizations, denaturing HPLC, hybridization to microarrays, biochips or gene chips, molecular marker analysis, biosensors, melting temperature profiling or a combination of any of the above.
- Any suitable means to sequence mitochondrial DNA may be used.
- mtDNA is amplified by PCR prior to sequencing.
- the method of PCR is well known in the art and may be performed as described in MuIMs and Faloona, 1987, Methods Enzymol., 155: 335.
- PCR products can be sequenced directly or cloned into a vector which is then placed into a bacterial host. Examples of DNA sequencing methods are found in Brumley, R. L. Jr. and Smith, L. M., 1991 , Rapid DNA sequencing by horizontal ultrathin gel electrophoresis, Nucleic Acids Res. 19:4121-4126 and Luckey, J.A., et al, 1993, High speed DNA sequencing by capillary gel electrophoresis, Methods Enzymol.
- the primer can be prepared using conventional solid-phase synthesis using commercially available equipment, such as that available from Applied Biosystems USA Inc. (Foster City, California), DuPont, (Wilmington, Del.), or Milligen (Bedford, Mass.).
- a junction point of a sequence deletion is first identified. Sequence deletions are primarily identified by direct and indirect repetitive elements which flank the sequence to be deleted at the 5' and 3' end. The removal of a section of the nucleotides from the genome followed by the ligation of the genome results in the creation of a novel junction point. [0069] Upon identification of the junction point, the nucleotides of the genes flanking the junction point are determined in order to identify a spliced gene. Typically the spliced gene comprises the initiation codon from the first gene and the termination codon of the second gene, and may be expressed as a continuous transcript, i.e.
- mtDNA molecules for use in the methods of the present invention are provided below. These mtDNAs are based on modifications of the known mitochondrial genome (SEQ ID NO: 1) and have been assigned a fusion or "FUS" designation, wherein A:B represents the junction point between the last mitochondrial nucleotide of the first spliced gene and the first mitochondrial nucleotide of the second spliced gene.
- variant refers to a nucleic acid differing from an mtDNA sequence of the present invention, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to a select mtDNA sequence. Specifically, the variants of the present invention comprise at least one of the nucleotides of the junction point of the spliced genes, and may further comprise one or more nucleotides adjacent thereto. In one embodiment of the invention, the variant sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to any one of the mtDNA sequences of the invention, or the complementary strand thereto.
- fragment refers to a short nucleic acid sequence which is a portion of that contained in the disclosed genomic sequences, or the complementary strand thereto. This portion includes at least one of the nucleotides comprising the junction point of the spliced genes, and may further comprise one or more nucleotides adjacent thereto.
- the fragments of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length.
- a fragment "at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases of any one of the mtDNA sequences listed above.
- “about” includes the particularly recited value, a value larger or smaller by several (5, 4, 3, 2, or 1) nucleotides, at either terminus or at both termini.
- These fragments have uses that include, but are not limited to, as diagnostic probes and primers as discussed herein. Of course, larger fragments (e.g., 50, 150, 500, 600, 2000 nucleotides) are also contemplated.
- the mtDNA sequences are selected from the group consisting of: [0093] SEQ ID NO: 2 (FUS 8469:13447; AltMet) [0094] SEQ ID NO: 3 (FUS 10744:14124) [0095] SEQ ID NO: 4 (FUS 7974:15496) [0096] SEQ ID NO: 5 (FUS 7992:15730) [0097] SEQ ID NO: 6 (FUS 8210:15339) [0098] SEQ ID NO: 7 (FUS 8828:14896) [0099] SEQ ID NO: 8 (FUS 10665:14856) [00100] SEQ ID NO: 9 (FUS 6075:13799) [00101] SEQ ID NO: 10 (FUS 6325:13989) [00102] SEQ ID NO: 11 (FUS 7438:13476) [00103] SEQ ID NO: 12 (FUS 7775:13532) [00104]
- Probes Another aspect of the invention is to provide a hybridization probe capable of recognizing an aberrant mtDNA sequence of the invention.
- the term "probe” refers to an oligonucleotide which forms a duplex structure with a sequence in the target nucleic acid, due to complementarity of at least one sequence in the probe with a sequence in the target region.
- the probe may be labeled, according to methods known in the art.
- hybridization of mtDNA to, for example, an array of oligonucleotides can be used to identify particular mutations, however, any known method of hybridization may be used.
- probes may be generated directly against exemplary mtDNA fusion molecules of the invention, or to a fragment or variant thereof.
- sequences set forth in SEQ ID NOs: 2-18 and 54 and those disclosed in Table 1 can be used to design primers or probes that will detect a nucleic acid sequence comprising a fusion sequence of interest.
- primers or probes which hybridize to these nucleic acid molecules may do so under highly stringent hybridization conditions or lower stringency conditions, such conditions known to those skilled in the art and found, for example, in Current Protocols in Molecular Biology (John Wiley & Sons, New York (1989)), 6.3.1-6.3.6.
- the probes of the invention contain a sequence complementary to at least a portion of the aberrant mtDNA comprising the junction point of the spliced genes. This portion includes at least one of the nucleotides involved in the junction point A:B, and may further comprise one or more nucleotides adjacent thereto.
- the present invention encompasses any suitable targeting mechanism that will select an mtDNA molecule using the nucleotides involved and/or adjacent to the junction point A:B.
- Various types of probes known in the art are contemplated by the present invention.
- the probe may be a hybridization probe, the binding of which to a target nucleotide sequence can be detected using a general DNA binding dye such as ethidium bromide, SYBR ® Green, SYBR ® Gold and the like.
- the probe can incorporate one or more detectable labels. Detectable labels are molecules or moieties a property or characteristic of which can be detected directly or indirectly and are chosen such that the ability of the probe to hybridize with its target sequence is not affected. Methods of labelling nucleic acid sequences are well-known in the art (see, for example, Ausubel et al., (1997 & updates) Current Protocols in Molecular Biology, Wiley & Sons, New York).
- Labels suitable for use with the probes of the present invention include those that can be directly detected, such as radioisotopes, fluorophores, chemiluminophores, enzymes, colloidal particles, fluorescent microparticles, and the like.
- directly detectable labels may require additional components, such as substrates, triggering reagents, light, and the like to enable detection of the label.
- the present invention also contemplates the use of labels that are detected indirectly.
- the probes of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length.
- a probe of "at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases that are complementary to an mtDNA sequence of the invention. Of course, larger probes (e.g., 50, 150, 500, 600, 2000 nucleotides) may be preferable.
- the probes of the invention will also hybridize to nucleic acid molecules in biological samples, thereby enabling the methods of the invention. Accordingly, in one aspect of the invention, there is provided a hybridization probe for use in the detection of cancer, wherein the probe is complementary to at least a portion of an aberrant mtDNA molecule. In another aspect the present invention provides probes and a use of (or a method of using) such probes for the detection of colorectal cancer, lung cancer, breast cancer, ovarian cancer, testicular, cancer, prostate cancer and/or melanoma skin cancer. [00121] Assays [00122] Measuring the level of aberrant mtDNA in a biological sample can determine the presence of one or more cancers in a subject.
- the present invention encompasses methods for predicting, diagnosing or monitoring cancer, comprising obtaining one or more biological samples, extracting mtDNA from the samples, and assaying the samples for aberrant mtDNA by: quantifying the amount of one or more aberrant mtDNA sequences in the sample and comparing the quantity detected with a reference value.
- the reference value is based on whether the method seeks to predict, diagnose or monitor cancer. Accordingly, the reference value may relate to mtDNA data collected from one or more known non-cancerous biological samples, from one or more known cancerous biological samples, and/or from one or more biological samples taken over time.
- the invention provides a method of detecting cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of an aberrant mitochondrial DNA described above.
- the present invention also provides for methods comprising assaying a tissue sample from the mammal by hybridizing the sample with at least one hybridization probe.
- the probe may be generated against a mutant mitochondrial DNA sequence of the invention as described herein.
- the invention provides a method as above, wherein the assay comprises: a) conducting a hybridization reaction using at least one of the probes to allow the at least one probe to hybridize to a complementary aberrant mitochondrial DNA sequence; b) quantifying the amount of the at least one aberrant mitochondrial DNA sequence in the sample by quantifying the amount of the mitochondrial DNA hybridized to the at least one probe; and, c) comparing the amount of the mitochondrial DNA in the sample to at least one known reference value.
