WO2010111625A1 - Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination - Google Patents

Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination Download PDF

Info

Publication number
WO2010111625A1
WO2010111625A1 PCT/US2010/028877 US2010028877W WO2010111625A1 WO 2010111625 A1 WO2010111625 A1 WO 2010111625A1 US 2010028877 W US2010028877 W US 2010028877W WO 2010111625 A1 WO2010111625 A1 WO 2010111625A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
vegf
antibody
protein
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/028877
Other languages
English (en)
French (fr)
Inventor
Qi Pan
Carl W. Birks
Pallavur V. Sivakumar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zymogenetics Inc
Original Assignee
Zymogenetics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Zymogenetics Inc filed Critical Zymogenetics Inc
Priority to MX2011009810A priority Critical patent/MX2011009810A/es
Priority to AU2010229705A priority patent/AU2010229705A1/en
Priority to CN2010800230893A priority patent/CN102448984A/zh
Priority to US13/260,408 priority patent/US20120134993A1/en
Priority to JP2012502294A priority patent/JP2012521768A/ja
Priority to EP10722828A priority patent/EP2411407A1/en
Publication of WO2010111625A1 publication Critical patent/WO2010111625A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • Angiogenesis is the formation of new blood vessels from existing vessels. It plays an essential role during development. In adults, angiogenesis occurs during wound healing to restore blood flow to tissues after injury or insult. Angiogenesis also plays an important role in tumor formation and in other diseases, including rheumatoid arthritis, atherosclerosis, psoriasis, diabetic retinopathy, and macular degeneration. (See, e.g. , Fan et al. , Trends Pharmacol. ScL 16:57, 1995; Folkman, Nature Med. 1 :27, 1995.)
  • Activators of angiogenesis include vascular endothelial growth factor-A (VEGF-A), fibroblast growth factors (FGFs), placenta growth factor (PlGF), and hepatocyte growth factor (HGF) and some cytokines such as interleukin-8 (IL-8).
  • Endogenous inhibitors of angiogenesis include thrombospondin, endostatin, angiostatin and interleukin-12. The balance between activators and inhibitors of angiogenesis is tilted towards activators during physiological and pathological angiogenesis.
  • VEGF-A is a key regulator of both physiological and pathological angiogenesis. It plays an essential role in the specification, morphogenesis, differentiation and homeostasis of vessels by regulating the proliferation, migration, and survival of endothelial cells.
  • VEGF-A is highly expressed in a variety of human tumors.
  • VEGF-A expression is regulated by the hypoxia-inducible factor 1 (HIF-I) transcription factor.
  • HIF-I hypoxia-inducible factor 1
  • VEGF-A121-206 Five human VEGF-A isoforms of 121, 145, 165, 189 or 206 amino acids in length (VEGF-A121-206), encoded by distinct mRNA splice variants, have been described, all of which are capable of stimulating mitogenesis in endothelial cells. These isoforms differ in biological activity, receptor specificity, and affinity for cell surface- and extracellular matrix- associated heparan-sulfate proteoglycans, which behave as low affinity receptors for VEGF-A: VEGF-A 121 does not bind to either heparin or heparan-sulfate; VEGF-Ai 45 and VEGF-Ai 6S (GenBank Ace. No.
  • VEGF-Ai 89 and VEGF-A 2 06 show the strongest affinity for heparin and heparan-sulfates.
  • VEGF-A 121 , VEGF- Ai 45 , and VEGF-Ai 65 are secreted in a soluble form, although most of VEGF-Ai 65 is confined to cell surface and extracellular matrix proteoglycans, whereas VEGF-Ai 89 and VEGF-A 2O6 remain associated with extracellular matrix.
  • Both VEGF-Ai 89 and VEGF-A 2 O 6 can be released by treatment with heparin or heparinase, indicating that these isoforms are bound to extracellular matrix via proteoglycans.
  • Cell-bound VEGF-Ai 89 can also be cleaved by proteases such as plasmin, resulting in release of an active soluble VEGF-Ai i 0 .
  • Human VEGF- Ai 65 the most abundant and biologically active form, is glycosylated at Asn74 and is typically expressed as a 46 kDa homodimer of 23 kDa subunits.
  • VEGFR- 1 /FIt-I farnesoid-like tyrosine kinase- 1; GenBank Ace. No. X51602; De Vries et al, Science 255:989-991, 1992
  • VEGFR-2/KDR/Flk- 1 kinase insert domain containing receptor/fetal liver kinase-1; GenBank Ace. Nos. X59397 (FIk-I) and L04947 (KDR); Terman et al, Biochem. Biophys. Res. Comm. 187:1579-1586, 1992; Matthews et al, Proc. Natl Acad.
  • VEGFi 2I and VEGFi 65 bind VEGFR-I; VEGFi 2I , VEGFi 45 , and VEGFi 65 bind VEGFR-2; VEGFi 65 binds neuropilin-1; and VEGFi 65 and VEGFi 45 bind neuropilin-2.
  • VEGFi 2I and VEGFi 65 bind VEGFR-I; VEGFi 2I , VEGFi 45 , and VEGFi 65 bind VEGFR-2; VEGFi 65 binds neuropilin-1; and VEGFi 65 and VEGFi 45 bind neuropilin-2.
  • VEGF-A Recognition of the importance of VEGF-A for the development of several important classes of cancer recently culminated in the approval of AVASTINTM, a humanized monoclonal antibody to VEGF-A, for combination treatment with chemotherapy for metastatic colorectal cancer, nonsmall cell lung cancer and metastatic breast cancer.
  • AVASTINTM a humanized monoclonal antibody to VEGF-A, for combination treatment with chemotherapy for metastatic colorectal cancer, nonsmall cell lung cancer and metastatic breast cancer.
  • FGFs Fibroblast growth factors
  • FGFl -14, 16-23 Fibroblast growth factors
  • FGFs play important roles in a variety of biological functions such as cell proliferation, differentiation, migration, angiogenesis and tumorigenesis. They execute their pleiotropic biological actions by binding, dimerizing and activating cell surface FGF receptors.
  • FGF receptor genes there are four FGF receptor genes in mammals, fgfRl-fgfR4.
  • the extracellular domain of FGFRs comprises three immunoglobulin-like domains.
  • Alternative splicing at the membrane proximal Ig loop of FgfRl-FgfR3 give rise to additional variants. This loop is encoded by an invariant exon (Ilia), for the N-terminal half, and a choice of exons termed IHb or IIIc for the other half.
  • Ilia invariant exon
  • FGF ligands and receptors and mutants in FGF receptors have been associated with many types of cancer, including prostate, breast, ovarian, bladder, colorectal, pancreatic, liver, lung, glioblastoma cancers, multiple myeloma and leukemia. (See e.g., Grose et al, Cytokine Growth Factor Rev. 16: 179-186, 2005).
  • FGFl, 2, 6, 8b, 9 and 17 are over-expressed in prostate tumor tissues, and the expression levels of FGF8b and 17 are correlated with tumor stage, grade and poor prognosis (Dorkin et al., Oncogene 18:2755- 2761, 1999; Gnanapragasam et al, Oncogene 21 :5069-5080, 2002; Heer et al, J Pathol. 204:578-586. 2004).
  • FGF9 contributes to prostate cancer-induced new bone formation and may participate in the osteoblastic progression of androgen receptor-negative prostate cancer in bone (Li et al, J Clin Invest. 118:2697-2710, 2008).
  • FGFRl and FGFR4 are over-expressed in prostate tumor tissues, and FGFR2IIIb to IIIc isoform switch promotes prostate cancer initiation and progression (Giri et al, Clin Cancer Res. 5: 1063-1071, 1999; Wang et al, Clin. Cancer Res. 10:6169-6178, 2004; Kwabi-Addo et al, Prostate 46: 163-172, 2001).
  • FGFl, 2, 8 are over-expressed in breast tumor tissues. Up to 8.7% of all breast cancers have FGFRl gene amplication and this amplification is an independent predictor of overall survival.
  • FGFR4 overexpression correlates with fail on tamoxifen therapy in patients with recurrent breast cancer (See, e.g., Elsheikh et al, Breast Cancer Res. 9, 2007; Meijer et al, Endocrine-Related Cancer 15: 101-111, 2008).
  • FGFl, 8, 9, 18 and FGFRl 111 C, FGFR2 m c, FGFR4 are over- expressed in ovarian tumor tissues.
  • FGFR3 over-expression and activating mutations have been reported in urothelial cell carcinoma of bladder cancer.
  • FGFR3 mutation in non-invasive, low-grade and stage bladder tumors significantly associate with higher recurrence rate. (See, e.g., Knowles, World J. Urol.
  • FGF-2, FGFRl and FGFR2 are frequently over-expressed in squamous cell carcinoma and adenocarcinoma of the lung. FGF-2 signaling pathway activation may be an early phenomenon in the pathogenesis of squamous cell carcinoma (Behrens, et. al., Clin Cancer Res. 14:6014-6022, 2008). [9] Many members of the FGF family, including FGFl, FGF2, FGF4 and FGF6, also have strong pro-angiogenic activity in vitro and in vivo, and can promote tumor progression by modulating tumor vascularization (Presta et al, Cytokine Growth Factor Rev. 16: 159-178, 2005).
  • VEGF blockade with an anti-VEGFR2 monoclonal antibody promotes hypoxia and induces the expression of FGFl, FGF2 and FGF7 in tumor tissues in the Ripl-Tag2 transgenic mice that develop spontaneous pancreatic tumors (Casanovas et al, Cancer Cell 8:299-309, 2005).
  • the upregulation of FGFs co-incides with the reinduction of angiogenesis and escape from VEGF blockade.
  • Combined inhibition of VEGF and FGF signaling in this model results in further tumor suppression, demonstrating that upregulation of the FGF signaling pathway contributes at least partially to escape mechanisms after VEGF-targeted therapy.
  • the present invention provides bispecific binding proteins comprising a antibody/soluble receptor bispecific binding protein that reduces the biological activity of both VEGF-A and FGF.
  • the bispecific binding protein comprises a VEGF-A binding region of an anti- VEGF-A antibody (VEGF-A antibody) moiety and a FGF binding moiety of an FGF receptor, as described herein.
  • the FGF binding moieties described here are generally soluble FGF receptors (FGFR).
  • FGFR soluble FGF receptors
  • the invention provides that in certain embodiments the soluble FGF receptor portion of the bispecific binding protein comprises an FGF receptor moiety of an FGFR3 or FGFR2 as described herein. In other embodiments, an Fc polypeptide is fused to the C-terminus of the FGFR.
  • the FGF binding moiety and VEGF-A binding moiety are polypeptides fused using peptide or polypeptide linker sequences, and in these instances the polynucleotides encoding said embodiments can be expressed as single bispecific binding protein.
  • the invention also provides that certain embodiments of the bispecific binding protein comprises a VEGF-A antibody moiety as described herein.
  • the VEGF-A antibody moiety can further be comprised of scFV polypeptides orVL and VH polypeptides described herein.
  • the FGF binding moiety is an FGF receptor moiety, and can be FGFR3, and in particular is FGFR3 ⁇ i c as described herein.
  • a bispecific antibody/soluble receptor protein comprises an FGF receptor moiety that is an FGFR3 selected from the group consisting of FGFR3 rac (23-375) as shown in SEQ ID NO: 13 , FGFR3 ⁇ i c (23-375)(S249W) as shown in SEQ ID NO:2, FGFR3 rac (143-375) as shown in SEQ ID NO: 19, FGFR3 mc (143-375)(S249W), as shown in SEQ ID NO: 10, FGFR3 mc (23- 375)(P250R) as shown in SEQ ID NO: 15, and FGFR3 mc (143-375)(P250R) as shown in SEQ ID NO:22 in combination with a VEGF-A antibody moiety selected from the group consisting of c
  • a bispecific antibody/soluble receptor combination comprises an FGF binding moiety that is an FGFR3 selected from the group consisting of FGFR3m c (23-375) as shown in SEQ ID NO: 13, FGFR3 mc (23-375)(S249W) as shown in SEQ ID NO:2, FGFR3 mc (143-375) as shown in SEQ ID NO: 19, FGFR3 mc (143-375)(S249W), as shown in SEQ ID NO:10, FGFR3 ⁇ i c (23-375)(P250R) as shown in SEQ ID NO: 15, and FGFR3 mc (143-375)(P250R) as shown in SEQ ID NO:22 and VEGF-A binding moiety selected from the group consisting of a c870 VL as shown in SEQ ID NO:48 and VH as shown in SEQ ID NO:50, a clO94 VL as shown in SEQ ID NO: 54 and VH as shown
  • the bispecific binding protein of the present invention embodies an FGFR3 moiety and VEGF-A antibody moiety selected from the group consisting of FGFR3(143-375)(S249W)Fc5 clO94.1 pZMP31 (SEQ ID NO:58); FGFR3(23- 375)(S249W)Fc5 clO94.1 pZMP31 (SEQ ID NO:60); FGFR3(143-375)(S249W)Fc5 c870e6 pZMP31 (SEQ ID NO:62); and FGFR3(23-375)(S249W)Fc5 c870e6 pZMP31 (SEQ ID NO:64).
  • the FGF binding moiety is FGFR2.
  • the FGFR2 comprises FGFR2 i ⁇ c .
  • a bispecific antibody/soluble receptor combinations comprises an FGF binding moiety that is an FGFR2 selected from the group consisting of FGFR2 IIIc (22-377) as shown in SEQ ID NO:24, FGFR2 ⁇ io(22-377)(S252W) as shown in SEQ ID NO:29, FGFR2 mc (22-377)(P253R) as shown in SEQ ID NO:33, FGFR2 IIIc (145-377), as shown in SEQ ID NO:37, FGFR2 IIIc (145- 377)(S252W) as shown in SEQ ID NO:40, and FGFR2 IIIc (145-377)(P253R) as shown in SEQ ID NO:42; and VEGF-A binding moiety selected from the group consisting of c870.1e6 scFV as shown
  • a bispecific antibody/soluble receptor combination comprises an FGF binding moiety that is an FGFR2 selected from the group consisting of FGFR2 rac (22-377) as shown in SEQ ID NO:24, FGFR2 ⁇ ic(22-377)(S252W) as shown in SEQ ID NO:29, FGFR2 IIIc (22-377)(P253R) as shown in SEQ ID NO:33, FGFR2 IIIc (145-377), as shown in SEQ ID NO:37, FGFR 2II i c (145- 377)(S252W) as shown in SEQ ID NO:40, and FGFR2 IIIc (145-377)(P253R) as shown in SEQ ID NO:42; and VEGF-A binding moiety selected from the group consisting a c870 VL as shown in SEQ ID NO:48 and VH as shown in SEQ ID NO:50, a clO94 VL as shown in SEQ ID NO:54 and V
  • the present invention provides for methods of using the bispecific antibody/soluble receptor binding proteins described herein.
  • the bispecific antibody/soluble receptor binding proteins can be administered to a subject to treat cancers characterized by solid tumor growth such as prostate cancer, breast cancer, pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, glioblastoma, non- small cell lung cancer (NSCLC), and gastrointestinal stromal tumor (GIST).
  • solid tumor growth such as prostate cancer, breast cancer, pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, glioblastoma, non- small cell lung cancer (NSCLC), and gastrointestinal stromal tumor (GIST).
  • a "polypeptide” is a polymer of amino acid residues joined by peptide bonds, whether produced naturally or synthetically. Polypeptides of less than about 10 amino acid residues are commonly referred to as “peptides.”