- Also included in the present invention are methods for predicting, diagnosing or monitoring cancer comprising diagnostic imaging assays as described below.
- the diagnostic assays of the invention can be readily adapted for high-throughput.
- High-throughput assays provide the advantage of processing many samples simultaneously and significantly decrease the time required to screen a large number of samples.
- the present invention contemplates the use of the nucleotides of the present invention in high-throughput screening or assays to detect and/or quantitate target nucleotide sequences in a plurality of test samples.
- Fusion Transcripts [00127] The present invention further provides the identification of fusion transcripts and associated hybridization probes useful in methods for predicting, diagnosing and/or monitoring cancer.
- fusion transcripts and associated hybridization probes useful in methods for predicting, diagnosing and/or monitoring cancer.
- One of skill in the art will appreciate that such molecules may be derived through the isolation of naturally-occurring transcripts or, alternatively, by the recombinant expression of mtDNAs isolated according to the methods of the invention.
- fusion transcripts derived therefrom comprise a junction point associated with the spliced genes.
- Naturally occurring fusion transcripts can be extracted from a biological sample and identified according to any suitable method known in the art, or may be conducted according to the methods described in the examples.
- stable polyadenylated fusion transcripts are identified using Oligo(dT) primers that target transcripts with poly-A tails, followed by RT-PCR using primer pairs designed against the target transcript.
- fusion transcripts were detected using such methods and found useful in predicting, diagnosing and/or monitoring cancer as indicated in the examples.
- fusion transcripts derived from the ORF sequences identified in Table 1 may be useful in predicting, diagnosing and/or monitoring cancer.
- SEQ ID NO: 19 (Transcript 1 ; 8469:13447; AltMet) [00132] SEQ ID NO: 20 (Transcript 2;10744:14124) [00133] SEQ ID NO: 21 (Transcript 3;7974: 15496) [00134] SEQ ID NO: 22 (Transcript 4;7992:15730) [00135] SEQ ID NO: 23 (Transcript 5;8210:15339) [00136] SEQ ID NO: 24 (Transcript 6;8828: 14896) [00137] SEQ ID NO: 25 (Transcript 7;10665:14856) [00138] SEQ ID NO: 26 (Transcript 8;6075: 13799) [00139] SEQ ID NO: 27 (Transcript 9;6325: 13989) [00140] SEQ ID NO: 28 (Transcript 10;7438:13476) [00141] SEQ ID NO: 29 (Transcript 11 ;7775:13532) [00142] SEQ I D NO: 30 (Transcript 12;
- fusion transcripts are also provided. Such sequences may adhere to the size limitations and percent identities described above with respect to genomic variants and fragments, or as determined suitable by a skilled technician.
- Probes [00152] Once a fusion transcript has been characterized, primers or probes can be developed to target the transcript in a biological sample. Such primers and probes may be prepared using any known method (as described above) or as set out in the examples provided below.
- a probe may, for example, be generated for the fusion transcript, and detection technologies, such as QuantiGene 2.0TM by Panomics TM, used to detect the presence of the transcript in a sample.
- Primers and probes may be generated directly against exemplary fusion transcripts of the invention, or to a fragment or variant thereof.
- the sequences set forth in SEQ ID NOs: 19-35 and 53, as well as those disclosed in Table 1 can be used to design probes that will detect a nucleic acid sequence comprising a fusion sequence of interest.
- probes designed to hybridize to the fusion transcripts of the invention contain a sequence complementary to at least a portion of the transcript expressing the junction point of the spliced genes.
- This portion includes at least one of the nucleotides complementary to the expressed junction point, and may further comprise one or more complementary nucleotides adjacent thereto.
- the present invention encompasses any suitable targeting mechanism that will select a fusion transcript that uses the nucleotides involved and adjacent to the junction point of the spliced genes.
- the transcript probes of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length.
- a probe of "at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases that are complementary to an mtDNA sequence of the invention. Of course, larger probes (e.g., 50, 150, 500, 600, 2000 nucleotides) may be preferable.
- the invention provides a hybridization probe for use in the detection of cancer, wherein the probe is complementary to at least a portion of a mitochondrial fusion transcript provided above.
- the present invention provides probes and a use of (or a method of using) such probes for the detection of colorectal cancer, lung cancer, breast cancer, ovarian cancer, testicular cancer, prostate cancer or melanoma skin cancer.
- Assays Measuring the level of mitochondrial fusion transcripts in a biological sample can determine the presence of one or more cancers in a subject.
- the present invention therefore, provides methods for predicting, diagnosing or monitoring cancer, comprising obtaining one or more biological samples, extracting mitochondrial RNA from the samples, and assaying the samples for fusion transcripts by: quantifying the amount of one or more fusion transcripts in the sample and comparing the quantity detected with a reference value.
- the reference value is based on whether the method seeks to predict, diagnose or monitor cancer. Accordingly, the reference value may relate to transcript data collected from one or more known non-cancerous biological samples, from one or more known cancerous biological samples, and/or from one or more biological samples taken over time.
- the invention provides a method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from said mammal for the presence of at least one fusion transcript of the invention by hybridizing said sample with at least one hybridization probe having a nucleic acid sequence complementary to at least a portion of the mitochondrial fusion transcript.
- the invention provides a method as above, wherein the assay comprises: [00161] a) conducting a hybridization reaction using at least one of the above-noted probes to allow the at least one probe to hybridize to a complementary mitochondrial fusion transcript; [00162] b) quantifying the amount of the at least one mitochondrial fusion transcript in the sample by quantifying the amount of the transcript hybridized to the at least one probe; and, [00163] c) comparing the amount of the mitochondrial fusion transcript in the sample to at least one known reference value.
- the diagnostic assays of the invention may also comprise diagnostic imaging methods as described herein and can be readily adapted for high-throughput.
- the present invention contemplates the use of the fusion transcripts and associated probes of the present invention in high-throughput screening or assays to detect and/or quantitate target nucleotide sequences in a plurality of test samples.
- Translation Products [00166] To date, mitochondrial fusion proteins have not been detected or isolated. However, the levels of mitochondrial fusion transcripts observed from the examples provided below and the indications that they are polyadenylated provide further evidence supporting the existence of such mitochondrial fusion proteins. Accordingly, the present invention provides the identification of fusion proteins for predicting, diagnosing, and/or monitoring of cancer.
- Fusion proteins contemplated for use in the disclosed methods may be derived through the isolation of naturally-occurring polypeptides or through gene expression.
- polypeptides can be prepared by methods known in the art, such as purification from cell extracts or the use of recombinant techniques.
- Putative protein sequences corresponding to transcripts 1-17 and 20 are provided below along with their respective sequence identifier. These, as well as the putative protein sequences corresponding to the deletion sequences disclosed in Table 1 , are herein contemplated for use in the methods of the present invention.
- SEQ ID NO: 36 Transcripts 1 [00170] SEQ ID NO: 37 (Transcript 2) [00171] SEQ ID NO: 38 (Transcript 3) [00172] SEQ ID NO: 39 (Transcript 4) [00173] SEQ ID NO: 40 (Transcript 5) [00174] SEQ ID NO: 41 (Transcript 6) [00175] SEQ ID NO: 42 (Transcript 7) [00176] SEQ ID NO: 43 (Transcript 8) [00177] SEQ ID NO: 44 (Transcript 9) [00178] SEQ ID NO: 45 (Transcript 10) [00179] SEQ ID NO: 46 (Transcript 11) [00180] SEQ ID NO: 47 (Transcript 12) [00181] SEQ ID NO: 48 (Transcript 14) [00182] SEQ ID NO: 49 (Transcript 15) [00183] SEQ ID NO: 50 (Transcript 16) [00184] SEQ ID NO: 51 (Transcript 17) [00185] SEQ ID NO: 52 (Transcripts 20)
- HPLC high performance liquid chromatography
- Assaying fusion protein levels in a biological sample can occur using a variety of techniques. For example, protein expression in tissues can be studied with classical immunohistological methods (Jalkanen et al., J. Cell. Biol. 101 :976-985 (1985 ); Jalkanen, M., et al., J. Cell. Biol. 105:3087-3096 (1987 )). Other methods useful for detecting protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine ( ⁇ 125> I, ⁇ 121 > I), carbon ( ⁇ 14> C), sulfur ( ⁇ 35> S), tritium ( ⁇ 3> H), indium ( ⁇ 112> In), and technetium ( ⁇ 99m> Tc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase, and radioisotopes, such as iodine ( ⁇ 125> I, ⁇ 121 > I), carbon ( ⁇ 14> C), sulfur ( ⁇ 35> S), tritium ( ⁇ 3> H), indium ( ⁇ 112> In), and technetium ( ⁇ 99m> Tc)
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- Protein specific antibodies for use in the assays of the present invention can be raised against the wild-type or expressed mitochondrial fusion proteins of the invention or an antigenic polypeptide fragment thereof, which may be presented together with a carrier protein, such as an albumin, to an animal system (such as rabbit or mouse) or, if it is long enough (at least about 25 amino acids), without a carrier.
- a carrier protein such as an albumin
- antibody As used herein, the term "antibody” (Ab) or “monoclonal antibody” (Mab) is meant to include intact molecules as well as antibody fragments, or antigen-binding fragments, thereof (such as, for example, Fab and F(ab')2 fragments) which are capable of specifically binding to, or having "specificity to", a mitochondrial fusion protein.
- Fab and F(ab')2 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). Thus, these fragments are preferred.
- the antibodies of the present invention may be prepared by any of a variety of methods. For example, cells expressing the mitochondrial fusion protein or an antigenic fragment thereof can be administered to an animal in order to induce the production of sera containing polyclonal antibodies. In one method, a preparation of mitochondrial fusion protein is prepared and purified to render it substantially free of natural contaminants. Such a preparation is then introduced into an animal in order to produce polyclonal antisera of greater specific activity. [00195] In a related method, the antibodies of the present invention are monoclonal antibodies. Such monoclonal antibodies can be prepared using hybridoma technology (Kohler et al., Nature 256:495 (1975); Kohler et al., Eur. J. Immunol.
- the present invention comprises immunological assays using antibodies or antigen- binding fragments having specificity to the fusion proteins described herein.
- kits containing the antibodies or antigen-binding fragments may be facilitated by kits containing the antibodies or antigen-binding fragments along with any other necessary reagents, test strips, materials, instructions etc.
- Assays Measuring the level of a translation product such as a fusion protein in a biological sample can determine the presence of one or more cancers in a subject.
- the present invention therefore, provides methods for predicting, diagnosing or monitoring cancer, comprising obtaining one or more biological samples, extracting mitochondrial fusion proteins from the samples, and assaying the samples for such molecules by: quantifying the amount of one or more molecules in the sample and comparing the quantity detected with a reference value.
- the reference value is based on whether the method seeks to predict, diagnose or monitor cancer. Accordingly, the reference value may relate to protein data collected from one or more known non-cancerous biological samples, from one or more known cancerous biological samples, and/or from one or more biological samples taken over time.
- Techniques for quantifying proteins in a sample include, for instance, classical immunohistological methods (Jalkanen et al., J. Cell. Biol. 101 :976-985 (1985 ); Jalkanen, M., et al., J. Cell. Biol. 105:3087-3096 (1987 )).
- the invention provides a method of detecting a cancer in a mammal, the method comprising assaying a tissue sample from the mammal for the presence of at least one mitochondrial fusion protein.
- the present invention provides for the detection of mitochondrial fusion proteins in the diagnosis of colorectal cancer, lung cancer, breast cancer, ovarian cancer, testicular cancer, prostate cancer and/or melanoma skin cancer.
- the invention includes diagnostic devices such as biochips, gene chips or microarrays used to diagnose specific diseases or identify specific mutations. All sequenced mitochondrial genomes are assessed to create a consenus structure of the base pair arrangement and are assigned a prohibiting index for proportion of base pair deletions and mutations associated with a particular disease or disorder. The diagnostic arrangement is then used to create biochips, gene chips, or microarrays. [00204] Once sequences associated with particular diseases, disease states or disorders are identified, hybridization of a mitochondrial nucleotide sample to an array of oligonucleotides can be used to identify particular mutations. Any known method of hybridization may be used.
- an array which has oligonucleotide probes matching the wild type or mutated region, and a control probe.
- arrays such as microarrays or gene chips are suitable. These arrays contain thousands of matched and control pairs of probes on a slide or microchip, and are capable of sequencing the entire genome very quickly. Review articles describing the use of microarrays in genome and DNA sequence analysis are available on-line.
- Microarray Polynucleotide arrays provide a high throughput technique that can assay a large number of polynucleotides in a sample comprising one or more target nucleic acid sequences.
- the arrays of the invention are useful for gene expression analysis, diagnosis of disease and prognosis of disease (e.g., monitoring a patient's response to therapy, and the like).
- Any combination of the polynucleotide sequences of mtDNA indicative of disease, or disease progression are used for the construction of a microarray.
- the target nucleic acid samples to be analyzed using a microarray are derived from any human tissue or fluid which contains adequate amounts of mtDNA, as previously described.
- the target nucleic acid samples are contacted with polynucleotide members under hybridization conditions sufficient to produce a hybridization pattern of complementary nucleic acid members/target complexes.
- the microarray comprises a plurality of unique polynucleotides attached to one surface of a solid support, wherein each of the polynucleotides is attached to the surface of the solid support in a non-identical preselected region.
- Each associated sample on the array comprises a polynucleotide composition, of known identity, usually of known sequence, as described in greater detail below. Any conceivable substrate may be employed in the invention.
- the array is constructed using any known means.
- the nucleic acid members may be produced using established techniques such as polymerase chain reaction (PCR) and reverse transcription (RT). These methods are similar to those currently known in the art (see e.g. PCR Strategies, Michael A.
- Amplified polynucleotides are purified by methods well known in the art (e.g., column purification).
- a polynucleotide is considered pure when it has been isolated so as to be substantially free of primers and incomplete products produced during the synthesis of the desired polynucleotide.
- a purified polynucleotide will also be substantially free of contaminants which may hinder or otherwise mask the binding activity of the molecule.
- the polynucleotide compositions are stably associated with the surface of a solid support, wherein the support may be a flexible or rigid solid support.
- a solid support to which a nucleic acid member may be attached may be used in the invention.
- suitable solid support materials include, but are not limited to, silicates such as glass and silica gel, cellulose and nitrocellulose papers, nylon, polystyrene, polymethacrylate, latex, rubber, and fluorocarbon resins such as TEFLONTM.
- the solid support material may be used in a wide variety of shapes including, but not limited to slides and beads. Slides provide several functional advantages and thus are a preferred form of solid support.
- RNA and/or DNA immobilized on the solid support Due to their flat surface, probe and hybridization reagents are minimized using glass slides. Slides also enable the targeted application of reagents, are easy to keep at a constant temperature, are easy to wash and facilitate the direct visualization of RNA and/or DNA immobilized on the solid support. Removal of RNA and/or DNA immobilized on the solid support is also facilitated using slides. [00215]
- the particular material selected as the solid support is not essential to the invention, as long as it provides the described function. Normally, those who make or use the invention will select the best commercially available material based upon the economics of cost and availability, the expected application requirements of the final product, and the demands of the overall manufacturing process.
- nucleic acid members of the invention Numerous methods are used for attachment of the nucleic acid members of the invention to the substrate (a process referred as spotting).
- polynucleotides are attached using the techniques of, for example U.S. Pat. No. 5,807,522, which is incorporated herein by reference for teaching methods of polymer attachment.
- spotting is carried out using contact printing technology.
- the amount of polynucleotide present in each composition will be sufficient to provide for adequate hybridization and detection of target polynucleotide sequences during the assay in which the array is employed.
- the amount of each nucleic acid member stably associated with the solid support of the array is at least about 0.1 ng, preferably at least about 0.5 ng and more preferably at least about 1 ng, where the amount may be as high as 1000 ng or higher, but will usually not exceed about 20 ng.