  • a “protein” is a macromolecule comprising one or more polypeptide chains. A protein may also comprise non-peptidic components, such as carbohydrate groups. Carbohydrates and other non-peptidic substituents may be added to a protein by the cell in which the protein is produced, and will vary with the type of cell. Proteins are defined herein in terms of their amino acid backbone structures; substituents such as carbohydrate groups are generally not specified, but may be present nonetheless.
  • amino-terminal and “carboxyl-terminal” are used herein to denote positions within polypeptides. Where the context allows, these terms are used with reference to a particular sequence or portion of a polypeptide to denote proximity or relative position. For example, a certain sequence positioned carboxyl-terminal to a reference sequence within a polypeptide is located proximal to the carboxyl terminus of the reference sequence, but is not necessarily at the carboxyl terminus of the complete polypeptide.
  • nucleic acid or “nucleic acid molecule” refers to polynucleotides, such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), oligonucleotides, fragments generated by the polymerase chain reaction (PCR), and fragments generated by any of ligation, scission, endonuclease action, and exonuclease action.
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • PCR polymerase chain reaction
  • Nucleic acid molecules can be composed of monomers that are naturally-occurring nucleotides (such as DNA and RNA), or analogs of naturally-occurring nucleotides (e.g., ⁇ -enantiomeric forms of naturally-occurring nucleotides), or a combination of both.
  • Modified nucleotides can have alterations in sugar moieties and/or in pyrimidine or purine base moieties.
  • Sugar modifications include, for example, replacement of one or more hydroxyl groups with halogens, alkyl groups, amines, and azido groups, or sugars can be functionalized as ethers or esters.
  • the entire sugar moiety can be replaced with sterically and electronically similar structures, such as aza-sugars and carbocyclic sugar analogs.
  • modifications in a base moiety include alkylated purines and pyrimidines, acylated purines or pyrimidines, or other well-known heterocyclic substitutes.
  • Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages. Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phosphoranilidate, phosphoramidate, and the like.
  • nucleic acid molecule also includes so-called “peptide nucleic acids,” which comprise naturally- occurring or modified nucleic acid bases attached to a polyamide backbone. Nucleic acids can be either single stranded or double stranded.
  • a VEGF-A antagonist is a compound that reduces the biological activity of VEGF-A
  • a FGFR antagonist is compound that reduces the biological activity of FGF. Since the activities of both VEGF-A and FGF are dependent on the interactions of multiple molecules (including ligand, receptor, and signal transducers), antagonists can reduce the activity by acting directly on VEGF-A or FGF, or by acting on another molecule in the cognate biological pathway.
  • a FGF antagonist can reduce FGF activity by, e.g.
  • Antagonists include, without limitation, antibodies, soluble receptors, and non-proteinaceous compounds that bind to a ligand or its receptor, or otherwise interfering with ligand-receptor interactions and/or other receptor functions.
  • receptor denotes a cell-associated protein that binds to a bioactive molecule (i.e., a ligand) and mediates the effect of the ligand on the cell.
  • a bioactive molecule i.e., a ligand
  • Membrane-bound receptors are characterized by a multi-domain or multi-peptide structure comprising an extracellular ligand-binding domain and an intracellular effector domain that is typically involved in signal transduction. Binding of ligand to receptor results in a conformational change in the receptor that causes an interaction between the effector domain and other molecule(s) in the cell. This interaction in turn leads to an alteration in the metabolism of the cell.
  • Metabolic events that are linked to receptor-ligand interactions include gene transcription, phosphorylation, dephosphorylation, increases in cyclic AMP production, mobilization of cellular calcium, mobilization of membrane lipids, cell adhesion, hydrolysis of inositol lipids and hydrolysis of phospholipids.
  • receptors can be membrane bound, soluble or nuclear; monomeric (e.g., thyroid stimulating hormone receptor, beta-adrenergic receptor) or multimeric (e.g., PDGF receptor, growth hormone receptor, IL-3 receptor, GM- CSF receptor, G-CSF receptor, erythropoietin receptor and IL-6 receptor).
  • a "soluble receptor” is a receptor polypeptide that is not bound to a cell membrane. Soluble receptors are most commonly ligand-binding receptor polypeptides that lack transmembrane and cytoplasmic domains. Soluble receptors can comprise additional amino acid residues, such as affinity tags that provide for purification of the polypeptide or provide sites for attachment of the polypeptide to a substrate. Many cell-surface receptors have naturally occurring, soluble counterparts that are produced by proteolysis or translated from alternatively spliced mRNAs. Receptor polypeptides are said to be substantially free of transmembrane and intracellular polypeptide segments when they lack sufficient portions of these segments to provide membrane anchoring or signal transduction, respectively.
  • the term "Fc-fusion protein” designates antibody-like molecules which combine the binding specificity of a heterologous protein with the effector functions of immunoglobulin constant domains.
  • the Fc-fusion proteins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i. e., is "heterologous"), and an immunoglobulin constant domain sequence.
  • the Fc-fusion protein molecule typically includes a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand.
  • the immunoglobulin constant domain sequence in the Fc-fusion protein can be obtained from any immunoglobulin, such as IgG-I, IgG-2, IgG-3, or IgG-4 subtypes, IgA (including IgA-I and IgA-2), IgE, IgD or IgM.
  • immunoglobulin such as IgG-I, IgG-2, IgG-3, or IgG-4 subtypes, IgA (including IgA-I and IgA-2), IgE, IgD or IgM.
  • useful Fc-fusion proteins according to this invention are polypeptides that comprise the FGF binding portions of a FGFR3 receptor without the transmembrane or cytoplasmic sequences of the FGFR3 receptor.
  • the extracellular domain of FGFR3 is fused to a constant domain of an immunoglobulin sequence.
  • antibody is used herein to denote proteins produced by the body in response to the presence of an antigen and that bind to the antigen, as well as antigen-binding fragments and engineered variants thereof.
  • antibody and antibodies include polyclonal antibodies, affinity-purified polyclonal antibodies, monoclonal antibodies, and antigen-binding antibody fragments, such as F(ab') 2 and Fab fragments. Genetically engineered intact antibodies and fragments, such as chimeric antibodies, humanized antibodies, single-chain Fv fragments, single-chain antibodies, diabodies, minibodies, linear antibodies, multivalent or multispecific hybrid antibodies, and the like are also included.
  • the term “antibody” is used expansively to include any protein that comprises an antigen binding site of an antibody and is capable of binding to its antigen.
  • the term "genetically engineered antibodies” means antibodies wherein the amino acid sequence has been varied from that of a native antibody. Because of the relevance of recombinant DNA techniques in the generation of antibodies, one need not be confined to the sequences of amino acids found in natural antibodies; antibodies can be redesigned to obtain desired characteristics. The possible variations are many and range from the changing of just one or a few amino acids to the complete redesign of, for example, the variable or constant region. Changes in the constant region will, in general, be made in order to improve or alter characteristics, such as complement fixation, interaction with cells and other effector functions. Typically, changes in the variable region will be made in order to improve the antigen binding characteristics, improve variable region stability, or reduce the risk of immunogenicity.
  • An "antigen-binding site of an antibody” is that portion of an antibody that is sufficient to bind to its antigen.
  • the minimum such region is typically a variable domain or a genetically engineered variant thereof.
  • Single-domain binding sites can be generated from camelid antibodies (see Muyldermans and Lauwereys, J. MoI. Recog. 12: 131-140, 1999; Nguyen et al, EMBO J. 19:921-930, 2000) or from V H domains of other species to produce single-domain antibodies ("dAbs"; see Ward et al, Nature 341 :544-546, 1989; US Patent No. 6,248,516 to Winter et al.).
  • an antigen-binding site is a polypeptide region having only 2 complementarity determining regions (CDRs) of a naturally or non- naturally (e.g., mutagenized) occurring heavy chain variable domain or light chain variable domain, or combination thereof (see, e.g., Pessi et al, Nature 362:367-369, 1993; Qiu et al, Nature Biotechnol 25:921-929, 2007). More commonly, an antigen-binding site of an antibody comprises both a heavy chain variable domain and a light chain variable domain that bind to a common epitope.
  • CDRs complementarity determining regions
  • a molecule that "comprises an antigen-binding site of an antibody” may further comprise one or more of a second antigen- binding site of an antibody (which may bind to the same or a different epitope or to the same or a different antigen), a peptide linker, an immunoglobulin constant domain, an immunoglobulin hinge, an amphipathic helix (see Pack and Pluckthun, Biochem. 31 : 1579- 1584, 1992), a non-peptide linker, an oligonucleotide (see Chaudri et al, FEBS Letters 450:23- 26, 1999), and the like, and may be a monomeric or multimeric protein.
  • molecules comprising an antigen-binding site of an antibody include, for example, Fv fragments, single-chain Fv fragments (scFv), Fab fragments, diabodies, minibodies, Fab-scFv fusions, bispecific (scFv)zt-IgG, and bispecific (scFv) 2 -Fab.
  • scFv single-chain Fv fragments
  • Fab fragments diabodies
  • minibodies minibodies
  • Fab-scFv fusions bispecific (scFv)zt-IgG
  • bispecific (scFv) 2 -Fab See, e.g., Hu et al, Cancer Res. 56:3055-3061, 1996; Atwell et al, Molecular Immunology 33:1301- 1312, 1996; Carter and Merchant, Curr. Opin. Biotechnol. 8:449-454, 1997; Zuo et al, Protein Engineering 13:361-367, 2000; and Lu et
  • immunoglobulin refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin gene(s).
  • One form of immunoglobulin constitutes the basic structural unit of an antibody. This form is a tetramer and consists of two identical pairs of immunoglobulin chains, each pair having one light and one heavy chain. In each pair, the light and heavy chain variable regions are together responsible for binding to an antigen, and the constant regions are responsible for the antibody effector functions.
  • Immunoglobulins typically function as antibodies in a vertebrate organism. Five classes of immunoglobulin protein (IgG, IgA, IgM, IgD, and IgE) have been identified in higher vertebrates.
  • IgG comprises the major class; it normally exists as the second most abundant protein found in plasma. In humans, IgG consists of four subclasses, designated IgGl, IgG2, IgG3, and IgG4.
  • the heavy chain constant regions of the IgG class are identified with the Greek symbol ⁇ .
  • immunoglobulins of the IgGl subclass contain a ⁇ l heavy chain constant region. Each immunoglobulin heavy chain possesses a constant region that consists of constant region protein domains (C H I , hinge, C H 2, and C H 3; IgG3 also contains a C H 4 domain) that are essentially invariant for a given subclass in a species.
  • DNA sequences encoding human and non-human immunoglobulin chains are known in the art.
  • Ellison et al DNA 1 : 11-18, 1981; Ellison et al, Nucleic Acids Res. 10:4071-4079, 1982; Kenten et al, Proc. Natl. Acad. ScL USA 79:6661-6665, 1982; Seno et al, Nuc. Acids Res. 11 :719-726, 1983; Riechmann et al., Nature 332:323-327, 1988; Amster et al., Nuc. Acids Res.
  • immunoglobulin is used herein for its common meaning, denoting an intact antibody, its component chains, or fragments of chains, depending on the context.
  • Full-length immunoglobulin "light chains” (about 25 Kd or 214 amino acids) are encoded by a variable region gene at the NH 2 -terminus (encoding about 110 amino acids) and a by a kappa or lambda constant region gene at the COOH-terminus.
  • Full-length immunoglobulin "heavy chains” (about 50 Kd or 446 amino acids) are encoded by a variable region gene (encoding about 116 amino acids) and a gamma, mu, alpha, delta, or epsilon constant region gene (encoding about 330 amino acids), the latter defining the antibody's isotype as IgG, IgM, IgA, IgD, or IgE, respectively.
  • variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
  • An immunoglobulin "Fv" fragment contains a heavy chain variable domain (V H ) and a light chain variable domain (V L ), which are held together by non-covalent interactions.
  • An immunoglobulin Fv fragment thus contains a single antigen-binding site.
  • the dimeric structure of an Fv fragment can be further stabilized by the introduction of a disulfide bond via mutagenesis. (See Almog et al, Proteins 31 : 128-138, 1998.)
  • single-chain Fv and “single-chain antibody” refer to antibody fragments that comprise, within a single polypeptide chain, the variable regions from both heavy and light chains, but lack constant regions.
  • a single-chain antibody further comprises a polypeptide linker between the V H and V L domains, which enables it to form the desired structure that allows for antigen binding.
  • Single-chain antibodies are discussed in detail by, for example, Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113 (Rosenburg and Moore eds., Springer- Verlag, New York, 1994), pp. 269- 315. (See also WIPO Publication WO 88/01649; U.S. Patent Nos. 4,946,778 and 5,260,203; Bird et al, Science 242:423-426, 1988.) Single-chain antibodies can also be bi-specific and/or humanized.
  • a "Fab fragment” contains one light chain and the C H 1 and variable regions of one heavy chain.
  • the heavy chain of a Fab fragment cannot form a disulfide bond with another heavy chain molecule.
  • a "Fab' fragment” contains one light chain and one heavy chain that contains more of the constant region, between the C H 1 and C H 2 domains, such that an interchain disulfide bond can be formed between two heavy chains to form a F(ab') 2 molecule.
  • a "F(ab') 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C H 1 and C H 2 domains, such that an interchain disulfide bond is formed between two heavy chains.
  • An immunoglobulin "Fc fragment” (or Fc domain) is the portion of an antibody that is responsible for binding to antibody receptors on cells and the CIq component of complement.
  • Fc stands for "fragment crystalline," the fragment of an antibody that will readily form a protein crystal.
  • Distinct protein fragments which were originally described by proteolytic digestion, can define the overall general structure of an immunoglobulin protein.
  • the Fc fragment consists of the disulfide-linked heavy chain hinge regions, C H 2, and C H 3 domains.
  • C H 2 disulfide-linked heavy chain hinge regions
  • Fc includes variants of naturally occuring sequences.
  • An immunoglobulin light or heavy chain variable region consists of a "framework" region interrupted by three hypervariable regions.
  • hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen binding.
  • the hypervariable region comprises amino acid residues from a "Complementarity Determining Region” or "CDR" (e.g., in human, residues 24-34 (Ll), 50-56 (L2), and 89-97 (L3) in the light chain variable domain and residues 31-35 (Hl), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain (amino acid sequence numbers based on the EU index; see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
  • a "human framework region” is a framework region that is substantially identical (about 85% or more, usually 90-95% or more) to the framework region of a naturally occurring human immunoglobulin.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDR's.
  • the CDR's are primarily responsible for binding to an epitope of an antigen.
  • CDRs Ll, L2, and L3 of the V L domain are also referred to herein, respectively, as LCDRl, LCDR2, and LCDR3;
  • CDRs Hl, H2, and H3 of the V H domain are also referred to herein, respectively, as HCDRl, HCDR2, and HCDR3.
  • variable antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from immunoglobulin variable and constant region genes belonging to different species.
  • the variable segments of the genes from a mouse monoclonal antibody may be joined to human constant region- encoding segments (e.g., human gamma 1 or gamma 3 heavy chain genes, and human kappa light chain genes).
  • a therapeutic chimeric antibody is thus a hybrid protein, typically composed of the variable or antigen-binding domains from a mouse antibody and the constant domains from a human antibody, although other mammalian species may be used.
  • a chimeric antibody is produced by recombinant DNA technology in which all or part of the hinge and constant regions of an immunoglobulin light chain, heavy chain, or both, have been substituted for the corresponding regions from another animal's immunoglobulin light chain or heavy chain.
  • the antigen-binding portion of the parent monoclonal antibody is grafted onto the backbone of another species' antibody.
  • Chimeric antibodies may be optionally "cloaked” with a human-like surface by replacement of exposed residues, the result of which is a "veneered antibody.”