- Control polynucleotides may be spotted on the array and used as target expression control polynucleotides and mismatch control nucleotides to monitor non-specific binding or cross-hybridization to a polynucleotide in the sample other than the target to which the probe is directed. Mismatch probes thus indicate whether a hybridization is specific or not.
- Target Preparation may be derived from one or more biological samples. It may be desirable to amplify the target nucleic acid sample prior to hybridization. One of skill in the art will appreciate that whatever amplification method is used, if a quantitative result is desired, care must be taken to use a method that maintains or controls for the relative frequencies of the amplified polynucleotides. Methods of "quantitative" amplification are well known to those of skill in the art.
- PCR For example, quantitative PCR involves simultaneously co- amplifying a known quantity of a control sequence using the same primers. This provides an internal standard that may be used to calibrate the PCR reaction. The high density array may then include probes specific to the internal standard for quantification of the amplified polynucleotide.
- PCR Protocols A Guide to Methods and Applications, lnnis et al., Academic Press, Inc. N.Y., (1990).
- Other suitable amplification methods include, but are not limited to polymerase chain reaction (PCR) (lnnis, et al., PCR Protocols. A guide to Methods and Application. Academic Press, Inc.
- LCR ligase chain reaction
- any analytically detectable marker that is attached to or incorporated into a molecule may be used in the invention.
- An analytically detectable marker refers to any molecule, moiety or atom which is analytically detected and quantified.
- Detectable labels suitable for use in the present invention include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
- Useful labels in the present invention include biotin for staining with labeled streptavidin conjugate, magnetic beads (e.g., DynabeadsTM), fluorescent dyes (e.g., fluorescein, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3H, 1251, 35S, 14C, or 32P), enzymes (e.g., horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads.
- Patents teaching the use of such labels include U.S.
- radiolabels may be detected using photographic film or scintillation counters
- fluorescent markers may be detected using a photodetector to detect emitted light
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
- the labels may be incorporated by any of a number of means well known to those of skill in the art.
- the label is simultaneously incorporated during the amplification step in the preparation of the sample polynucleotides.
- PCR polymerase chain reaction
- labeled primers or labeled nucleotides will provide a labeled amplification product.
- transcription amplification as described above, using a labeled nucleotide (e.g. fluorescein-labeled UTP and/or CTP) incorporates a label into the transcribed polynucleotides.
- a labeled nucleotide e.g. fluorescein-labeled UTP and/or CTP
- a label may be added directly to the original polynucleotide sample (e.g., mRNA, polyA mRNA, cDNA, etc.) or to the amplification product after the amplification is completed.
- Means of attaching labels to polynucleotides are well known to those of skill in the art and include, for example nick translation or end-labeling (e.g. with a labeled RNA) by kinasing of the polynucleotide and subsequent attachment (ligation) of a polynucleotide linker joining the sample polynucleotide to a label (e.g., a fluorophore).
- the target will include one or more control molecules which hybridize to control probes on the microarray to normalize signals generated from the microarray.
- Labeled normalization targets are polynucleotide sequences that are perfectly complementary to control oligonucleotides that are spotted onto the microarray as described above.
- the signals obtained from the normalization controls after hybridization provide a control for variations in hybridization conditions, label intensity, "reading" efficiency and other factors that may cause the signal of a perfect hybridization to vary between arrays.
- Image Acquisition and Data Analysis [00226] Following hybridization and any washing step(s) and/or subsequent treatments of a conventional nature, the resultant hybridization pattern is detected.
- the intensity or signal value of the label will be not only be detected but quantified, by which is meant that the signal from each spot of the hybridization will be measured and compared to a unit value corresponding to the signal emitted by a known number of end labeled target polynucleotides to obtain a count or absolute value of the copy number of each end-labeled target that is hybridized to a particular spot on the array in the hybridization pattern.
- data analysis can include the steps of determining fluorescent intensity as a function of substrate position from the data collected, removing outliers, i.e., data deviating from a predetermined statistical distribution, and calculating the relative binding affinity of the test polynucleotides from the remaining data.
- the resulting data is displayed as an image with the intensity in each region varying according to the binding affinity between associated oligonucleotides and/or polynucleotides and the test polynucleotides.
- the hybridization pattern is used to determine quantitative information about the genetic profile of the labeled target polynucleotide sample that was contacted with the array to generate the hybridization pattern, as well as the state or condition of the tissue, fluid, organs, cell, etc. from which the sample was derived.
- the invention further provides for diagnostic tests for detecting cancer.
- the invention also provides for monitoring a patient's condition. According to the method of the invention, the presence of cancer is detected by obtaining a biological sample from a patient. A test sample comprising nucleic acid is prepared from the biological sample.
- the nucleic acid extracted from the sample is hybridized to an array comprising a solid substrate and a plurality of nucleic acid members, wherein each member is indicative of the presence of disease or a predisposition to cancer.
- hybridization of the sample comprising nucleic acid to one or more nucleic acid members on the array is indicative of cancer or a predisposition to a cancer.
- Diagnostic Monitoring may further comprise the step of recommending a monitoring regime or course of therapy based on the outcome of one or more assays. This allows clinicians to practice personalized medicine; e.g.
- the information can be used to diagnose a pre-cancerous condition or existing cancer condition. Further, by quantitating the amount of aberrant mtDNA in successive samples over time, the progression of a cancer condition can be monitored. For example, data provided by assaying the patient's tissues at one point in time to detect a first set of mutations from wild-type could be compared against data provided from a subsequent assay, to determine if changes in the aberration have occurred.
- the mutation may be indicative of a genetic susceptibility to develop a cancer condition.
- a determination of susceptibility to disease or diagnosis of its presence can further be evaluated on a qualitative basis based on information concerning the prevalence, if any, of the cancer condition in the patient's family history and the presence of other risk factors, such as exposure to environmental factors and whether the patient's cells also carry a mutation of another sort.
- Biological Sample [00235] The present invention provides for diagnostic tests which involve obtaining or collecting one or more biological samples.
- biological sample refers to a tissue or bodily fluid containing cells from which mtDNA, mtRNA and translation products or fusion proteins can be obtained.
- the biological sample can be derived from tissue including, but not limited to, skin, lung, breast, prostate, nervous, muscle, heart, stomach, colon, rectal tissue and the like; or from blood, saliva, cerebral spinal fluid, sputa, urine, mucous, synovial fluid, peritoneal fluid, amniotic fluid and the like.
- the biological sample may be obtained from a cancerous or non-cancerous tissue and may be, but is not limited to, a surgical specimen or a biopsy specimen.
- the biological sample can be used either directly as obtained from the source or following a pre-treatment to modify the character of the sample.
- the biological sample can be pre-treated prior to use by, for example, preparing plasma or serum from blood, disrupting cells, preparing liquids from solid materials, diluting viscous fluids, filtering liquids, distilling liquids, concentrating liquids, inactivating interfering components, adding reagents, and the like.
- preparing plasma or serum from blood disrupting cells
- preparing liquids from solid materials diluting viscous fluids
- filtering liquids distilling liquids
- concentrating liquids inactivating interfering components
- adding reagents and the like.
- more than one sample type may be assayed at a single time (i.e. for the detection of more than one cancer).
- kits for detecting cancer in a clinical environment.
- Such kits may include one or more sampling means, in combination with one or more probes according to the present invention.
- the kit may comprise means for detecting a translation product of the invention.
- kits can optionally include reagents required to conduct a diagnostic assay, such as buffers, salts, detection reagents, and the like.
- Other components such as buffers and solutions for the isolation and/or treatment of a biological sample, may also be included in the kit.
- One or more of the components of the kit may be lyophilised and the kit may further comprise reagents suitable for the reconstitution of the lyophilised components.
- the kit may also contain reaction vessels, mixing vessels and other components that facilitate the preparation of the test sample.
- the kit may also optionally include instructions for use, which may be provided in paper form or in computer-readable form, such as a disc, CD, DVD or the like.
- kits of the present invention may comprise an immunological assay.
- the kits may comprise antibodies or antigen-binding fragments having specificity towards the fusion proteins described herein. It will be understood that various other reagents, test strips etc. required for such immunological assay will be contained in the kits as will the required instructions to users.
- EXAMPLES [00244] Various aspects of the invention will be described by illustration using the following examples. The examples provided herein serve only to illustrate certain specific embodiments of the invention and are not intended to limit the scope of the invention in any way.
- Example 1 Detection of Mitochondrial Fusion Transcripts
- the mitochondrial 4977 "common deletion" and a 3.4kb deletion previously identified by the present Applicant in PCT application no. PCT/CA2007/001711 result in unique open reading frames having active transcripts as identified by oligo-dT selection in prostate tissue ( Figures 2 and 3). Examination of breast tissue samples also reveals the presence of a stable polyadenylated fusion transcript resulting from the 3.4kb deletion ( Figure 4).
- RNA isolation cDNA synthesis [00249] Total RNA was isolated from snap frozen prostate and breast tissue samples (both malignant and normal samples adjacent to tumours) using the AurumTM Total RNA Fatty and Fibrous Tissue kit (Bio-Rad, Hercules, CA) following the manufacturer's instructions. Since in this experiment, genomic DNA contamination was to be avoided, a DNase I treatment step was included, using methods as commonly known in the art. RNA quantity and quality were determined with an ND-1000 spectrophotometer (NanoDrop® technologies).
- RNA concentrations varied from 100 - 1000ng/ul with a 260/280 ratio between 1.89 - 2.10. RNA concentrations were adjusted to 100ng/ul and 2ul of each template were used for first strand DNA synthesis with SuperscriptTM First-Strand Synthesis System for RT-PCR (Invitrogen) following the manufacturer's instructions.
- Oligo(dT) primers that target transcripts with poly-A tails were used.
- PCR [00251] Real time PCR was performed using 5ul of each cDNA template with the iQ TM SYBR ® Green Supermix (Bio-Rad, Hercules, CA) on DNA Engine Opticon ® 2 Continuous Fluorescence Detection System (Bio-Rad, Hercules, CA).
- the primer pairs targeting the 4977bp deletion are; 8416F 5'- CCTTACACTATTCCTCATCAC- 3', 13637R 5'- TGACCTGTTAGGGTGAGAAG - 3', and those for the 3.4 kb deletion are; ND4LF 5'- TCGCTCACACCTCATATCCTC -3', ND5R 5'- TGTGATTAGGAGTAGGGTTAGG -3'.
- the reaction cocktail included: 2X SYBR ® Green Supermix (10OmM KCL, 4OmM Tris-HCI, pH 8.4, 0.4mM of each dNTP [dATP, dCTP, dGTP, and dTTP], iTaq TM DNA polymerase, 50 units/ml, 6mM MgCI 2 , SYBR ® Green 1 , 2OnM flourescein, and stabilizers), 25OnM each of primers, and ddH 2 ⁇ .
- 2X SYBR ® Green Supermix 10OmM KCL, 4OmM Tris-HCI, pH 8.4, 0.4mM of each dNTP [dATP, dCTP, dGTP, and dTTP], iTaq TM DNA polymerase, 50 units/ml, 6mM MgCI 2 , SYBR ® Green 1 , 2OnM flourescein, and stabilizers), 25OnM each of primers, and ddH 2
- PCR cycling parameters were as follows; (1) 95 0 C for 2 min, (2) 95 0 C for 30 sec, (3) 55 0 C (for the 4977bp deletion) and 63 0 C (for the 3.4 kb deletion) for 30 sec , (4) 72 0 C for 45 sec, (5) plate read, followed by 39 cycles of steps 3 to 5, and final incubation at 4 0 C.
- samples were run on agarose gels for specific visualization of amplification products (see Figures 2 to 4).
- Figure 2 is an agarose gel showing polyadenalated fusion transcripts in prostate samples invoked by the loss of 3.4kb from the mitochondrial genome.
- Figure 2 B- blank, Lanes 1-6 transcripts detected in cDNA; lanes 7-12 no reverse transcriptase (RT) controls for samples in lanes 1-6.
- Figure 3 shows polyadenalated fusion transcripts in prostate samples invoked by the loss of the 4977kb common deletion.
- B-blank Lanes 1-6 transcripts detected in cDNA; lanes 7-12 no RT controls for samples in lanes 1-6.
- Figure 4 shows polyadenalated fusion transcripts in breast samples invoked by the loss of 3.4kb from the mtgenome.
- the repetitive elements occur at positions 10745-10754 in ND4L and 14124-14133 in ND5.
- the 3.4kb deletion results in the removal of the 3' end of ND4L, the full ND4 gene, tRNA histidine, tRNA serine2, tRNA Ieucine2, and the majority of the 5' end of ND5 (see Figure 5a), resulting in a gene splice of ND4L and ND5 with a junction point of 10744(ND4L):14124(ND5) ( Figure 5b).
- ND4L By starting at the original initiation codon of the first gene, ND4L, the amino acid sequence was translated until a termination codon occurs.
- the termination codon is the original termination codon of ND5. Therefore, despite splicing two genes together, the reading frame is kept intact resulting in a hypothetical or predicted transcript that is 100 amino acids (or 300 bp) in length.
- This fusion protein transcript product is identified herein as SEQ ID NO: 37.
- the nucleotide sequence (SEQ ID NO: 3) encoding such protein corresponds to the mitochondrial genome positions of 10470-10744:14124-14148.
- SEQ ID NO: 3 is the complementary DNA sequence to the RNA transcript (SEQ ID NO: 20) detected in the manner described above.
- transcript 1 is a fusion transcript between ATPase 8 and ND5 associated with positions 8469:13447 (SEQ ID NO: 19).
- Transcripts 3 and 4 are fusion transcripts between COM and Cytb associated with nucleotide positions 7974:15496 and 7992:15730 respectively.
- Table 3 provides a summary of the relationships between the various sequences used in this example. Table 3 includes the detected fusion transcript, the DNA sequence complementary to the fusion transcript detected and hypothetical translation products for each transcript.
- Example 3 Application to Prostate Cancer
- Example 4 Application to Breast Cancer
- analyses were conducted on two samples of breast tumour tissue and two samples of tumour-free tissues adjacent to those tumours, as well as three samples of prostate tumour tissue, one sample comprising adjacent tumour-free tissue. Results for this example are provided in Table 4.
- the prostate tumour tissue sample having a corresponding normal tissue section demonstrated a similar pattern to the prostate sample analyzed in Example 3 in that the tumour tissue had approximately 2 times the amount of the fusion transcript than did the normal adjacent tissue.
- the breast tumour samples demonstrated a marked increase in the fusion transcript levels when compared to the adjacent non-tumour tissues.
- Example 5 Application to Colorectal Cancer
- This study sought to determine the effectiveness of several transcripts of the invention in detecting colorectal cancer.
- a total of 19 samples were prepared comprising nine control (benign) tissue samples (samples 1 to 9) and ten tumour (malignant) tissue samples (samples 10 to 19).
- transcripts 2 and 3 are the same as those discussed above with respect to Examples 3 and 4.
- Homogenates were prepared using approximately 25mg of tissue from OCT blocks and diluted 1 :1 for transcripts 2 and 4, and 1 :8 for transcripts 10 and 11. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a GlomaxTM Multi Detection System (Pro meg a). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples.
- Input RNA was accounted for by using the formula Iog 2 a RLU - Iog 2 h RLU where a is the target fusion transcript and h is the housekeeper transcript.
- the analysis of the data comprised the following steps: [00274] a) Establish CVs (coefficients of variation) for triplicate assays; acceptable if ⁇ 15%. [00275] b) Establish average RLU value for triplicate assays of target fusion transcript(a) and housekeeper transcript (h). [00276] c) Establish lower limit from triplicate value of background RLU (I). [00277] d) Subtract lower limit (I) from (a).
- Transcript 2 There exists a statistically significant difference between the means (p ⁇ 0.10) of the normal and malignant groups (p>0.09), using a cutoff value of 3.6129 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 89% and the area under the curve is 0.73 indicating fair test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Using a cutoff value of -7.5555 as demonstrated by the ROC curve results in a sensitivity of 60% and specificity of 89% and the area under the curve is 0.76 indicating fair to good test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Transcript 2 was also found to have utility in the detection of breast cancer.
- Transcript 11 was also found to have utility in the detection of melanoma skin cancer.