  • human antibody includes an antibody that has an amino acid sequence of a human immunoglobulin and includes antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin genes and that do not express endogenous immunoglobulins, as described, for example, in U.S. Patent No. 5,939,598 to Kucherlapati et al.
  • humanized immunoglobulin refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human (e.g., a mouse or rat) immunoglobulin.
  • the non-human immunoglobulin providing the CDR's is called the "donor” and the human immunoglobulin providing the framework is called the “acceptor.”
  • Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, preferably about 95% or more identical.
  • all parts of a humanized immunoglobulin, except possibly the CDR's are substantially identical to corresponding parts of natural human immunoglobulin sequences.
  • humanized antibodies may retain non-human residues within the human variable region framework domains to enhance proper binding characteristics (e.g., mutations in the frameworks may be required to preserve binding affinity when an antibody is humanized).
  • a “humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin.
  • a humanized antibody would not encompass a typical chimeric antibody as defined above because, e.g., the entire variable region of a chimeric antibody is non- human.
  • a "bispecific antibody” or “bifunctional antibody” is a hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies may be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315- 321, l990; Kostelny et al., J. Immunol. 148: 1547-1553, 1992.
  • a “bivalent antibody” other than a “multispecific” or “multifunctional” antibody in certain embodiments, is an antibody comprising two binding sites having identical antigenic specificity.
  • diabodies refers to small antibody fragments with two antigen- binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H -V L ).
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the domains are forced to pair with the complementary domains of another chain and create two antigen- binding sites.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. ScL USA 90:6444-6448, 1993.
  • minibody refers herein to a polypeptide that encodes only 2 complementarity determining regions (CDRs) of a naturally or non-naturally (e.g., mutagenized) occurring heavy chain variable domain or light chain variable domain, or combination thereof. Examples of minibodies are described by, e.g., Pessi et al., Nature 362:367-369, 1993; and Qiu et al, Nature Biotechnol. 25:921-929, 2007. [46] The term “linear antibodies” refers to the antibodies described in Zapata et al, Protein Eng. 8: 1057-1062, 1995. Briefly, these antibodies comprise a pair of tandem Fd segments (V H -C HI -V H -C HI ) which form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
  • the term "monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • parent antibody refers to an antibody which is encoded by an amino acid sequence used for the preparation of the variant.
  • the parent antibody has a human framework region and, if present, has human antibody constant region(s).
  • the parent antibody may be a humanized or human antibody.
  • a “variant" anti-VEGF-A antibody refers herein to a molecule which differs in amino acid sequence from a "parent" anti-VEGF-A antibody amino acid sequence by virtue of addition, deletion and/or substitution of one or more amino acid residue(s) in the parent antibody sequence.
  • the variant comprises one or more amino acid substitution(s) in one or more hypervariable region(s) of the parent antibody.
  • the variant may comprise at least one, e.g., from about one to about ten, and preferably from about two to about five, substitutions in one or more hypervariable regions of the parent antibody.
  • the variant will have an amino acid sequence having at least 75% amino acid sequence identity with the parent antibody heavy or light chain variable domain sequences, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%.
  • Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the parent antibody residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. None of N- terminal, C-terminal, or internal extensions, deletions, or insertions into the antibody sequence shall be construed as affecting sequence identity or homology.
  • the variant retains the ability to bind human VEGF-A and preferably has properties which are superior to those of the parent receptor or antibody.
  • the variant may have a stronger binding affinity, enhanced ability to inhibit VEGF-A-induced biological activity (e.g., angiogenesis or proliferation).
  • VEGF-A-induced biological activity e.g., angiogenesis or proliferation.
  • the variant antibody of particular interest herein is one which displays about at least a 3 fold, 5 fold, 10 fold, 20 fold, or 50 fold, enhancement in biological activity when compared to the parent antibody.
  • epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. More specifically, the term "VEGF-A epitope” as used herein refers to a portion of the VEGF-A polypeptide having antigenic or immunogenic activity in an animal, preferably in a mammal, and most preferably in a mouse or a human. An epitope having immunogenic activity is a portion of a VEGF-A polypeptide that elicits an antibody response in an animal.
  • An epitope having antigenic activity is a portion of a VEGF-A polypeptide to which an antibody immunospecifically binds as determined by any method well known in the art, for example, by immunoassays.
  • Antigenic epitopes need not necessarily be immunogenic.
  • a "vector” is a nucleic acid molecule, such as a plasmid, cosmid, or bacteriophage, that has the capability of replicating autonomously in a host cell.
  • Cloning vectors typically contain one or a small number of restriction endonuclease recognition sites that allow insertion of a nucleic acid molecule in a determinable fashion without loss of an essential biological function of the vector, as well as nucleotide sequences encoding a marker gene that is suitable for use in the identification and selection of cells transformed with the cloning vector. Marker genes typically include genes that provide tetracycline resistance or ampicillin resistance.
  • An "expression vector” is a nucleic acid molecule encoding a gene that is expressed in a host cell.
  • an expression vector comprises a transcription promoter, a gene, and a transcription terminator. Gene expression is usually placed under the control of a promoter, and such a gene is said to be “operably linked” to the promoter.
  • a regulatory element and a core promoter are operably linked if the regulatory element modulates the activity of the core promoter.
  • expression refers to the biosynthesis of a gene product.
  • expression involves transcription of the structural gene into mRNA and the translation of mRNA into one or more polypeptides.
  • amino acid residues corresponding to those specified by SEQ ID NO includes post-translational modifications of such residues.
  • Neovascularization and angiogenesis refer to the generation of new blood vessels into cells, tissue, or organs.
  • the control of angiogenesis is typically is typically altered in certain disease states and, in many case, the pathological damage associated with the disease is related to altered or unregulated angiogenesis.
  • Persistant, unregulated angiogenesis occurs in a variety of disease states, including those characterized by the abnormal growth by endothelial cells, and supports the pathological damage seen in these conditions including leakage and permeability of blood vessels.
  • neovascular disorder refers to any disease or disorder having a pathology that is mediated, at least in part, by increased or unregulated angiogenesis activity.
  • diseases or disorders include various cancers comprising solid tumors (e.g., pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, non-small cell lung cancer (NSCLC), and gastrointestinal stromal tumor (GIST)) as well as certain ocular diseases involving neovascularization (“neovascular ocular disorders”).
  • solid tumors e.g., pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, non-small cell lung cancer (NSCLC), and gastrointestinal stromal tumor (GIST)
  • ovascular ocular disorders e.g., ocular diseases involving neovascularization
  • diseases or disorders are particularly amenable to certain treatment methods for inhibition angiogenesis, as described further herein.
  • An effective amount of an agent is administered according to the methods of the present invention in an "effective regime.”
  • the term “effective regime” refers to a combination of amount of the agent being administered and dosage frequency adequate to accomplish treatment or prevention of the disease or disorder.
  • patient in the context of treating a disease or disorder as described herein, includes mammals such as, for example, humans and other primates.
  • mammals such as, for example, humans and other primates.
  • domesticated animals such as, e.g., cows, hogs, sheep, horses, dogs, and cats.
  • Two amino acid sequences have "100% amino acid sequence identity” if the amino acid residues of the two amino acid sequences are the same when aligned for maximal correspondence.
  • two nucleotide sequences have "100% nucleotide sequence identity” if the nucleotide residues of the two nucleotide sequences are the same when aligned for maximal correspondence.
  • Sequence comparisons can be performed using standard software programs such as those included in the LASERGENE bioinformatics computing suite, which is produced by DNASTAR (Madison, Wisconsin). Other methods for comparing two nucleotide or amino acid sequences by determining optimal alignment are well-known to those of skill in the art. (See, e.g.
  • Percent sequence identity is determined by conventional methods. See, e.g., Altschul et al, Bull. Math. Bio. 48:603, 1986, and Henikoff and Henikoff, Proc. Natl. Acad. ScL USA 89:10915, 1992. For example, two amino acid sequences can be aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1 , and the "BLOSUM62" scoring matrix of Henikoff and Henikoff, supra, as shown in Table 1 (amino acids are indicated by the standard one-letter codes). The percent identity is then calculated as: ([Total number of identical matches]/ [length of the longer sequence plus the number of gaps introduced into the longer sequence in order to align the two sequences])(100).
  • the "FASTA" similarity search algorithm of Pearson and Lipman is a suitable protein alignment method for examining the level of identity shared by an amino acid sequence disclosed herein and a second amino acid sequence.
  • the FASTA algorithm is described by Pearson and Lipman, Proc. Natl Acad. ScL USA 85:2444, 1988, and by Pearson, Meth. Enzymol. 183:63, 1990.
  • the ten regions with the highest density of identities are then rescored by comparing the similarity of all paired amino acids using an amino acid substitution matrix, and the ends of the regions are "trimmed" to include only those residues that contribute to the highest score.
  • the trimmed initial regions are examined to determine whether the regions can be joined to form an approximate alignment with gaps.
  • the highest scoring regions of the two amino acid sequences are aligned using a modification of the Needleman-Wunsch-Sellers algorithm (Needleman and Wunsch, J. MoI. Biol. 48:444, 1970; Sellers, SIAM J. Appl. Math. 26:787, 1974), which allows for amino acid insertions and deletions.
  • FASTA can also be used to determine the sequence identity of nucleic acid molecules using a ratio as disclosed above.
  • the ktup value can range between one to six, preferably from three to six, most preferably three, with other parameters set as described above.
  • Figures IA- 1C illustrate the amino acid sequences of certain immunoglobulin Fc polypeptides. Amino acid sequence numbers are based on the EU index (Kabat et al, Sequences of Proteins of Immunological Interest, US Department of Health and Human Services, NIH, Bethesda, 1991). The illustrated sequences include a wild-type human sequence ("wt"; SEQ ID NO:75) and five variant sequences, designated Fc-488 (SEQ ID NO:76), Fc4 (SEQ ID NO:77), Fc5 (SEQ ID NO:74), Fc6 (SEQ ID NO:78), and Fc7 (SEQ ID NO:79).
  • wt human sequence
  • Fc-488 SEQ ID NO:76
  • Fc4 SEQ ID NO:77
  • Fc5 SEQ ID NO:74
  • Fc6 SEQ ID NO:78
  • Fc7 SEQ ID NO:79
  • Figure 2 depicts a tetravalent, bispecific antibody/soluble receptor combination with specificity for two different targets (referred to herein as ⁇ VEGF-A and ligand binding domain of FGFR).
  • Figure 3 depicts FGFR-Fc (R&D Systems) showing variable inhibition of FGF-9- stimulated proliferation of osteoblasts.
  • Figure 4A depicts the inhibition of FGF-9-stimulated proliferation by FGFR-Fc constructs (ZymoGenetics) Full-length FGFR3-Fc wild-type and mutant constructs (ZymoGenetics) have similar IC50s and Figure 4B depicts Truncated FGFR3-Fc mutant constructs (ZymoGenetics) have similar IC50s.
  • Figure 5A depicts the direct binding of FGF-8b by FGFR-Fc (R&D Systems) and Figure 5B depicts the direct binding of FGF-8b by FGFR-Fc constructs (ZymoGenetics).
  • Figure 6A depicts the direct binding of FGF- 17 by FGFR-Fc (R&D Systems) and Figure 6B depicts the direct binding of FGF- 17 by FGFR2-Fc constructs (ZymoGenetics).
  • Figure 7 depicts the direct binding of FGF- 17 by FGFR3-Fc constructs (ZymoGenetics).
  • Figure 8A depicts FGFR-Fc inhibits growth of Caki-1 cells and Figure 8B depicts FGFR-Fc inhibits growth of DU 145 cells.
  • Figure 9 depicts the second and third Ig-like domains of the FGF receptor family.
  • the present invention addresses a need in the art to provide more therapeutics to treat cancers, particularly solid tumors, by providing new proteins that are multispecific binding proteins, in particular bispecific binding proteins.
  • the term "bispecific binding protein” refers to a protein capable of specifically binding to at least two different target molecules via at least two binding moieties having different binding specificities.
  • the binding moieties may be, for example, a protein (e.g., antibody or soluble receptor) or small molecule.
  • the binding moieties of a bispecific binding protein may be physically linked.
  • the present invention as described herein provides bispecific binding proteins which comprise a soluble receptor moiety and an antibody moiety.
  • the soluble receptor moiety comprises a soluble FGF receptor or portion thereof and the antibody moiety comprises a VEGF-A antibody or portion thereof as described herein.
  • two or more different moieties of a bispecific binding protein are linked via linker to form a multimer (e.g., a dimer).
  • a peptide linker sequence may be employed to separate, for example, the polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
  • a bispecific binding protein of the invention reduces the biological activity of both FGF and VEGF-A.
  • the present invention provides VEGF-A and FGF antagonists, particularly neutralizing anti-VEGF-A antibodies in combination with FGF soluble receptors, that reduce signaling through VEGF-A receptors and FGF receptors.
  • Reduction of angiogenic signals through VEGF-A and/or FGF using such antagonists are useful for treatment of various disorders having a pathology characterized at least in part by neovascularization. For example, inhibition of angiogenic signals through VEGF-A and/or FGF in and around tumors reduces the tumor's ability to vascularize, grow, and metastasize.
  • FGF receptors can activate multiple signal transduction pathways including the phospho lipase C, phosphatidyl inositol 3 -kinase, mitogen-activated protein kinase and signal transducers and activators of transcription (STAT) pathways, all of which play a role in prostate cancer progression.
  • STAT signal transducers and activators of transcription
  • the net result of increased FGF signaling includes enhanced proliferation, resistance to cell death, increased motility and invasiveness, increased angiogenesis, enhanced metastasis, resistance to chemotherapy and radiation and androgen independence, all of which can enhance tumor progression and clinical aggressiveness.
  • FGF receptors and/or FGF signaling can affect both the tumor cells directly and tumor angiogenesis (Kwabi-Addo et al., Endocrine-Related Cancer 11 (4) 709 -724, 2004).
  • the present invention provides VEGF-A and FGF antagonists that reduce the biological activity of both VEGF-A and FGF.
  • the FGF-binding moiety is a soluble FGF receptor (FGFR) and the VEGF-A-binding moiety is a VEGF-A antibody.
  • the VEGF-A and FGF antagonists are bispecific antibody/soluble receptor binding proteins that specifically bind to and reduce VEGF-A and FGF activity. Bispecific binding proteins of the invention are described in detail herein. II. FGF Receptors, Anti- VEGF-A Antibodies, and Related Bispecific Binding Compositions
  • the FGFR portion of the molecule is a soluble receptor.
  • the FGFR comprises three Ig- like domains referred to as Dl, D2 and D3.
  • the receptor can comprise Dl, D2, D3 or can comprise D2, D3 without Dl of the FGF receptor.
  • the receptor may be the native receptor or with mutations in the D2-D3 region.
  • the FGFR family and domains D2 and D3 are shown in Figure 1.
  • FGF receptors can be characterized by their binding affinity for FGF ligands.
  • Association rate constants k a (M 1 S 4 )
  • dissociation rate constants k d (s 4 )
  • the association rate constant is a value that reflects the rate of the ligand-receptor complex formation.
  • the dissociation rate constant is a value that reflects the stability of this complex.
  • Equilibrium binding affinity is typically expressed as either an equilibrium dissociation constant (K D (M)) or an equilibrium association constant (K A (M 4 )).
  • Binding affinities for the bispecific binding proteins of the present invention will be in the range of 100 nM or less, preferably 10 nM or less, and more preferably 1 nM or less when measured in a standard in vitro assay such as in BIACORE binding analyses.