- Transcript 10 was also found to have utility in the detection of lung cancer and melanoma.
- Transcript 8 was also found to have utility in the detection of lung cancer. Any of the 7 transcripts listed may be used individually or in combination as a tool for the detection of characterization of colorectal cancer in a clinical setting.
- Example 6 Application to Lung Cancer
- Example 5 nine control (benign) tissue samples (samples 1 to 9) and ten tumour (malignant) tissue samples (samples 10 to 19) were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual). Homogenates were diluted 1 :8 and the quantity of 4 target transcripts and 1 housekeeper transcript was measured in Relative Luminenscence Units RLU on a GlomaxTM Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well.
- tissue samples used in this example had the following characteristics: [00295] Table 9: Characteristics of Lung Cancer Samples
- Using a cutoff value of 2.5071 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 71 % and the area under the curve is 0.74 indicating fair test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Example 6 The results from example 6 illustrate the utility of transcripts 6, 8, 10, and 20 of the invention in the detection of lung cancer tumours and the distinction between malignant and normal lung tissues. Any of these three transcripts may be used for the detection or characterization of lung cancer in a clinical setting.
- Example 7 Application to Melanoma
- This study sought to determine the effectiveness of several transcripts of the invention in the detection of melanomas. In this study a total of 14 samples were used, comprising five control (benign) tissue samples and nine malignant tissue samples. All samples were formalin fixed, paraffin embedded (FFPE).
- FFPE formalin fixed, paraffin embedded
- FFPE tissue samples were sectioned into tubes and homogenized according to the manufacturer's recommendations (Quantigene® 2.0 Sample Processing Kit for FFPE Samples; and Quantigene 2.0 Reagent System User Manual) such that each sample approximated 20 microns prior to homogenization. Homogenates were diluted 1 :4 and the quantity of 7 target transcripts and 1 housekeeper transcript was measured in Relative Luminenscence Units RLU on a GlomaxTM Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. [00306] The 14 tissue samples used in this example had the following characteristics: [00307] Table 10: Characteristics of Melanoma Cancer Samples
- transcripts 10 and 11 were also used in Example 5. The analysis of data was performed according to the method described in Example 5. The results are illustrated in figures 8a -8g.
- transcripts 6, 10, 11 , 14, 15, 16 and 20 of the invention are shown in the detection of malignant melanomas.
- transcripts 10 and11 were also found have utility in detecting colorectal cancer while transcript 6 has utility in the detection of lung cancer.
- a transcript summary by disease is provided at Table 6.
- Example 8 Application to Ovarian Cancer [00322] This study sought to determine the effectiveness of several transcripts of the invention in detecting ovarian cancer.
- samples 1 to 10 were prepared comprising ten control (benign) tissue samples (samples 1 to 10) and ten tumour (malignant) tissue samples (samples 11 to 20).
- the samples were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual).
- Eight target transcripts and one housekeeper transcript were prepared in the manner as outlined above in previous examples.
- the 20 tissue samples used in this example had the following characteristics: [00324] Table 12: Characteristics of Ovarian Cancer Samples
- transcripts 1 , 2, 3, 6, 11 , 12, 15 and 20 are the same as those discussed above with respect to Examples 3-7.
- Homogenates were prepared using approximately 25mg of frozen tissue and diluted 1 :4. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a GlomaxTM Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples. Input RNA was accounted for by using the formula log 2 a RLU - Iog 2 /?
- RLU where a is the target fusion transcript and h is the housekeeper transcript.
- the analysis of the data comprised the following steps: a) Establish CVs (coefficients of variation) for triplicate assays; acceptable if ⁇ 15%. b) Establish average RLU value for triplicate assays of target fusion transcript(a) and housekeeper transcript (h). c) Establish lower limit from triplicate value of background RLU (I). d) Subtract lower limit (I) from (a). e) Calculate log 2 a RLU - log 2 /? RLU.
- Using a cutoff value of -9.6479 as demonstrated by the ROC curve results in a sensitivity of 90% and specificity of 70% and the area under the curve is 0.86 indicating good test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Using a cut-off value of -8.6926 as demonstrated by the ROC curve results in a sensitivity of 70% and specificity of 80% and the area under the curve is 0.80 indicating good test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Transcript 6 was also found to have utility in the detection of melanoma and lung cancer.
- Transcript 11 was also found to have utility in the detection of melanoma skin cancer, colorectal cancer and testicular cancer.
- Transcript 12 was also found to have utility in the detection of colorectal cancer and testicular cancer.
- Transcript 15 was also found to have utility in the detection of melanoma and testicular cancer.
- Transcript 20 was also found to have utility in the detection of colorectal cancer, melanoma, and testicular cancer. Any of the 8 transcripts listed may be used individually or in combination as a tool for the detection or characterization of ovarian cancer in a clinical setting.
- Example 9 Application to Testicular Cancer
- This study sought to determine the effectiveness of several transcripts of the invention in detecting testicular cancer.
- a total of 17 samples were prepared comprising eight control (benign) tissue samples (samples 1 to 8) and 9 tumour (malignant) tissue samples (samples 9 to 17 ), 5 of the malignant samples were non-seminomas (samples 9-13)and 4 were seminomas (samples 14-17).
- the samples were homogenized according to the manufacturer's recommendations (Quantigene® Sample Processing Kit for Fresh or Frozen Animal Tissues; and Quantigene 2.0 Reagent System User Manual).
- 10 target transcripts and one housekeeper transcript were prepared in the manner as outlined above in previous examples.
- the 17 tissue samples used in this example had the following characteristics: [00345] Table 14: Characteristics of Testicular Cancer Samples
- transcripts 2, 3, 4, 11 , 12, 15, 16 and 20 are the same as those discussed above with respect to Examples 3-8.
- Homogenates were prepared using approximately 25mg of frozen tissue and diluted 1 :4. The quantity of the transcripts was measured in Relative Luminenscence Units RLU on a GlomaxTM Multi Detection System (Promega). All samples were assayed in triplicate for each transcript. Background measurements (no template) were done in triplicate as well. The analysis accounted for background by subtracting the lower limit from the RLU values for the samples. Input RNA was accounted for by using the formula log 2 a RLU - Iog 2 /?
- RLU where a is the target fusion transcript and h is the housekeeper transcript.
- the analysis of the data comprised the following steps: a) Establish CVs (coefficients of variation) for triplicate assays; acceptable if ⁇ 15%. b) Establish average RLU value for triplicate assays of target fusion transcript(a) and housekeeper transcript (h). c) Establish lower limit from triplicate value of background RLU (I). d) Subtract lower limit (I) from (a). e) Calculate log 2 a RLU - log 2 /? RLU.
- Using a cutoff value of -9.7628 as demonstrated by the ROC curve results in a sensitivity of 67% and specificity of 100% and the area under the curve is 0.833 indicating good test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- Using a cut-off value of - 7.4575 as demonstrated by the ROC curve results in a sensitivity of 100% and specificity of 87.5% and the area under the curve is 0.938 indicating excellent test accuracy.
- the threshold value chosen may be adjusted to increase either the specificity or sensitivity of the test for a particular application.
- transcripts 2, 3, 4, 11 , 12, 13, 15, 16, and 20 in the detection of testicular cancer, and testicular cancer subtypes, and in distinguishing malignant from normal testicular tissue.
- Transcript 2 was also found to have utility in the detection of prostate, breast, colorectal and ovarian cancer.
- Transcript 3 was also found to have utility in the detection of prostate, breast, melanoma, colorectal, and ovarian cancers.
- Transcript 4 was also found to have utility in the detection of prostate and colorectal cancers.
- Transcript 11 was also found to have utility in the detection of colorectal, melanoma, and ovarian cancers.
- Transcript 12 was also found to have utility in the detection of colorectal and ovarian cancers.
- Transcript 15 was also found to have utility in the detection of melanoma and ovarian cancers.
- Transcript 16 was also found to have utility in the detection of melanoma skin cancer.
- Transcript 20 was also found to have utility in the detection of colorectal cancer, melanoma, and ovarian cancer. Any of the 9 transcripts listed may be used individually or in combination as a tool for the detection or characterization of ovarian cancer in a clinical setting.