  • the FGFR is FGFR3III C
  • Other specific embodiments include FGFR3III C where amino acid number 262 of SEQ ID NO:2 or amino acid number 142 of SEQ ID NO:9 was mutated from S to W.
  • Other specific embodiments include FGFR3III C where amino acid number 263 of SEQ ID NO: 15 or amino acid number 143 of SEQ ID NO:22 was mutated from P to R.
  • the FGFR3III C may be truncated at the N-terminal as shown in SEQ ID NOS: 10, 19, and 22.
  • the FGFR is FGFR2III C
  • Other specific embodiments include FGFR2III C where amino acid number X of SEQ ID NO:29 or amino acid number Xa of SEQ ID NO:40 was mutated from S to W.
  • Other specific embodiments include FGFR2III C where amino acid number Y of SEQ ID NO:33 or amino acid number Ya of SEQ ID NO:42 was mutated from P to R.
  • the FGFR2III C may be truncated at the N-terminal as shown in SEQ ID NOS:37 and 42.
  • VEGF-A antagonists for use within the present invention include molecules that bind to VEGF-A or a VEGF-A receptor and thereby reduce the activity of VEGF-A on cells that express the receptor such as, e.g., VEGFR-I, VEGFR-2, neuropilin- 1 , and/or neuropilin-2.
  • VEGF-A antagonists include anti-VEGF-A antibodies.
  • Other suitable VEGF-A antagonists include soluble VEGF-A receptors comprising a VEGFR extracellular domain, as well as small molecule antagonists capable of inhibiting the interaction of VEGF-A with its receptor or otherwise capable in inhibiting VEGF-A-induced intracellular signaling through a VEGF-A receptor.
  • VEGF-A antagonists for use within the invention include antibodies that specifically bind to VEGF-A, including bispecific antibodies that also comprise a binding site for FGF.
  • Antibodies that are specific for VEGF- A bind at least the soluble secreted forms of VEGF-A, and preferably also bind cell surface-associated forms.
  • Antibodies are considered to be specifically binding if (1) they exhibit a threshold level of binding activity, and (2) they do not significantly cross-react with control polypeptide molecules.
  • a threshold level of binding is determined if an anti-VEGF-A antibody binds to a VEGF-A polypeptide, peptide or epitope with an affinity at least 10-fold greater than the binding affinity to a control (non- VEGF-A) polypeptide.
  • binding affinity of an antibody can be readily determined by one of ordinary skill in the art, commonly by surface plasmon resonance using automated equipment. Other methods are known in the art, for example Scatchard analysis (Scatchard, Ann. NY Acad. ScL 51 :660-672, 1949).
  • Antibodies of the present invention comprise or consist of portions of intact antibodies that retain antigen-binding specificity. Suitable antibodies include, for example, fully human antibodies; humanized antibodies; chimeric antibodies; antibody fragments such as, e.g., Fab, Fab', F(ab) 2 , F(ab') 2 and Fv antibody fragments; single chain antibodies; and monomers or dimers of antibody heavy or light chains or mixtures thereof. Preferred antibodies of the invention are monoclonal antibodies. Antibodies comprising a light chain may comprise kappa or lambda light chain.
  • antibodies of the invention include intact immunoglobulins of any isotype including IgA, IgG, IgE, IgD, or IgM (including subtypes thereof).
  • Intact immunoglobulins in accordance with the present invention preferably include intact IgG (e.g., intact IgGl, IgGl, IgG3, IgG4, IgAl, or IgA2).
  • Phage display can also be employed for the preparation of binding proteins based on non-antibody scaffolds (Koide et al, supra.). Methods for preparing recombinant human polyclonal antibodies are disclosed by Wiberg et al., Biotechnol Bioeng. 94:396-405, 2006; Meijer et al, J. MoI Biol. 358:764-772, 2006; Haurum et al, U.S. Patent Application Publication No. 2002/0009453; and Haurum et al, U.S. Patent Application Publication No. 2005/0180967.
  • polyclonal antibodies for use within the present invention can be generated by inoculating any of a variety of warm-blooded animals such as horses, cows, goats, sheep, dogs, chickens, rabbits, mice, and rats with an immunogenic polypeptide or polypeptide fragment.
  • the immunogenicity of an immunogenic polypeptide can be increased through the use of an adjuvant, such as alum (aluminum hydroxide) or Freund's complete or incomplete adjuvant.
  • Polypeptides useful for immunization also include fusion polypeptides, such as fusions of VEGF-A or a portion thereof with an immunoglobulin polypeptide or with maltose binding protein.
  • the polypeptide immunogen may be a full-length molecule or a portion thereof. If the polypeptide portion is hapten-like, it may be advantageously joined or linked to a macromolecular carrier (such as keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) or tetanus toxoid) for immunization.
  • a macromolecular carrier such as keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) or tetanus toxoid
  • antibodies can be screened against known polypeptides related to the antibody target (e.g. , orthologs, paralogs, or sequence variants of, for example, to isolate a population of antibodies that is highly specific for binding to the target protein or polypeptide.
  • highly specific populations include, for example, antibodies that bind to human VEGF-A but not to mouse VEGF-A.
  • Such a lack of cross-reactivity with related polypeptide molecules is shown, for example, by the antibody detecting a VEGF-A polypeptide but not known, related polypeptides using a standard Western blot analysis (Current Protocols in Molecular Biology (Ausubel et al eds., Green and Wiley and Sons, NY 1993)) or ELISA (enzyme immunoassay) (Immunoassay, A Practical Guide (Chan ed., Academic Press, Inc. 1987)).
  • Western blot analysis Current Protocols in Molecular Biology (Ausubel et al eds., Green and Wiley and Sons, NY 1993)
  • ELISA enzyme immunoassay
  • antibodies raised to a VEGF-A polypeptide are adsorbed to related polypeptides adhered to insoluble matrix; antibodies that are highly specific to the VEGF-A polypeptide will flow through the matrix under the proper buffer conditions.
  • mAbs Native monoclonal antibodies
  • subject animals e.g., rats or mice
  • a purified immunogenic protein or fragment thereof e.g., a purified immunogenic protein or fragment thereof.
  • animals are each given an initial intraperitoneal (IP) injection of the purified protein or fragment, typically in combination with an adjuvant (e.g., Complete Freund's Adjuvant or RIBI Adjuvant (available from Sigma- Aldrich, St. Louis, MO)) followed by booster IP injections of the purified protein at, for example, two-week intervals. Seven to ten days after the administration of the third booster injection, the animals are bled and the serum is collected. Additional boosts can be given as necessary.
  • IP intraperitoneal
  • an adjuvant e.g., Complete Freund's Adjuvant or RIBI Adjuvant (available from Sigma- Aldrich, St. Louis, MO)
  • Splenocytes and lymphatic node cells are harvested from high-titer animals and fused to myeloma cells (e.g., mouse SP2/0 or Ag8 cells) using conventional methods.
  • the fusion mixture is then cultured on a feeder layer of thymocytes or cultured with appropriate medium supplements (including commercially available supplements such as Hybridoma Fusion and Cloning Supplement; Roche Diagnostics, Indianapolis, IN).
  • appropriate medium supplements including commercially available supplements such as Hybridoma Fusion and Cloning Supplement; Roche Diagnostics, Indianapolis, IN.
  • specific antibody-producing hybridoma pools are identified using standard assays (e.g., ELISA). Positive pools may be analyzed further for their ability to block or reduce the activity of the target protein. Positive pools are cloned by limiting dilution.
  • the invention also includes the use of multiple monoclonal antibodies that are specific for different epitopes on a single target molecule. Use of such multiple antibodies in combination can reduce carrier effects seen with single antibodies and may also increase rates of clearance via the Fc receptor and improve ADCC. Two, three, or more monoclonal antibodies can be used in combination.
  • the amino acid sequence of a native antibody can be varied through the application of recombinant DNA techniques.
  • antibodies can be redesigned to obtain desired characteristics.
  • Modified antibodies can provide, for example, improved stability and/or therapeutic efficacy relative to its non-modified form.
  • the possible variations are many and range from the changing of just one or a few amino acids to the complete redesign of, for example, the variable or constant region. Changes in the constant region will, in general, be made in order to improve or alter characteristics, such as complement fixation, interaction with membranes, and other effector functions. Typically, changes in the variable region will be made in order to improve the antigen binding characteristics, improve variable region stability, or reduce the risk of immunogenicity. Phage display techniques can also be employed. See, e.g., Huse et al, Science 246: 1275-1281, 1989; Ladner et al, U.S. Patent No. 5,571,698.
  • a humanized anti-VEGF-A antibody comprises the complementarity determining regions (CDRs) of a mouse donor immunoglobulin and heavy chain and light chain frameworks of a human acceptor immunoglobulin. Often, framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
  • CDRs complementarity determining regions
  • framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al, U.S. Patent No. 5,585,089; Riechmann et al, Nature 332:323, 1988).
  • Non- humanized chimeric antibodies can also be used therapeutically (e.g., in immunosuppressed patients).
  • an antibody in accordance with the present invention is a chimeric antibody derived, inter alia, from a non-human anti-VEGF-A antibody.
  • a chimeric antibody comprises a variable region derived from a mouse or rat antibody and a constant region derived from a human so that the chimeric antibody has a longer half-life and is less immunogenic when administered to a human subject.
  • Methods for producing chimeric antibodies are known in the art.
  • the present invention also encompasses fully human antibodies such as those derived from peripheral blood mononuclear cells of ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer patients. Such cells may be fused with myeloma cells, for example, to form hybridoma cells producing fully human antibodies against VEGF-A.
  • Human antibodies can also be made in transgenic, non- human animals, commonly mice. See, e.g., Tomizuka et al, US Patent No. 7,041,870. In general, a nonhuman mammal is made transgenic for a human heavy chain locus and a human light chain locus, and the corresponding endogenous immunoglobulin loci are inactivated.
  • Antibodies of the present invention may be specified in terms of an epitope or portion of a VEGF-A polypeptide that they recognize or specifically bind.
  • An epitope or polypeptide portion may be specified, e.g. , by N-terminal and C-terminal positions of the epitope or other portion of the VEGF-A polypeptide shown in SEQ ID NO:72.
  • the antibodies of the invention have binding affinities that include a dissociation constant (K d ) less than 5 x 10 " M, less than 10 " M, less than 5 x 10 " M, less than 10 " M, less than 5 x 10 "4 M, less than 10 "4 M, less than 5 x 10 "5 M, less than 10 "5 M, less than 5 x 10 "6 M, less than 10 "6 M, less than 5 x 10 "7 M, less than 10 "7 M, less than 5 x 10 "8 M, less than 10 "8 M, less than 5 x 10 "9 M, less than 10 "9 M, less than 5 x 10 "10 M, less than 10 "10 M, less than 5 x 10 "11 M, less than 10 "11 M, less than 5 x 10 "12 M, less than 10 "12 M, less than 5 x 10 "13 M, less than 10 "13 M, less than 5 x 10 "14 M, less than 10 " 14 M, less than 5 x 10 "15 M, or
  • Antibodies of the present invention further include derivatives that are modified, e.g. , by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding to its epitope. Suitable modifications include, for example, fucosylation, glycosylation, acetylation, pegylation, phosphorylation, and amidation.
  • the antibodies and derivatives thereof may themselves by derivatized by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other proteins, and the like.
  • at least one heavy chain of the antibody is fucosylated.
  • the fucosylation is N-linked.
  • at least one heavy chain of the antibody comprises a fucosylated, N-linked oligosaccharide.
  • Antibodies of the present invention may be used alone or as immunoconjugates with a cytotoxic agent.
  • the agent is a chemotherapeutic agent.
  • the agent is a radioisotope such as, for example, Lead-212, Bismuth-212, Astatine-211, Iodine-131, Scandium-47, Rhenium-186, Rhenium-188, Yttrium-90, Iodine-123, Iodine-125, Bromine-77, Indium- I l l , or a fissionable nuclide such as Boron- 10 or an Actinide.
  • the agent is a toxin or cytotoxic drug such as, for example, ricin, modified Pseudomonas enterotoxin A, calicheamicin, adriamycin, 5-fluorouracil, an auristatin (e.g., auristatin E), maytansin, or the like.
  • auristatin e.g., auristatin E
  • Antibodies of the present invention include variants having single or multiple amino acid substitutions, deletions, additions, or replacements relative to a reference antibody (e.g., a reference antibody having VL and/or VH sequences as shown in Table 2 or Table 3), such that the variant retains one or more biological properties of the reference antibody (e.g., block the binding VEGF-A to their respective counter- structures (a VEGF-A receptor), block the biological activity of VEGF-A, binding affinity).
  • a reference antibody e.g., a reference antibody having VL and/or VH sequences as shown in Table 2 or Table 3
  • the skilled person can produce variants having single or multiple amino acid substitutions, deletions, additions, or replacements.
  • variants may include, for example: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety, and the like.
  • Antibodies of the invention may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In another embodiment, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues.
  • the techniques for obtaining these variants including genetic (suppressions, deletions, mutations, etc.), chemical, and enzymatic techniques, are known to the person having ordinary skill in the art.
  • Exemplary antibodies that bind to VEGF-A have been identified by screening a phage display library. Methods of screening by phage display are described in detail in standard reference texts, such as Babas, Phage Display: A Laboratory Manual (Cold Spring Harbor Lab Press, 2001) and Lo, Benny K.C., A., Antibody Engineering (2004). Such phage display libraries can be used to display expressed proteins on the surface of a cell or other substance such that the complementary binding entity can be functionally isolated.
  • variable light and heavy chain fragments of antibodies can be isolated in a Fab format.
  • variable regions can then be manipulated to generate antibodies, including antigen-binding fragments, such as scFvs, bispecific scFvs, and multispecific, multifunctional antagonists to VEGF-A.
  • variable regions of exemplary Fabs have been identified for their characteristics of binding and/or neutralizing VEGF-A in assays described herein. (See Examples, infra.) These variable regions were manipulated to generate various binding entities, including scFvs that bind and/or neutralize VEGF-A.
  • Table 2 show nucleotide and amino acid SEQ ID NO. designations for anti-VEGF-A antibody clusters identified for their ability to bind and neutralize VEGF-A, while Table 3 list the amino acid residue positions corresponding to the framework and CDR regions of the anti-VEGF-A antibodies listed in Table 2.
  • Table 4 SEQ ID NO. Designations for anti-VEGF-A Antibody Clusters
  • Residue position numbers shown are according to VL or VH polypeptide sequences for the corresponding antibody cluster number, the amino acid SEQ ID NOs: for which are indicated in Table 4.
  • an anti-VEGF-A antibody of the present invention comprises one or more CDRs of an anti-VEGF-A antibody listed in Table 2 (boundaries of corresponding CDR regions shown in Table 3, respectively).
  • the antibody comprises a heavy chain CDR (at least one of the HCDRl, HCDR2, and HCDR3 regions) and/or a corresponding light chain CDR (at least one of the LCDRl, LCDR2, and LCDR3 regions) of an antibody listed in Table 2.
  • the anti-VEGF-A antibody has two or three heavy chain CDRs and/or two or three light chain CDRs of an antibody listed in Table 2.
  • the antibody further comprises at least one corresponding light chain CDR.
  • an anti-VEGF-A antibody includes a heavy and/or light chain variable domain, the heavy or light chain variable domain having (a) a set of three CDRs corresponding to the heavy or light chain CDRs as shown for an antibody listed in Table 2, and (b) a set of four framework regions.
  • an anti-VEGF-A antibody can include a heavy and/or light chain variable domain, where the heavy or light chain variable domain has (a) a set of three CDRs, in which the set of CDRs are from an antibody listed in Table 2, and (b) a set of four framework regions, in which the set of framework regions are identical to or different from the set of framework regions of the same antibody listed in Table 2.
  • an anti-VEGF-A antibody includes a heavy chain variable region and/or light chain variable region that is substantially identical to the heavy and/or light chain variable region(s) of an antibody listed in Table 2.
  • LCDRl has the amino acid sequence shown in residues 24-34 of SEQ ID NO:66; LCDR2 has the amino acid sequence shown in residues 50-56 of SEQ ID NO:66; LCDR3 has the amino acid sequence shown in residues 89-97 of SEQ ID NO:66; HCDRl has the HCDRl amino acid sequence of antibody clO39 (residues 31-35 of SEQ ID NO:68); HCDR2 has the HCDR2 amino acid sequence of antibody clO39 (residues 50-66 of SEQ ID NO:68); and HCDR3 has an amino acid sequence selected from the group consisting of SEQ ID NOs:68.
  • LCDRl has the LCDRl amino acid sequence of an antibody selected from the group consisting of c870 and clO94 (residues 23-35 of SEQ ID NOS:48 and 54, respectively);
  • LCDR2 has the LCDR2 amino acid sequence of an antibody selected from the group consisting of c870 and clO94 (residues 51-57 of SEQ ID NOS:48 and 54, respectively);
  • LCDR3 has the LCDR3 amino acid sequence of an antibody selected from the group consisting of c870 and clO94 (residues 90-100 of SEQ ID NOS:48 and 54, respectively);
  • HCDRl has the HCDRl amino acid sequence of an antibody selected from the group consisting of c870 and clO94 (residues 31-35 of SEQ ID NOS:48 and 54, respectively);
  • HCDR2 has the HCDR2 amino acid sequence
  • the anti-VEGF-A antibody has CDRs LCDRl, LCDR2, LCDR3, HCDRl, HCDR2, and HCDR3 of an antibody selected from the group consisting of c870, clO39 and clO94.
  • the anti-VEGF-A antibody has the light and heavy chain variable domains (V L and V H ) of an antibody selected from the group consisting of c870, clO39 and clO94.
  • an anti-VEGF-A antibody in accordance with the present invention comprises a V L domain comprising CDRs LCDRl, LCDR2, and LCDR3 and a V H domain comprising CDRs HCDRl, HCDR2, and HCDR3, wherein said set of V L and V n CDRs has 3 or fewer amino acid substitutions relative to a second set of CDRs, where said second set of CDRs has the LCDRl, LCDR2, LCDR3, HCDRl, HCDR2, and HCDR3 amino acid sequences of an antibody selected from group consisting of c870, clO39 and clO94.
  • the antibody comprises zero, one, or two amino acid substitutions in said set of CDRs.
  • Epitopes recognized by anti-VEGF-A antibodies of the present invention typically include five or more amino acids of human VEGF-Ai 6S (residues 27-191 of SEQ ID NO:72).
  • Preferred epitopes comprise at least one amino acid included within one or more of the following polypeptide regions of VEGF-A: HEVVKFMDVYQRSYCHPIETL (amino acid residues 38-58 of SEQ ID NO:72), EYIFKPSCVPLMRCG (amino acid residues 70-84 of SEQ ID NO:72), EESNITMQIMRIKPHQG (amino acid residues 98-114 of SEQ ID NO:72), and PCGPCSERRKHLF (amino acid residues 142-154).
  • the epitope comprises at least two, at least three, at least four, at least five, at least six, or at least seven amino acids from one or more of the VEGF-A polypeptide regions as shown in residues 38-58, 70-84, 98-114, and 142-154 of SEQ ID NO:72.
  • VEGF-A epitopes are epitopes as determined by peptide microarray epitope mapping comprising the use of overlapping VEGF-A peptides (e.g., 13-mer peptides, with, for example, 2 amino acid shifts between each pair of sequential peptides).
  • the anti-VEGF-A epitope comprises at least one amino acid included within one or more of the following polypeptide regions of VEGF-A: KFMDVYQRSYC (amino acid residues 42-52 of SEQ ID NO:72), IFKPSCVPLMR (amino acid residues 72-82 of SEQ ID NO:72), IMRIKPHQG (amino acid residues 106-114 of SEQ ID NO:72), and PCGPCSERRKHLF (amino acid residues 142-154).
  • KFMDVYQRSYC amino acid residues 42-52 of SEQ ID NO:72
  • IFKPSCVPLMR amino acid residues 72-82 of SEQ ID NO:72
  • IMRIKPHQG amino acid residues 106-114 of SEQ ID NO:72
  • PCGPCSERRKHLF amino acid residues 142-154
  • the epitope comprises at least two, at least three, at least four, at least five, at least six, or at least seven amino acids from one or more of the VEGF-A polypeptide regions as shown in residues 42-52, 72-82, 106-114, and 142-154 of SEQ ID NO:72.
  • an anti- VEGF-A antibody in accordance with the present invention binds to an epitope comprising (a) one or more amino acids included within a first polypeptide region of VEGF-A as shown in amino acid residues 38-58 or 42-52 of SEQ ID NO:72 and (b) one or more amino acids included within a second polypeptide region of VEGF-A as shown in amino acid residues 70-84 or 72-82 of SEQ ID NO:72.
  • an anti-VEGF-A antibody binding to an epitope comprising (a) and (b) as above, the epitope does not comprise an amino acid included within a polypeptide region of VEGF-A as shown in residues 90 to 132 of SEQ ID NO:72 (EGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRP).
  • the epitope further comprises (c) one or more amino acids included within a third polypeptide region of VEGF-A as shown in residues 96-114 or 106-114 of SEQ ID NO:72. .
  • an anti-VEGF-A antibody binding to an epitope comprising (a), (b), and (c) as above, the antibody does not bind to human and mouse VEGF-A with K d values within 10-fold of the other.
  • an anti-VEGF-A antibody binding to an epitope comprising (a) and (b) as above, the epitope further comprises (d) one or more amino acids included within a fourth polypeptide region of VEGF-A as shown in residues 142-154 of SEQ ID NO:72.
  • an anti-VEGF-A antibody is an antibody fragment such as, for example, an Fv, Fab, Fab', F(ab) 2 , F(ab') 2 , scFv, or diabody.
  • an anti-VEGF-A antibody is an scFv.
  • scFv entities that bind VEGF-A can be oriented with the variable light (V L ) region either amino terminal to the variable heavy (V H ) region or carboxylterminal to it.
  • an anti-VEGF-A scFv has the CDRs of an anti-VEGF-A antibody listed in Table X.
  • an anti-VEGF-A scFv has the V L and V H domains of an anti-VEGF-A antibody listed in Table 2.
  • the CDRs or the V L and V H domains of an anti- VEGF-A scFv are those of an anti-VEGF-A antibody selected from c870 clO39 and c 1094.
  • the scFv comprises an amino acid sequence as set forth in SEQ ID NO:70 (clO39 scFv; nucleotide sequence shown in SEQ ID NO:69); SEQ ID NO:44 (c870.1e6 scFv; nucleotide sequence shown in SEQ ID NO:43); or SEQ ID NO:46 (clO94.1 scFv; nucleotide sequence shown in SEQ ID NO:45).
  • scFvs may be provided in any of a variety of bispecific antibody formats such as, for example, tandem scFv (tascFv), bi-single chain Fv (biscFv), and whole monoclonal antibody with a single chain Fv (scFv) fused to the carboxyl terminus (biAb) (see infra).
  • tascFv tandem scFv
  • biscFv bi-single chain Fv
  • scFv single chain Fv fused to the carboxyl terminus
  • Bispecific binding proteins combine the binding proteins of this invention via the Fc region of an immunoglobulin heavy chain as exemplified in Figure 2.
  • the Fc-fusion protein comprises the Fc region of an IgG molecule.
  • the Fc region is from a human IgGl molecule.
  • the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CHl, CH2 and CH3 regions of an IgGl molecule.
  • the simplest and most straightforward Fc-fusion protein design often combines the binding domain(s) of antagonist polypeptides of this invention, via the Fc region of an immunoglobulin heavy chain.
  • nucleic acid encoding the binding components will be fused C-terminally to nucleic acid encoding the N-terminus of an immunoglobulin constant domain sequence, however N-terminal fusions are also possible.
  • the encoded chimeric polypeptide will retain at least functionally active hinge, CH2 and CH3 domains of the constant region of an immunoglobulin heavy chain. Fusions are also made to the C-terminus of the Fc portion of a constant domain, or immediately N-terminal to the CHl of the heavy chain or the corresponding region of the light chain.
  • the precise site at which the fusion is made is not critical; particular sites are well known and may be selected in order to optimize the biological activity, secretion, or binding characteristics of the Fc-fusion protein.
  • the binding domain sequence is fused to the N-terminus of the Fc region of immunoglobulin Gl(IgGl). It is possible to fuse the entire heavy chain constant region to the binding domain sequence. However, more preferably, a sequence beginning in the hinge region just upstream of the papain cleavage site which defines IgG Fc chemically (i. e. residue 216, taking the first residue of heavy chain constant region to be 114), or analogous sites of other immunoglobulins is used in the fusion.
  • the binding domain amino acid sequence is fused to (a) the hinge region and CH2 and CH3 or (b) the CHl, hinge, CH2 and CH3 domains, of an IgG heavy chain.
  • the Fc-fusion proteins are assembled as multimers, and particularly as heterodimers or heterotetramers.
  • these assembled immunoglobulins will have known unit structures.
  • a basic four chain structural unit is the form in which IgG, IgD, and IgE exist.
  • a four chain unit is repeated in the higher molecular weight immunoglobulins; IgM generally exists as a pentamer of four basic units held together by disulfide bonds.
  • IgA globulin, and occasionally IgG globulin may also exist in multimeric form in serum. In the case of multimer, each of the four units may be the same or different.
  • the Fc sequences can be inserted between immunoglobulin heavy chain and light chain sequences, such that an immunoglobulin comprising a chimeric heavy chain is obtained.
  • the Fc sequences are fused to the 3 'end of an immunoglobulin heavy chain in each arm of an immunoglobulin, either between the hinge and the CH2 domain, or between the CH2 and CH3 domains. Similar constructs have been reported by Hoogenboom et al, MoI. Immunol, 28: 1027-1037 (1991).
  • an immunoglobulin light chain might be present either covalently associated to an binding domain-immunoglobulin heavy chain fusion polypeptide, or directly fused to the bdining domain.
  • DNA encoding an immunoglobulin light chain is typically coexpressed with the DNA encoding the binding domain-immunoglobulin heavy chain fusion protein.
  • the hybrid heavy chain and the light chain will be covalently associated to provide an immunoglobulin-like structure comprising two disulfide- linked immunoglobulin heavy chain-light chain pairs.
  • Fc-fusion proteins are most conveniently constructed by fusing the cDNA sequence encoding the binding domain portion in-frame to an immunoglobulin cDNA sequence.
  • fusion to genomic immunoglobulin fragments can also be used (see, e. g. Aruffo et al, Cell, 61 : 1303- 1313 (1990); and Stamenkovic et al, Cell, 66: 1133-1144 (1991)).
  • the latter type of fusion requires the presence of Ig regulatory sequences for expression.
  • cDNAs encoding IgG heavy-chain constant regions can be isolated based on published sequences from cDNA libraries derived from spleen or peripheral blood lymphocytes, by hybridization or by polymerase chain reaction (PCR) techniques.
  • the cDNAs encoding the binding domain and the immunoglobulin parts of the Fc-fusion protein are inserted in tandem into a plasmid vector that directs efficient expression in the chosen host cells.
  • Fc sequences useful for creating Fc fusion molecules for use in the present invention include six versions of a modified human IgGl Fc and are named Fc-488 (SEQ ID NO:76), as well as Fc4 (SEQ ID NO:77), Fc5 (SEQ ID NO:74), Fc6 (SEQ ID NO:78), and Fc7 (SEQ ID NO:79).
  • Fc4, Fc5, and Fc6 contain mutations to reduce effector functions mediated by the Fc by reducing Fc ⁇ RI binding and complement CIq binding.
  • Fc4 contains the same amino acid substitutions that were introduced into Fc-488.
  • Additional amino acid substitutions were introduced to reduce potential Fc mediated effector functions. Specifically, three amino acid substitutions were introduced to reduce Fc ⁇ RI binding. These are the substitutions at EU index positions 234, 235, and 237. Substitutions at these positions have been shown to reduce binding to Fc ⁇ RI (Duncan et al, Nature 332:563 (1988)). These amino acid substitutions may also reduce Fc ⁇ RIIa binding, as well as Fc ⁇ RIII binding (Sondermann et al, Nature 406:267 (2000); Wines et al, J. Immunol 164:5313 (2000)).
  • Fc6 is identical to Fc5 except that the carboxyl terminal lysine codon has been eliminated.
  • the C-terminal lysine of mature immunoglobulins is often removed from mature immunoglobulins post-translationally prior to secretion from B-cells, or removed during serum circulation. Consequently, the C-terminal lysine residue is typically not found on circulating antibodies.
  • the stop codon in the Fc6 sequence was changed to TAA.
  • Fc7 is identical to the wild-type ⁇ l Fc except for an amino acid substitution at EU index position 297 located in the Cm domain.
  • EU index position Asn-297 is a site of N-lmked carbohydrate attachment.
  • N-linked carbohydrate introduces a potential source of variability in a recombinantly expressed protein due to potential batch-to-batch variations in the carbohydrate structure.
  • Asn-297 was mutated to a glutamine residue to prevent the attachment of N-linked carbohydrate at that residue position.
  • the carbohydrate at residue 297 is also involved in Fc binding to the FcRIII (Sondermann et al, Nature 406:267 (2000)). Therefore, removal of the carbohydrate should decrease binding of recombinant Fc7 containing fusion proteins to the Fc ⁇ Rs in general.
  • the stop codon in the Fc7 sequence was mutated to TAA.
  • Leucine zipper forms of these molecules are also contemplated by the invention.
  • "Leucine zipper” is a term in the art used to refer to a leucine rich sequence that enhances, promotes, or drives dimerization ortrimerization of its fusion partner (e. g. , the sequence or molecule to which the leucine zipper is fused or linked to).
  • Various leucine zipper polypeptides have been described in the art. See, e. g., Landschulz et al, Science, 240: 1759 (1988); US Patent 5,716,805; WO 94/10308; Hoppe et al, FEBS Letters, 344: 1991 (1994); Maniatis et al, Nature, 341 : 24 (1989).
  • a leucine zipper sequence may be fused at either the 5'or 3'end of the polypeptide of this invention.
  • Fusion proteins may generally be prepared using standard techniques, including chemical conjugation. Fusion proteins can also be expressed as recombinant proteins in an expression system by standard techniques. Suitable linkers are further described herein, infra.
  • a linker can be naturally-occurring, synthetic, or a combination of both.
  • a synthetic linker can be a randomized linker, e.g., both in sequence and size.
  • the randomized linker can comprise a fully randomized sequence, or optionally, the randomized linker can be based on natural linker sequences.
  • the linker can comprise, for example, a non-polypeptide moiety (e.g., a polynucleotide), a polypeptide, or the like.
  • a linker can be rigid, or alternatively, flexible, or a combination of both. Linker flexibility can be a function of the composition of both the linker and the subunits that the linker interacts with.
  • the linker joins two selected binding entities (e.g., two separate polypeptides or proteins, such as two different antibodies) and maintains the entities as separate and discrete.
  • the linker can allow the separate, discrete domains to cooperate yet maintain separate properties such as multiple separate binding sites for the same target in a multimer or, for example, multiple separate binding sites for different targets in a multimer.