- the invention provides a kit for conducting an assay for determining the presence of cancer in a tissue sample.
- the kit includes the required reagents for conducting the assay as described above.
- the kit includes one or more containers containing one or more hybridization probes corresponding to transcripts 1 to 17, and 20 described above.
- the reagents for conducting the assay may include any necessary buffers, salts, detection reagents etc.
- the kit may include any necessary sample collection devices, containers etc. for obtaining the needed tissue samples, reagents or materials to prepare the tissue samples for example by homogenization or nucleic acid extraction, and for conducting the subject assay or assays.
- the kit may also include control tissues or samples to establish or validate acceptable values for diseased or non-diseased tissues.
- Example 10 Detection of Fusion Protein [00367]
- Cell lines [00368] The presence of fusion proteins was investigated in two human prostate cell lines. Firstly the normal prostate cell line RWPE-1 (ATCC Cat# CRL-11609), these cells are non tumourigenic in nude mice and were established by infection with human papilloma virus 18 of histologically normal adult human prostate cells. Secondly a tumorigenic cell line WPE1-NA22 were examined (ATCC Cat# CRL-2849). These cells were derived from the RWPE-1 cells following exposure to N-methyl-N-nitrosourea.
- Both cell lines were grown in Keratinicyte Serum Free Medium (Invitrogen Cat#17005-042), medium is supplemented with bovine pituitary extract and human recombinant epidermal growth factor. Cells were grown to 90% confluence then trypsinised using TrypLE Select (Invitrogen Cat#12563029). Cells were then counted using an automated counting system (Invitrogen Countess Cat#C10227), aliquots were then snap frozen and stored at -80 0 C.
- Protein Extraction [00371] Cell fractions were extracted from both RWPE1 and WPE1-NA22 cell lines using the Qproteome Mitochondria Isolation Kit (Qiagen Cat#37612). Both mitochondrial and cytoplasmic fractions were extracted from 1x10 7 cells. Protein concentration was then calculated using a fluorescent protein assay (Quant-IT Protein, Invitrogen Cat#Q33211) measured on a Qubit fluorometer (Invitrogen Cat#Q32857). [00372] SDS-Page Gel electrophoresis [00373] SDS-Page electrophoresis was carried out on mitochondrial and cytosolic fractions prepared using the Qproteome mitochondrial isolation kit.
- LCMS LCMS
- Eight gel slices were cut out from each lane of a colloidal blue stained 1 D SDS-PAGE ( Figure 19) and in gel digested with trypsin following standard procedures.
- the digestion products were eluted form the gel and evaporated.
- An aliquot was injected onto an LCMS system (Dionex / LC Packings Ultimate3000 coupled online to a Thermo LTQ XL orbitrap) and separated on a 25 cm (75 urn ID) PepMap (Dionex) column at a flow rate of 300 ml/min with formic acid as a ion pairing agent and a linear gradient starting at 5% MeCN going to 40% MeCN over 110 min.
- MS spectra were collected in the orbitrap at a resolution of 60000 (400 Da) and MSMS spectra in the linear ion trap at low resolution.
- Data were processed using Thermo Proteome Discoverer to generate .mgf (mascot generic format) peak list files, which were submitted in house to XITandem, searching a custom database comprised of the human proteome (ensembl) and predicted fusion proteins based on the fusion transcripts described previously. To calculate a false discovery rate (FDR), the searched database also included the reverse sequence of all proteins.
- FDR false discovery rate
- the proteins were scored by their log(e) + values and classified as significant when the log(e) + was less than negative one, with preference given to proteins with a log(e) + less than negative three. Fusion proteins were identified by the presence of at least one peptide from each of the contributing genes of the fusion transcript present in the same gel slice. Protein sequence coverage from the identified peptides by the LC/MS-MS are displayed in red. The sequence of the protein which may be difficult to observe a peptide due to experimental conditions are indicated in green. Finally, protein sequence that is displayed in black represents a neutral possibility of identifying a peptide. [00380] Examples of Identified Fusion Proteins [00381] Many mitochondrial fusion proteins were identified using this methodology. Four of such fusion proteins are described below as representative examples.
- CO2 Cytochrome c oxidase subunit 2
- ND3 NADH-ubiquinone oxidoreductase chain 3
- ND1 NADH dehydrogenase subunit 1
- the ND1 C-terminus peptide YDQLMHLLWK was not observed in gel slice 4, and based on the expected sizes of P0064 and ND2 it is suggested that gel slice 4 contains P0064 and ND2.
- CO1 Cytochrome c oxidase subunit 1
- cell line RWPE-1 is indicated as NO and cell line WPE1-NA22 is indicated as Ll.
- the additional cell lines included in this experiment represent a continued progression of malignancy with moderate invasive potential (Ml), high invasive potential (HI), and very high invasive potential (VH).
- Ml moderate invasive potential
- HI high invasive potential
- VH very high invasive potential
- the cells were lysed and assayed using custom probes specific to each of the fusion transcripts on the branching DNA platform as described herein or previously in PCT application no. PCT/CA2009/000351 (published under number WO 2009/117811), the entire contents of which are incorporated herein by reference. Results indicated high levels of expression (with RLU values ranging from 10 6 IO 8 ).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Wood Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Hematology (AREA)
- Analytical Chemistry (AREA)
- Urology & Nephrology (AREA)
- Food Science & Technology (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- General Physics & Mathematics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Surgery (AREA)
- Medical Informatics (AREA)
- Heart & Thoracic Surgery (AREA)
- Oncology (AREA)
- Hospice & Palliative Care (AREA)
- Pharmacology & Pharmacy (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2011137486/10A RU2011137486A (ru) | 2009-03-27 | 2010-03-29 | Аберрантная митохондриальная днк, ассоциированные с ней слитые транскрипты, продукты трансляции и гибрадизационные зонды |
| EP17188792.0A EP3272871B1 (en) | 2009-03-27 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
| NZ595114A NZ595114A (en) | 2009-03-27 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
| SG2011068467A SG174514A1 (en) | 2008-03-28 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
| CN201080014122.6A CN102388140B (zh) | 2008-03-28 | 2010-03-29 | 异常线粒体dna、相关的融合转录本和翻译产物及其杂交探针 |
| KR1020117025261A KR101720555B1 (ko) | 2009-03-27 | 2010-03-29 | 이상 미토콘드리아 디엔에이, 관련된 융합 전사물 및 번역 산물 및 이에 대한 하이브리드화 탐침 |
| AU2010234238A AU2010234238B2 (en) | 2009-03-27 | 2010-03-29 | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor |
| EP10761136.0A EP2411522B1 (en) | 2009-03-27 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
| US13/260,497 US8715960B2 (en) | 2008-03-28 | 2010-03-29 | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor |
| JP2012501093A JP5734947B2 (ja) | 2009-03-27 | 2010-03-29 | 異常型ミトコンドリアdna、関連融合転写物および翻訳産物、並びにそのハイブリダイゼーションプローブ |
| CA2756824A CA2756824A1 (en) | 2010-03-29 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/CA2009/000351 WO2009117811A1 (en) | 2008-03-28 | 2009-03-27 | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor |
| CAPCTCA2009/000351 | 2009-03-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010115261A1 true WO2010115261A1 (en) | 2010-10-14 |
Family
ID=42937093
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2010/000423 Ceased WO2010115261A1 (en) | 2008-03-28 | 2010-03-29 | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor |
Country Status (6)
| Country | Link |
|---|---|
| EP (2) | EP2411522B1 (OSRAM) |
| JP (1) | JP5734947B2 (OSRAM) |
| KR (1) | KR101720555B1 (OSRAM) |
| AU (1) | AU2010234238B2 (OSRAM) |
| RU (1) | RU2011137486A (OSRAM) |