  • a disulfide bridge exists between two linked binding entities or between a linker and a binding entity.
  • Choosing a suitable linker for a specific case where two or more binding entities are to be connected may depend on a variety of parameters including, e.g., the nature of the binding entities, the structure and nature of the target to which the bispecific composition should bind, and/or the stability of the linker (e.g., peptide linker) towards proteolysis and oxidation.
  • the linker e.g., peptide linker
  • Particularly suitable linker polypeptides predominantly include amino acid residues selected from Glycine (GIy), Serine (Ser), Alanine (Ala), and Threonine (Thr).
  • the peptide linker may contain at least 75% (calculated on the basis of the total number of residues present in the peptide linker), such as at least 80%, at least 85%, or at least 90% of amino acid residues selected from GIy, Ser, Ala, and Thr.
  • the peptide linker may also consist of GIy, Ser, Ala and/or Thr residues only.
  • the linker polypeptide should have a length that is adequate to link two binding entities in such a way that they assume the correct conformation relative to one another so that they retain the desired activity, such as binding to a target molecule as well as other activities that may be associated with such target binding (e.g., agonistic or antagonistic activity for a given biomolecule).
  • a suitable length for this purpose is, e.g., a length of at least one and typically fewer than about 50 amino acid residues, such as 2-25 amino acid residues, 5-20 amino acid residues, 5-15 amino acid residues, 8-12 amino acid residues or 11 residues.
  • Other suitable polypeptide linker sizes may include, e.g., from about 2 to about 15 amino acids, from about 3 to about 15, from about 4 to about 12, about 10, about 8, or about 6 amino acids.
  • the amino acid residues selected for inclusion in the linker polypeptide should exhibit properties that do not interfere significantly with the activity or function of the polypeptide multimer.
  • the peptide linker should, on the whole, not exhibit a charge that would be inconsistent with the activity or function of the multimer, or interfere with internal folding, or form bonds or other interactions with amino acid residues in one or more of the domains that would seriously impede the binding of the multimer to the target in question.
  • the use of naturally occurring as well as artificial peptide linkers to connect polypeptides into novel linked fusion polypeptides is well-known in the art. (See, e.g., Hallewell et al, J. Biol. Chem. 264, 5260-5268, 1989; Alfthan et al, Protein Eng.
  • peptide linkers are widely used for production of single-chain antibodies where the variable regions of a light chain (V L ) and a heavy chain (V H ) are joined through an artificial linker, and a large number of publications exist within this particular field.
  • a widely used peptide linker is a 15 mer consisting of three repeats of a Gly-Gly-Gly-Gly-Ser amino acid sequence ((Gly 4 Ser) 3 ) (SEQ ID NO:73).
  • Other linkers have been used, and phage display technology, as well as selective infective phage technology, has been used to diversify and select appropriate linker sequences (Tang et al, J. Biol. Chem.
  • Peptide linkers have been used to connect individual chains in hetero- and homo-dimeric proteins such as the T-cell receptor, the lambda Cro repressor, the P22 phage Arc repressor, IL- 12, TSH, FSH, IL-5, and interferon- ⁇ . Peptide linkers have also been used to create fusion polypeptides. Various linkers have been used, and, in the case of the Arc repressor, phage display has been used to optimize the linker length and composition for increased stability of the single-chain protein (see Robinson and Sauer, Proc. Natl. Acad. ScL USA 95, 5929-5934, 1998).
  • Still another way of obtaining a suitable linker is by optimizing a simple linker (e.g., (Gly 4 Ser) n ) through random mutagenesis.
  • a simple linker e.g., (Gly 4 Ser) n
  • the peptide linker possess at least some flexibility. Accordingly, in some variations, the peptide linker contains 1-25 glycine residues, 5- 20 glycine residues, 5-15 glycine residues, or 8-12 glycine residues. Particularly suitable peptide linkers typically contain at least 50% glycine residues, such as at least 75% glycine residues. In some embodiments, a peptide linker comprises glycine residues only. In certain variations, the peptide linker comprises other residues in addition to the glycine. Preferred residues in addition to glycine include Ser, Ala, and Thr, particularly Ser.
  • a peptide linker comprises at least one proline residue in the amino acid sequence of the peptide linker.
  • a peptide linker can have an amino acid sequence wherein at least 25% (e.g., at least 50% or at least 75%) of the amino acid residues are proline residues.
  • the peptide linker comprises proline residues only.
  • a peptide linker is modified in such a way that an amino acid residue comprising an attachment group for a non-polypeptide moiety is introduced.
  • amino acid residues may be a cysteine or a lysine residue (to which the non-polypeptide moiety is then subsequently attached).
  • Another alternative is to include an amino acid sequence having an in vivo N- glycosylation site (thereby attaching a sugar moiety (in vivo) to the peptide linker).
  • An additional option is to genetically incorporate non-natural amino acids using evolved tRNAs and tRNA synthetases (see, e.g., U.S. Patent Application Publication 2003/0082575) into a polypeptide binding entity or peptide linker. For example, insertion of keto-tyrosine allows for site-specific coupling to an expressed polypeptide.
  • a peptide linker comprises at least one cysteine residue, such as one cysteine residue.
  • a peptide linker comprises at least one cysteine residue and amino acid residues selected from the group consisting of GIy, Ser, Ala, and Thr.
  • a peptide linker comprises glycine residues and cysteine residues, such as glycine residues and cysteine residues only. Typically, only one cysteine residue will be included per peptide linker.
  • a specific peptide linker comprising a cysteine residue includes a peptide linker having the amino acid sequence Gly n -Cys-Gly m , wherein n and m are each integers from 1-12, e.g., from 3-9, from 4-8, or from 4-7.
  • the present invention comprise bispecific binding proteins comprising a bispecific antibody/soluble receptor combination of an FGFR and an anti- VEGF-A antibody.
  • the FGFR and anti-VEGF-A antibodies are covalently linked (e.g., via a peptide linker) to form a bispecific binding protein.
  • the bispecific binding protein comprises an immunoglobulin heavy chain constant region such as, for example, an Fc fragment.
  • Particularly suitable Fc fragments include, for example, Fc fragments comprising an Fc region modified to reduce or eliminate one or more effector functions (e.g., Fc5, having the amino acid sequence shown in SEQ ID NO: 74).
  • a VEGF-A antibody/soluble FGF receptor bispecific binding protein that reduces the activity of both VEGF-A and FGF in accordance with the present invention comprises a binding region of an anti-VEGF-A antibody moiety as described herein and a FGF binding moiety of an FGFR3 as described herein .
  • the FGF binding moiety is an FGFR3III C as described herein.
  • the FGF binding moiety is an FGF receptor moiety, and can be FGFR3, and in particular is FGFR3m c as described herein.
  • a bispecific antibody/soluble receptor protein comprises an FGF receptor moiety that is an FGFR3 selected from the group consisting of FGFR3m c (23-375) as shown in SEQ ID NO: 13, FGFR3 ⁇ io(23-375)(S249W) as shown in SEQ ID NO:2, FGFR3 rac (143-375) as shown in SEQ ID NO: 19, FGFR3 mc (143-375)(S249W), as shown in SEQ ID NO:10, FGFR3 rac (23-375)(P250R) as shown in SEQ ID NO: 15, and FGFR3 fflc (143-375)(P250R) as shown in SEQ ID NO:22; in combination with a VEGF-A antibody moiety selected from the group consisting of c870.1e6 scFV as shown in SEQ ID NO:44, clO94.1 scFV as shown in SEQ ID NO:46, c870 sc
  • a bispecific antibody/soluble receptor combination comprises an FGF binding moiety that is an FGFR3 selected from the group consisting of FGFR3 mc (23-375) as shown in SEQ ID NO: 13, FGFR3 rac (23- 375)(S249W) as shown in SEQ ID NO:2, FGFR3 rac (143-375) as shown in SEQ ID NO:19, FGFR3 ⁇ i c (143-375)(S249W), as shown in SEQ ID NO:10, FGFR3 mc (23-375)(P250R) as shown in SEQ ID NO: 15, FGFR3 mc (143-375)(P250R) as shown in SEQ ID NO:22, and VEGF-A binding moiety selected from the group consisting of a c870 VL as shown in SEQ ID NO:48 and VH as shown in SEQ ID NO:50, a clO94 VL as shown in SEQ ID NO:54 and VH as shown
  • the bispecific binding protein of the present invention embodies an FGFR3 moiety and VEGF-A antibody moiety selected from the group consisting of FGFR3(143- 375)(S249W)Fc5 clO94.1 pZMP31 (SEQ ID NO:58); FGFR3(23-375)(S249W)Fc5 clO94.1 pZMP31 (SEQ ID NO:60); FGFR3(143-375)(S249W)Fc5 c870e6 pZMP31 (SEQ ID NO:62); and FGFR3(23- 375)(S249W)Fc5 c870e6 pZMP31 (SEQ ID NO:64).
  • the FGF binding moiety is FGFR2.
  • the FGFR2 comprises FGFR2 IIIc .
  • a bispecific antibody/soluble receptor combinations comprises an FGF binding moiety that is an FGFR2 selected from the group consisting of FGFR2mo(22-377) as shown in SEQ ID NO:24, FGFR2 fflc (22-377)(S252W) as shown in SEQ ID NO:29, FGFR2 ⁇ ic(22-377)(P253R) as shown in SEQ ID NO:33, FGFR2 IIIc (145-377), as shown in SEQ ID NO:37, FGFR2 fflc (145-377)(S252W) as shown in SEQ ID NO:40, and FGFR2 fflc (145-377)(P253R) as shown in SEQ ID NO:42; and VEGF-A binding moiety selected from the group consisting of c870.1e6 s
  • a bispecific antibody/soluble receptor combination comprises an FGF binding moiety that is an FGFR2 selected from the group consisting of FGFR2 IIIc (22-377) as shown in SEQ ID NO:24, FGFR2 IIIc (22- 377)(S252W) as shown in SEQ ID NO:29, FGFR2 rac (22-377)(P253R) as shown in SEQ ID NO:33, FGFR2 ⁇ io(145-377), as shown in SEQ ID NO:37, FGFR 2mc (145-377)(S252W) as shown in SEQ ID NO:40, and FGFR2 rac (145-377)(P253R) as shown in SEQ ID NO:42; and VEGF-A binding moiety selected from the group consisting a c870 VL as shown in SEQ ID NO:48 and VH as shown in SEQ ID NO:50, a clO94 VL as shown in SEQ ID NO:54 and VH as shown
  • the soluble FGFR polypeptides of the invention can be prepared by expressing a DNA encoding the extracellular domain or portions thereof.
  • a polynucleotide sequence that encodes for a polypeptide which contains residues 36-388 of SEQ ID NO: 13 can be used to prepare FGFR3 ⁇ i c .
  • An N-terminally truncated FGFR3m c can be using a polynucleotide encoding residues 36- 268 of SEQ ID NO: 19.
  • FGFR2 mc a polynucleotide encoding residues 36-391 of SEQ ID NO:24 can be used.
  • a polynucleotide sequence that encodes for a polypeptide which contains residues 36-268 of SEQ ID NO:37 can be used to prepare an N-terminally truncated FGFR2 ⁇ i c . It is preferred that the extracellular domain polypeptides be prepared in a form substantially free of transmembrane and intracellular polypeptide segments.
  • the receptor DNA is linked to a second DNA segment encoding a secretory peptide, such as the receptor's native signal sequence.
  • Other signal sequences that could be used include tPA signal sequence (described in the Examples below), CD33 signal sequence or human growth hormone signal sequence.
  • a C- terminal extension such as a poly-histidine tag, substance P, FlagTM peptide (Hopp et al, Biotechnology 6: 1204-1210, 1988; available from Eastman Kodak Co., New Haven, CT) or another polypeptide or protein for which an antibody or other specific binding agent is available, can be fused to the receptor polypeptide.
  • the invention also includes nucleic acids encoding the heavy chain and/or light chain of the antibodies of the invention.
  • Nucleic acids of the invention include nucleic acids having a region that is substantially identical to a V L - and/or V H - encoding polynucleotide as listed in Table 2, supra.
  • Nucleic acids of the invention also include complementary nucleic acids. In some instances, the sequences will be fully complementary (no mismatches) when aligned. In other instances, there may be up to about a 20% mismatch in the sequences. In some embodiments of the invention are provided nucleic acids encoding both a heavy chain and a light chain of an antibody of the invention.
  • the present invention provides one or more polynucleotide(s) (e.g., DNA or RNA) that encode an FGFR and/or VEGF-A antibody as described herein.
  • a polynucleotide of the present invention encodes a VEGF-A antibody/soluble FGF receptor bispecific binding protein that binds and reduces the activity of both FGF and VEGF-A.
  • Nucleic acids of the present invention can be cloned into a vector, such as a plasmid, cosmid, bacmid, phage, artificial chromosome (BAC, YAC) or virus, into which another genetic sequence or element (either DNA or RNA) may be inserted so as to bring about the replication of the attached sequence or element.
  • the expression vector contains a constitutively active promoter segment (such as but not limited to CMV, SV40, Elongation Factor or LTR sequences) or an inducible promoter sequence such as the steroid inducible pIND vector (Invitrogen), where the expression of the nucleic acid can be regulated.
  • Expression vectors of the invention may further comprise regulatory sequences, for example, an internal ribosomal entry site.
  • the expression vector can be introduced into a cell by, for example, transfection.
  • proteins for use within the present invention can be produced in genetically engineered host cells according to conventional techniques.
  • Suitable host cells are those cell types that can be transformed or transfected with exogenous DNA and grown in culture, and include bacteria, fungal cells, and cultured higher eukaryotic cells (including cultured cells of multicellular organisms), particularly cultured mammalian cells.
  • Techniques for manipulating cloned DNA molecules and introducing exogenous DNA into a variety of host cells are disclosed by Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989), and Ausubel et al., supra.
  • a DNA sequence encoding a protein of interest is operably linked to other genetic elements required for its expression, generally including a transcription promoter and terminator, within an expression vector.
  • the vector will also commonly contain one or more selectable markers and one or more origins of replication, although those skilled in the art will recognize that within certain systems selectable markers may be provided on separate vectors, and replication of the exogenous DNA may be provided by integration into the host cell genome. Selection of promoters, terminators, selectable markers, vectors and other elements is a matter of routine design within the level of ordinary skill in the art. Many such elements are described in the literature and are available through commercial suppliers.
  • a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in the expression vector.
  • the secretory signal sequence may be that of the native form of the recombinant protein, or may be derived from another secreted protein (e.g., t-PA; see U.S. Patent No. 5,641,655) or synthesized de novo.
  • the secretory signal sequence is operably linked to the protein-encoding DNA sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell.
  • Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the polypeptide of interest, although certain signal sequences may be positioned elsewhere in the DNA sequence of interest (see, e.g., Welch et al, U.S. Patent No. 5,037,743; Holland et al, U.S. Patent No. 5,143,830).
  • a secretory signal sequence for use in accordance with the present invention has an amino acid sequence selected from the group consisting of residues 1-35 of SEQ ID NOS:2, 10, 13, 15, 19, 22, 24, 29, 33, 37, 40, 42, 58, 60, 62, and 64.
  • Cultured mammalian cells are suitable hosts for production of recombinant proteins for use within the present invention.
  • Methods for introducing exogenous DNA into mammalian host cells include calcium phosphate -mediated transfection (Wigler et al, Cell 14:725, 1978; Corsaro and Pearson, Somatic Cell Genetics 7:603, 1981 : Graham and Van der Eb, Virology 52:456, 1973), electroporation (Neumann et al., EMBO J.