| WO (1) | WO2010115261A1 (OSRAM) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8715960B2 (en) | 2008-03-28 | 2014-05-06 | Mitomics Inc. | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TWI709188B (zh) | 2018-09-27 | 2020-11-01 | 財團法人工業技術研究院 | 基於機率融合的分類器、分類方法及分類系統 |
| CN113025633B (zh) * | 2019-12-09 | 2024-08-27 | 武汉纽福斯生物科技有限公司 | 编码人nadh脱氢酶亚单位1蛋白的核酸及其应用 |
Citations (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US5807522A (en) | 1994-06-17 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for fabricating microarrays of biological samples |
| WO2009039601A1 (en) | 2007-09-26 | 2009-04-02 | Genesis Genomics Inc. | 3.4 kb mitochondrial dna deletion for use in the detection of cancer |
| WO2009117811A1 (en) | 2008-03-28 | 2009-10-01 | Genesis Genomics Inc. | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6218117B1 (en) * | 1998-06-15 | 2001-04-17 | Mitokor | Compositions and methods for identifying agents that quantitatively alter detectable extramitochondrial DNA:mitochondrial DNA ratios |
| US20030162174A1 (en) * | 2001-06-11 | 2003-08-28 | Sutherland John W. | Detecting nucleic acid deletion sequences |
| EP1397508A2 (en) * | 2001-06-11 | 2004-03-17 | 1304854 Ontario Ltd | Complete mitochondrial genome sequences as a diagnostic tool for the health sciences |
| NZ562928A (en) * | 2005-04-18 | 2011-01-28 | Mitomics Inc | Mitochondrial mutations and rearrangements as a diagnostic tool for the detection of sun exposure, prostate cancer and other cancers |
-
2010
- 2010-03-29 AU AU2010234238A patent/AU2010234238B2/en not_active Ceased
- 2010-03-29 EP EP10761136.0A patent/EP2411522B1/en not_active Not-in-force
- 2010-03-29 EP EP17188792.0A patent/EP3272871B1/en active Active
- 2010-03-29 WO PCT/CA2010/000423 patent/WO2010115261A1/en not_active Ceased
- 2010-03-29 JP JP2012501093A patent/JP5734947B2/ja not_active Expired - Fee Related
- 2010-03-29 KR KR1020117025261A patent/KR101720555B1/ko not_active Expired - Fee Related
- 2010-03-29 RU RU2011137486/10A patent/RU2011137486A/ru not_active Application Discontinuation
Patent Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4366241B1 (OSRAM) | 1980-08-07 | 1988-10-18 | ||
| US5807522A (en) | 1994-06-17 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for fabricating microarrays of biological samples |
| WO2009039601A1 (en) | 2007-09-26 | 2009-04-02 | Genesis Genomics Inc. | 3.4 kb mitochondrial dna deletion for use in the detection of cancer |
| WO2009117811A1 (en) | 2008-03-28 | 2009-10-01 | Genesis Genomics Inc. | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor |
Non-Patent Citations (29)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS, pages: 6.3.1 - 6.3.6 |
| A. INNIS ET AL.,: "PCR Strategies", 1995 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1997, WILEY & SONS |
| BARRINGER ET AL., GENE, vol. 89, 1990, pages 117 |
| BRUMLEY, R. L. JR.; SMITH, L.M.: "Rapid DNA sequencing by horizontal ultrathin gel electrophoresis", NUCLEIC ACIDS RES., vol. 19, 1991, pages 4121 - 4126 |
| C. R. NEWTON; A. GRAHAM, PCR: INTRODUCTION TO BIOTECHNIQUES SERIES, 1997 |
| DAI J.G. ET AL.: "Mitochondrial DNA 4977 BP deletion mutations in lung carcinoma.", INDIAN JOURNAL OF CANCER., vol. 43, no. 1, January 2006 (2006-01-01), pages 20 - 25, XP008154370 * |
| GUATELLI ET AL., PROC. NAT. ACAD. SCI. USA, vol. 87, 1990, pages 1874 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, N.Y., pages: 563 - 681 |
| HOPGOOD, R. ET AL.: "Strategies for automated sequencing of human mtDNA directly from PCR products", BIOTECHNIQUES, vol. 13, 1992, pages 82 - 92 |
| INNIS ET AL.: "A guide to Methods and Application", 1990, ACADEMIC PRESS, INC, article "PCR Protocols" |
| INNIS ET AL.: "PCR Protocols, A Guide to Methods and Applications", 1990, ACADEMIC PRESS, INC. N.Y. |
| JALKANEN ET AL., J. CELL. BIOL., vol. 101, 1985, pages 976 - 985 |
| JALKANEN, M. ET AL., J. CELL. BIOL., vol. 105, 1987, pages 3087 - 3096 |
| KOHLER ET AL., EUR. J. IMMUNOL., vol. 6, 1976, pages 292 |
| KOHLER ET AL., EUR. J. IMMUNOL., vol. 6, 1976, pages 511 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KRISHNAN ET AL., NATURE GENETICS, 2008 |
| KWOH ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 1173 |
| LANDEGREN ET AL., SCIENCE, vol. 241, 1988, pages 1077 |
| LUCKEY, J.A. ET AL.: "High speed DNA sequencing by capillary gel electrophoresis", METHODS ENZYMOL., vol. 218, 1993, pages 154 - 172 |
| MITA S. ET AL.: "Recombination via flanking direct repeats is a major cause of large- scale deletions of human mitochondrial DNA.", NUCLEIC ACIDS RESEARCH, vol. 18, no. 3, 1990, pages 561 - 567, XP008154366 * |
| MULLIS; FALOONA, METHODS ENZYMOL., vol. 155, 1987, pages 335 |
| See also references of EP2411522A4 |
| TANAKA, M. ET AL.: "Automated sequencing of mtDNA", METHODS ENZYMOL., vol. 264, 1996, pages 407 - 421 |
| UCHIDA T. ET AL.: "Down-regulation of mitochondrial gene expression by the anti- tumor arotinoid mofarotene (Ro 40-8757).", INTERNATIONAL JOURNAL OF CANCER, vol. 58, no. 6, 1994, pages 891 - 897, XP008154368 * |
| WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316 - 325 |
| WU; WALLACE, GENOMICS, vol. 4, 1989, pages 560 |
| ZHU W. ET AL.: "Large-scale mitochondrial DNA deletion mutations and nuclear genome instability in human breast cancer.", CANCER DETECTION AND PREVENTION, vol. 28, no. 2, 2004, pages 119 - 126, XP002524596 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8715960B2 (en) | 2008-03-28 | 2014-05-06 | Mitomics Inc. | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor |
| US10266899B2 (en) | 2008-03-28 | 2019-04-23 | Mdna Life Sciences Inc. | Aberrant mitochondrial DNA, associated fusion transcripts and hybridization probes therefor |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3272871A1 (en) | 2018-01-24 |
| EP2411522A4 (en) | 2013-01-02 |
| JP5734947B2 (ja) | 2015-06-17 |
| RU2011137486A (ru) | 2013-05-10 |
| EP2411522A1 (en) | 2012-02-01 |
| AU2010234238A1 (en) | 2011-09-29 |
| KR101720555B1 (ko) | 2017-03-29 |
| JP2012521745A (ja) | 2012-09-20 |
| AU2010234238B2 (en) | 2016-07-28 |
| EP2411522B1 (en) | 2017-09-06 |
| EP3272871B1 (en) | 2020-01-15 |
| KR20140014360A (ko) | 2014-02-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8715960B2 (en) | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor | |
| US7122373B1 (en) | Human genes and gene expression products V | |
| AU2010275699B2 (en) | Markers for endometrial cancer | |
| JP6017497B2 (ja) | 前立腺細胞増殖性障害の発症に関連する遺伝子の発現を解析する方法及び核酸 | |
| AU2010234238B2 (en) | Aberrant mitochondrial DNA, associated fusion transcripts and translation products and hybridization probes therefor | |
| HK1166818B (en) | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor | |
| HK1166818A (en) | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor | |
| CA2756824A1 (en) | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefor | |
| HK1153224A (en) | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor | |
| HK1153224B (en) | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor | |
| HK1244815A1 (en) | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor | |
| HK1244815B (en) | Aberrant mitochondrial dna, associated fusion transcripts and hybridization probes therefor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080014122.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10761136 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010234238 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 595114 Country of ref document: NZ |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2756824 Country of ref document: CA Ref document number: 2012501093 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2010234238 Country of ref document: AU Date of ref document: 20100329 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2010761136 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010761136 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20117025261 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011137486 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13260497 Country of ref document: US |