  • suitable mammalian host cells include African green monkey kidney cells (Vero; ATCC CRL 1587), human embryonic kidney cells (293-HEK; ATCC CRL 1573), baby hamster kidney cells (BHK-21, BHK-570; ATCC CRL 8544, ATCC CRL 10314), canine kidney cells (MDCK; ATCC CCL 34), Chinese hamster ovary cells (CHO-Kl; ATCC CCL61; CHO DG44; CHO DXBI l (Hyclone, Logan, UT); see also, e.g., Chasin et al, Som. Cell. Molec. Genet.
  • rat pituitary cells GHl; ATCC CCL82), HeLa S3 cells (ATCC CCL2.2), rat hepatoma cells (H-4-II-E; ATCC CRL 1548) SV40-transformed monkey kidney cells (COS-I; ATCC CRL 1650) and murine embryonic cells (NIH-3T3; ATCC CRL 1658).
  • GHl rat pituitary cells
  • HeLa S3 cells ATCC CCL2.2
  • rat hepatoma cells H-4-II-E
  • COS-I SV40-transformed monkey kidney cells
  • NIH-3T3 ATCC CRL 1658
  • Additional suitable cell lines are known in the art and available from public depositories such as the American Type Culture Collection, Manassas, Virginia. Strong transcription promoters can be used, such as promoters from SV-40 or cytomegalovirus. See, e.g., U.S. Patent No. 4,956,288.
  • Other suitable promoters
  • Drug selection is generally used to select for cultured mammalian cells into which foreign DNA has been inserted. Such cells are commonly referred to as “transfectants.” Cells that have been cultured in the presence of the selective agent and are able to pass the gene of interest to their progeny are referred to as “stable transfectants.”
  • Exemplary selectable markers include a gene encoding resistance to the antibiotic neomycin, which allows selection to be carried out in the presence of a neomycin-type drug, such as G-418 or the like; the gpt gene for xanthine-guanine phosphoribosyl transferase, which permits host cell growth in the presence of mycophenolic acid/xanthine; and markers that provide resistance to zeocin, bleomycin, blastocidin, and hygromycin (see, e.g., Gatignol et al, MoI Gen.
  • Selection systems can also be used to increase the expression level of the gene of interest, a process referred to as "amplification.” Amplification is carried out by culturing transfectants in the presence of a low level of the selective agent and then increasing the amount of selective agent to select for cells that produce high levels of the products of the introduced genes.
  • An exemplary amplifiable selectable marker is dihydrofolate reductase, which confers resistance to methotrexate.
  • Other drug resistance genes e.g., hygromycin resistance, multi-drug resistance, puromycin acetyltransferase
  • drug resistance genes e.g., hygromycin resistance, multi-drug resistance, puromycin acetyltransferase
  • Other higher eukaryotic cells can also be used as hosts, including insect cells, plant cells and avian cells.
  • Agrobacterium rhizogenes as a vector for expressing genes in plant cells has been reviewed by Sinkar et al, J. Biosci. (Bangalore) 11 :47-58, 1987. Transformation of insect cells and production of foreign polypeptides therein is disclosed by Guarino et al, U.S. Patent No. 5,162,222 and WIPO publication WO 94/06463.
  • Insect cells can be infected with recombinant baculovirus, commonly derived from Autographa californica nuclear polyhedrosis virus (AcNPV). See King and Possee, The Baculovirus Expression System: A Laboratory Guide (Chapman & Hall, London); O'Reilly et al., Baculovirus Expression Vectors: A Laboratory Manual (Oxford University Press., New York 1994); and Baculovirus Expression Protocols. Methods in Molecular Biology (Richardson ed., Humana Press, Totowa, NJ, 1995). Recombinant baculovirus can also be produced through the use of a transposon- based system described by Luckow et al. (J. Virol.
  • This system which utilizes transfer vectors, is commercially available in kit form (BAC-TO-BAC kit; Life Technologies, Gaithersburg, MD).
  • the transfer vector e.g., PFASTBACl; Life Technologies
  • the transfer vector contains a Tn7 transposon to move the DNA encoding the protein of interest into a baculovirus genome maintained in E. coli as a large plasmid called a "bacmid.” See Hill-Perkins and Possee, J. Gen. Virol. 71 :971-976, 1990; Bonning et al., J. Gen. Virol. 75:1551-1556, 1994; and Chazenbalk and Rapoport, J. Biol. Chem. 270: 1543-1549, 1995.
  • transfer vectors can include an in- frame fusion with DNA encoding a polypeptide extension or affinity tag as disclosed above.
  • a transfer vector containing a protein-encoding DNA sequence is transformed into E. coli host cells, and the cells are screened for bacmids which contain an interrupted lacZ gene indicative of recombinant baculovirus.
  • the bacmid DNA containing the recombinant baculovirus genome is isolated, using common techniques, and used to transfect Spodoptera frugiperda cells, such as Sf9 cells.
  • Recombinant virus that expresses the protein or interest is subsequently produced.
  • Recombinant viral stocks are made by methods commonly used in the art.
  • the recombinant virus is used to infect host cells, typically a cell line derived from the fall armyworm, Spodoptera frugiperda (e.g., Sf9 or Sf21 cells) or Trichoplusia ni (e.g., HIGH FIVE cells; Invitrogen, Carlsbad, CA). See generally Glick and Pasternak, Molecular Biotechnology, Principles & Applications of Recombinant DNA (ASM Press, Washington, D. C, 1994). See also U.S. Patent No. 5,300,435. Serum- free media are used to grow and maintain the cells. Suitable media formulations are known in the art and can be obtained from commercial suppliers.
  • the cells are grown up from an inoculation density of approximately 2-5 x 10 5 cells to a density of 1 -2 x 10 6 cells, at which time a recombinant viral stock is added at a multiplicity of infection (MOI) of 0.1 to 10, more typically near 3.
  • MOI multiplicity of infection
  • Fungal cells including yeast cells, can also be used within the present invention.
  • Yeast species of particular interest in this regard include Saccharomyces cerevisiae, Pichia pastoris, and Pichia methanolica.
  • Methods for transforming S. cerevisiae cells with exogenous DNA and producing recombinant polypeptides therefrom are disclosed by, for example, Kawasaki, U.S. Patent No. 4,599,311; Kawasaki et al, U.S. Patent No. 4,931,373; Brake, U.S. Patent No. 4,870,008; Welch et al, U.S. Patent No. 5,037,743; and Murray et al, U.S. Patent No. 4,845,075.
  • Transformed cells are selected by phenotype determined by the selectable marker, commonly drug resistance or the ability to grow in the absence of a particular nutrient (e.g., leucine).
  • An exemplary vector system for use in Saccharomyces cerevisiae is the POTl vector system disclosed by Kawasaki et al (U.S. Patent No. 4,931,373), which allows transformed cells to be selected by growth in glucose-containing media.
  • Suitable promoters and terminators for use in yeast include those from glycolytic enzyme genes (see, e.g., Kawasaki, U.S. Patent No. 4,599,311; Kingsman et al, U.S. Patent No. 4,615,974; and Bitter, U.S. Patent No.
  • Prokaryotic host cells including strains of the bacteria Escherichia coli, Bacillus, and other genera are also useful host cells within the present invention. Techniques for transforming these hosts and expressing foreign DNA sequences cloned therein are well known in the art (see, e.g., Sambrook et al, supra). When expressing a recombinant protein in bacteria such as E. coli, the protein may be retained in the cytoplasm, typically as insoluble granules, or may be directed to the periplasmic space by a bacterial secretion sequence.
  • the cells are lysed, and the granules are recovered and denatured using, for example, guanidine isothiocyanate or urea.
  • the denatured protein can then be refolded and dimerized by diluting the denaturant, such as by dialysis against a solution of urea and a combination of reduced and oxidized glutathione, followed by dialysis against a buffered saline solution.
  • the protein may be recovered from the cytoplasm in soluble form and isolated without the use of denaturants.
  • the protein is recovered from the cell as an aqueous extract in, for example, phosphate buffered saline.
  • the extract is applied directly to a chromatographic medium, such as an immobilized antibody or heparin-Sepharose column.
  • Secreted proteins can be recovered from the periplasmic space in a soluble and functional form by disrupting the cells (by, for example, sonication or osmotic shock) to release the contents of the periplasmic space and recovering the protein, thereby obviating the need for denaturation and refolding.
  • Antibodies, including single-chain antibodies can be produced in bacterial host cells according to known methods. See, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. ScL USA 85:5879-5883, 1988; and Pantoliano et al., Biochem. 30: 10117-10125, 1991.
  • Transformed or transfected host cells are cultured according to conventional procedures in a culture medium containing nutrients and other components required for the growth of the chosen host cells.
  • suitable media including defined media and complex media, are known in the art and generally include a carbon source, a nitrogen source, essential amino acids, vitamins and minerals. Media may also contain such components as growth factors or serum, as required.
  • the growth medium will generally select for cells containing the exogenously added DNA by, for example, drug selection or deficiency in an essential nutrient which is complemented by the selectable marker carried on the expression vector or co-transfected into the host cell.
  • Bispecific binding proteins comprising VEGF-A antibody/soluble FGF receptor bispecific binding proteins are purified by conventional protein purification methods, typically by a combination of chromatographic techniques. See generally Affinity Chromatography: Principles & Methods (Pharmacia LKB Biotechnology, Uppsala, Sweden, 1988); Scopes, Protein Purification: Principles and Practice (Springer-Verlag, New York 1994). Proteins comprising an immunoglobulin heavy chain polypeptide can be purified by affinity chromatography on immobilized protein A. Additional purification steps, such as gel filtration, can be used to obtain the desired level of purity or to provide for desalting, buffer exchange, and the like.
  • Antibodies can be purified from cell culture media by known methods, such as affinity chromatography using conventional columns and other equipment.
  • conditioned medium is harvested and may be stored at 4°C for up to five days.
  • a bacteriostatic agent e.g., sodium azide
  • the pH of the medium is lowered (typically to Ph ⁇ 5.5), such as by the addition of glacial acetic acid dropwise.
  • the lower pH provides for optimal capture of IgG via a protein G resin.
  • the protein G column size is determined based on the volume of the conditioned medium.
  • the packed column is neutralized with a suitable buffer, such as 35 mM NaPO/t, 120 mM NaCl pH 7.2.
  • the medium is then passed over the neutralized protein g resin at a flow rate determined by both the volume of the medium and of the column size. The flowthrough is retained for possible additional passes over the column.
  • the resin with the captured antibody is then washed into the neutralizing buffer.
  • the column is eluted into fractions using an acidic elution buffer, such as 0.1M glycine, pH 2.7 or equivalent. Each fraction is neutralized, such as with 2M tris, pH 8.0 at a 1 :20 ratio tris:glycine. Protein containing fractions (e.g., based on A 2 8o) are pooled.
  • the pooled fractions are buffer exchanged into a suitable buffer, such as 35mM NaPO/t, 120 mM NaCl pH 7.2 using a desalting column. Concentration is determined by A 2 so using an extinction coefficient of 1.44. Endotoxin levels may be determined by LAL assay. Purified protein may be stored frozen, typically at -80 0 C.
  • Cells expressing functional VEGF-A antibody/soluble FGF receptor bispecific binding proteins are used within screening assays.
  • a variety of suitable assays are known in the art. These assays are based on the detection of a biological response in a target cell.
  • One such assay is a cell proliferation assay. Cells are cultured in the presence or absence of a test compound, and cell proliferation is detected by, for example, measuring incorporation of tritiated thymidine or by colorimetric assay based on the metabolic breakdown of 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT) (Mosman, J. Immunol. Meth. 65: 55-63, 1983).
  • MTT 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide
  • An alternative assay format uses cells that are further engineered to express a reporter gene.
  • the reporter gene is linked to a promoter element that is responsive to the receptor-linked pathway, and the assay detects activation of transcription of the reporter gene.
  • a preferred promoter element in this regard is a serum response element, or SRE.
  • SRE serum response element
  • a preferred such reporter gene is a luciferase gene.
  • Expression of the luciferase gene is detected by luminescence using methods known in the art. (See, e.g., Baumgartner et al., J. Biol. Chem.
  • Luciferase activity assay kits are commercially available from, for example, Promega Corp., Madison, WI.
  • Target cell lines of this type can be used to screen libraries of chemicals, cell-conditioned culture media, fungal broths, soil samples, water samples, and the like. For example, a bank of cell- conditioned media samples can be assayed on a target cell to identify cells that produce ligand. Positive cells are then used to produce a cDNA library in a mammalian expression vector, which is divided into pools, transfected into host cells, and expressed. Media samples from the transfected cells are then assayed, with subsequent division of pools, re-transfection, subculturing, and re-assay of positive cells to isolate a cloned cDNA encoding the ligand.
  • the present invention provides methods of inhibiting angiogenesis, particularly methods for treatment of diseases or disorders associated with angiogenesis.
  • such methods include administering to a subject a bispecific binding protein comprising a bispecific antibody/soluble receptor combination in an amount effective to inhibit angiogenesis.
  • the bispecific binding protein is administered to a subject suffering from, or at an elevated risk of developing, a disease or disorder characterized by increased angiogenesis (a "neovascular disorder").
  • Neovascular disorders amenable to treatment in accordance with the present invention include, for example, cancers characterized by solid tumor growth (e.g., pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, non-small cell lung cancer (NSCLC), glioblastoma, and gastrointestinal stromal tumor (GIST)) as well as various neovascular ocular disorders (e.g., age-related macular degeneration, diabetic retinopathy, iris neovascularization, and neovascular glaucoma).
  • solid tumor growth e.g., pancreatic cancer, renal cell carcinoma (RCC), colorectal cancer, non-small cell lung cancer (NSCLC), glioblastoma, and gastrointestinal stromal tumor (GIST)
  • various neovascular ocular disorders e.g., age-related macular degeneration, diabetic retinopathy, iris neovascularization, and neovascular glaucoma.
  • neovascular disorders amenable to treatment in accordance with the present invention include, for example, rheumatoid arthritis, psoriasis, atherosclerosis, chronic inflammation, lung inflammation, preeclampsia, pericardial effusion (such as that associated with pericarditis), and pleural effusion.
  • the bispecific binding protein comprising a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is delivered in a manner consistent with conventional methodologies associated with management of the disease or disorder for which treatment is sought.
  • an effective amount of the antagonists is administered to a subject in need of such treatment for a time and under conditions sufficient to prevent or treat the disease or disorder.
  • Subjects for administration of bispecific binding proteins as described herein include patients at high risk for developing a particular disease or disorder associated with angiogenesis as well as patients presenting with an existing neovascular disorder.
  • the subject has been diagnosed as having the disease or disorder for which treatment is sought. Further, subjects can be monitored during the course of treatment for any change in the disease or disorder (e.g., for an increase or decrease in clinical symptoms of the disease or disorder).
  • pharmaceutical compositions or medicants are administered to a patient susceptible to, or otherwise at risk of, a particular disease in an amount sufficient to eliminate or reduce the risk or delay the outset of the disease.
  • compositions or medicants are administered to a patient suspected of, or already suffering from such a disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease and its complications.
  • An amount adequate to accomplish this is referred to as a therapeutically- or pharmaceutically- effective dose or amount.
  • agents are usually administered in several dosages until a sufficient response (e.g. , inhibition of inappropriate angiogenesis activity) has been achieved. Typically, the response is monitored and repeated dosages are given if the desired response starts to fade.
  • accepted screening methods may be employed to determine risk factors associated with specific neovascular disorders or to determine the status of an existing disorder identified in a subject. Such methods can include, for example, determining whether an individual has relatives who have been diagnosed with a particular disease. Screening methods can also include, for example, conventional work-ups to determine familial status for a particular disease known to have a heritable component. For example, various cancers are also known to have certain inheritable components.
  • Inheritable components of cancers include, for example, mutations in multiple genes that are transforming (e.g., Ras, Raf, EGFR, cMet, and others), the presence or absence of certain HLA and killer inhibitory receptor (KIR) molecules, or mechanisms by which cancer cells are able to modulate immune suppression of cells like NK cells and T cells, either directly or indirectly (see, e.g., Ljunggren and Malmberg, Nature Rev. Immunol. 7:329-339, 2007; Boyton and Altmann, Clin. Exp. Immunol. 149:1- 8, 2007).
  • KIR HLA and killer inhibitory receptor
  • nucleotide probes can be routinely employed to identify individuals carrying genetic markers associated with a particular disease of interest.
  • angiogenesis may be implemented as an independent treatment program or as a follow-up, adjunct, or coordinate treatment regimen to other treatments.
  • the bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is formulated as a pharmaceutical composition.
  • a pharmaceutical composition comprising a bispecific VEGF-A antibody/FGFR soluble receptor combination can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the therapeutic molecule is combined in a mixture with a pharmaceutically acceptable carrier.
  • a composition is said to be a "pharmaceutically acceptable carrier" if its administration can be tolerated by a recipient patient.
  • Sterile phosphate -buffered saline is one example of a pharmaceutically acceptable carrier.
  • Other suitable carriers are well-known to those in the art.
  • Formulations may further include one or more excipients, preservatives, solubilizers, buffering agents, albumin to prevent protein loss on vial surfaces, etc.
  • Monospecific antagonists can be individually formulated or provided in a combined formulation.
  • a pharmaceutical composition comprising a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is administered to a subject in an effective amount.
  • an antagonist may be administered to subjects by a variety of administration modes, including, for example, by intramuscular, subcutaneous, intravenous, intra-atrial, intra-articular, parenteral, intranasal, intrapulmonary, transdermal, intrapleural, intrathecal, and oral routes of administration.
  • the bispecific binding proteins are typically formulated for intravitreal injection according to conventional methods.
  • an antagonist may be administered to a subject in a single bolus delivery, via continuous delivery (e.g., continuous transdermal delivery) over an extended time period, or in a repeated administration protocol (e.g., on an hourly, daily, or weekly basis).
  • a "therapeutically effective amount" of a composition is that amount that produces a statistically significant effect, such as a statistically significant reduction in disease progression or a statistically significant improvement in organ function.
  • the exact dose will be determined by the clinician according to accepted standards, taking into account the nature and severity of the condition to be treated, patient traits, etc. Determination of dose is within the level of ordinary skill in the art.
  • Effective dosages of the compositions of the present invention vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, whether treatment is prophylactic or therapeutic, as well as the specific activity of the composition itself and its ability to elicit the desired response in the individual.
  • the patient is a human, but in some diseases, the patient can be a nonhuman mammal.
  • dosage regimens are adjusted to provide an optimum therapeutic response, i.e., to optimize safety and efficacy. Accordingly, a therapeutically or prophylactically effective amount is also one in which any undesired collateral effects are outweighed by beneficial effects of inhibiting angiogenesis.
  • a dosage typically ranges from about 0.1 ⁇ g to 100 mg/kg or 1 ⁇ g/kg to about 50 mg/kg, and more usually 10 ⁇ g to 5 mg/kg of the subject's body weight.
  • an effective amount of the agent is between about 1 ⁇ g/kg and about 20 mg/kg, between about 10 ⁇ g/kg and about 10 mg/kg, or between about 0.1 mg/kg and about 5 mg/kg. Dosages within this range can be achieved by single or multiple administrations, including, e.g., multiple administrations per day or daily, weekly, bi-weekly, or monthly administrations. For example, in certain variations, a regimen consists of an initial administration followed by multiple, subsequent administrations at weekly or bi-weekly intervals. Another regimen consists of an initial administration followed by multiple, subsequent administrations at monthly or bi-monthly intervals. Alternatively, administrations can be on an irregular basis as indicated by monitoring of NK cell activity and/or clinical symptoms of the disease or disorder.
  • Dosage of the pharmaceutical composition may be varied by the attending clinician to maintain a desired concentration at a target site.
  • local concentration of the agent in the bloodstream at the target tissue may be between about 1-50 nanomoles of the composition per liter, sometimes between about 1.0 nanomole per liter and 10, 15, or 25 nanomoles per liter depending on the subject's status and projected measured response.
  • Higher or lower concentrations may be selected based on the mode of delivery, e.g., trans- epidermal delivery versus delivery to a mucosal surface.
  • Dosage should also be adjusted based on the release rate of the administered formulation, e.g., nasal spray versus powder, sustained release oral or injected particles, transdermal formulations, etc.
  • the release rate of the administered formulation e.g., nasal spray versus powder, sustained release oral or injected particles, transdermal formulations, etc.
  • slow-release particles with a release rate of 5 nanomolar would be administered at about twice the dosage of particles with a release rate of 10 nanomolar.
  • a pharmaceutical composition comprising bispecific binding proteins comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein can be furnished in liquid form, in an aerosol, or in solid form.
  • Liquid forms are illustrated by injectable solutions, aerosols, droplets, topological solutions and oral suspensions.
  • Exemplary solid forms include capsules, tablets, and controlled-release forms. The latter form is illustrated by miniosmotic pumps and implants. (See, e.g., Bremer et al., Pharm. Biotechnol.
  • Liposomes provide one means to deliver therapeutic polypeptides to a subject, e.g., intravenously, intraperitoneally, intrathecally, intramuscularly, subcutaneously, or via oral administration, inhalation, or intranasal administration.
  • Liposomes are microscopic vesicles that consist of one or more lipid bilayers surrounding aqueous compartments.
  • Liposomes are similar in composition to cellular membranes and as a result, liposomes can be administered safely and are biodegradable. Depending on the method of preparation, liposomes may be unilamellar or multilamellar, and liposomes can vary in size with diameters ranging from 0.02 ⁇ m to greater than 10 ⁇ m.
  • a variety of agents can be encapsulated in liposomes: hydrophobic agents partition in the bilayers and hydrophilic agents partition within the inner aqueous space(s).
  • hydrophobic agents partition in the bilayers and hydrophilic agents partition within the inner aqueous space(s).
  • hydrophobic agents partition in the bilayers
  • hydrophilic agents partition within the inner aqueous space(s).
  • it is possible to control the therapeutic availability of the encapsulated agent by varying liposome size, the number of bilayers, lipid composition, as well as the charge and surface characteristics of the liposomes.
  • Liposomes can adsorb to virtually any type of cell and then slowly release the encapsulated agent.
  • an absorbed liposome may be endocytosed by cells that are phagocytic. Endocytosis is followed by intralysosomal degradation of liposomal lipids and release of the encapsulated agents (see Scherphof et al, Ann. N.Y. Acad. Sci. 446:368, 1985).
  • small liposomes 0.1 to 1.0 ⁇ m
  • the reticuloendothelial system can be circumvented by several methods including saturation with large doses of liposome particles, or selective macrophage inactivation by pharmacological means (see Claassen et al., Biochim. Biophys. Acta 802:428, 1984).
  • incorporation of glycolipid- or polyethelene glycol-derivatized phospholipids into liposome membranes has been shown to result in a significantly reduced uptake by the reticuloendothelial system (see Allen et al., Biochim. Biophys. Acta 1068:133, 1991; Allen et al., Biochim. Biophys. Acta 1150:9, 1993).
  • Liposomes can also be prepared to target particular cells or organs by varying phospholipid composition or by inserting receptors or counter-receptors into the liposomes.
  • liposomes prepared with a high content of a nonionic surfactant, have been used to target the liver.
  • a nonionic surfactant See, e.g., Japanese Patent 04-244,018 to Hayakawa et al; Kato et al, Biol. Pharm. Bull. 16:960, 1993.
  • These formulations were prepared by mixing soybean phospatidylcholine, ⁇ - tocopherol, and ethoxylated hydrogenated castor oil (HCO-60) in methanol, concentrating the mixture under vacuum, and then reconstituting the mixture with water.
  • DPPC dipalmitoylphosphatidylcholine
  • SG soybean- derived sterylglucoside mixture
  • Cho cholesterol
  • various targeting counter-receptors can be bound to the surface of the liposome, such as antibodies, antibody fragments, carbohydrates, vitamins, and transport proteins.
  • liposomes can be modified with branched type galactosyllipid derivatives to target asialoglycoprotein (galactose) receptors, which are exclusively expressed on the surface of liver cells.
  • galactose asialoglycoprotein
  • target cells are prelabeled with biotinylated antibodies specific for a counter-receptor expressed by the target cell.
  • biotinylated antibodies specific for a counter-receptor expressed by the target cell.
  • streptavidin-conjugated liposomes are administered.
  • targeting antibodies are directly attached to liposomes.
  • Polypeptides and antibodies can be encapsulated within liposomes using standard techniques of protein microencapsulation.
  • liposomes may contain a variety of components.
  • liposomes may comprise lipid derivatives of poly(ethylene glycol). (See Allen et al, Biochim. Biophys. Acta 1150:9, 1993.)
  • Micro spheres have been designed to maintain high systemic levels of therapeutic proteins.
  • Micro spheres are prepared from degradable polymers such as poly(lactide-co-glycolide) (PLG), polyanhydrides, poly (ortho esters), nonbiodegradable ethylvinyl acetate polymers, in which proteins are entrapped in the polymer.
  • PLG poly(lactide-co-glycolide)
  • PEG polyanhydrides
  • poly (ortho esters) nonbiodegradable ethylvinyl acetate polymers
  • dosage forms can be devised by those skilled in the art, as shown by, e.g., Ansel and Popovich, Pharmaceutical Dosage Forms and Drug Delivery Systems (Lea & Febiger, 5th ed. 1990); Gennaro (ed.), Remington's Pharmaceutical Sciences (Mack Publishing Company, 19th ed. 1995), and Ranade and Hollinger, Drug Delivery Systems (CRC Press 1996).
  • compositions as described herein may also be used in the context of combination therapy.
  • combination therapy is used herein to denote that a subject is administered at least one therapeutically effective dose of a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein and another therapeutic agent.
  • compositions comprising a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein can be used as an angiogenesis inhibition agent in combination with chemotherapy or radiation.
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein can work in synergy with conventional types of chemotherapy or radiation.
  • the bispecific binding proteins can further reduce tumor burden and allow more efficient killing by the chemotherapeutic.
  • compositions of the present invention demonstrating angiogenesis inhibiting activity can also be used in combination with immunomodulatory compounds including various cytokines and co-stimulatory/inhibitory molecules. These could include, but are not limited to, the use of cytokines that stimulate anti-cancer immune responses. For instance, the combined use of IL-2 and IL- 12 shows beneficial effects in T-cell lymphoma, squamous cell carcinoma, and lung cancer. (See Zaki et al, J. Invest. Dermatol. 118:366-71, 2002; Li et al, Arch. Otolaryngol. Head Neck Surg.
  • VEGF-A antibody/soluble FGF receptor bispecific binding proteins could be combined with reagents that co-stimulate various cell surface molecules found on immune-based effector cells, such as the activation of CD 137. (See Wilcox et al, J. Clin. Invest. 109:651-9, 2002) or inhibition of CTLA4 (Chambers et al., Ann. Rev. Immunol. 19:565- 94, 2001).
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein could be used with reagents that induce tumor cell apoptosis by interacting with TRAIL-related receptors.
  • reagents include TRAIL ligand, TRAIL ligand-Ig fusions, anti-TRAIL antibodies, and the like.
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is used in combination with a monoclonal antibody therapy that does not specifically target angiogenesis.
  • a monoclonal antibody therapy that does not specifically target angiogenesis.
  • Such combination therapy is particularly useful for treatment of cancer, in which the use of monoclonal antibodies, particularly antibodies directed against tumor-expressed antigens, is becoming a standard practice for many tumors including breast cell carcinoma (trastuzumab or HERCEPTIN ® ) and colon carcinoma (cetuximab or ERBITUX ® ).
  • compositions may be supplied as a kit comprising a container that comprises a therapeutic compositions as described herein.
  • a therapeutic composition can be provided, for example, in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection.
  • a kit can include a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a therapeutic composition.
  • Such a kit may further comprise written information on indications and usage of the pharmaceutical composition.
  • Cancers amenable to treatment in accordance with the present invention include cancers characterized by the presence of solid tumors.
  • the quantity of blood vessels in a tumor tissue is a strong negative prognostic indicator for cancers involving solid tumor formation, ⁇ see, e.g., Weidner et al, (1992), supra; Weidner et al, (1993), supra; Li et al, supra; Foss et al, supra), and both the VEGF and FGF family of signaling molecules appear to play key roles in the development of new blood vessels associated with solid tumors.
  • Table 4 below lists some cancers characterized by solid tumor formation, organized predominantly by target tissues.
  • Non-small cell carcinoma b. Small cell carcinoma
  • Gastrointestinal Tract cancers a. Colorectal cancer b. Gastric cancer
  • Liver cancer a. Liver Cell Adenoma b. Hepatocellular Carcinoma
  • Gynecologic cancer a. Cervical cancer b. Ovarian cancer
  • Vaginal cancer d. Vulvar cancer e. Gestational Trophoblastic Neoplasia f. Uterine cancer
  • Urinary Tract cancer a. Renal cancer carcinoma b. Prostate cancer
  • Neurolo gical Tumors a. Astrocytoma and glioblastoma b. Primary CNS lymphoma
  • Bone cancers a. Osteoblastoma b. Osteochondroma
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein as described herein is used to treat a cancer characterized by the presence of a solid tumor, such as, e.g., any of the cancers listed in Table 4.
  • the cancer to be treated in accordance with the present invention is selected from the following: a cancer of the head and neck (e.g., a cancer of the oral cavity, orophyarynx, nasopharynx, hypopharynx, nasal cavity or paranasal sinuses, larynx, lip, or salivary gland); a lung cancer (e.g., non-small cell lung cancer, small cell carcinoma, or mesothelimia); a gastrointestinal tract cancer (e.g., colorectal cancer, gastric cancer, esophageal cancer, or anal cancer); gastrointestinal stromal tumor (GIST); pancreatic adenocarcinoma; pancreatic acinar cell carcinoma; a cancer of the small intestine; a cancer of the liver or biliary tree (e.g., liver cell adenoma, hepatocellular carcinoma, hemangiosarcoma, extrahepatic or intrahepatic cholan
  • the cancer to be treated is a childhood cancer such as, for example, brain cancer, neuroblastoma, WiIm' s tumor (nephroblastoma), rhabdomyosarcoma, retinoblastoma, or hepatoblastoma.
  • the cancer is an immunotherapeutically sensitive cancer such as, for example, melanoma, kidney cancer, breast cancer, prostate cancer, colorectal cancer, cervical cancer, ovarian cancer, or lung cancer.
  • Prostate cancer is abnormal growth within a gland in the male reproductive system found below the bladder and in front of the rectum. Almost all prostate cancers arise from the secretory glandular cells in the prostate so are therefore prostatic adenocarcinomas.
  • cancer of the prostate is a common malignant cancer in men, second only to lung cancer.
  • Carcinoma of the prostate is predominantly a tumor of older men, which frequently responds to treatment when widespread and may be cured when localized. It is estimated that 17% of men will be diagnosed with prostate cancer in their lifetime.
  • the tumors generally originate as small and well-defined lesions, and can often present present as multiple primary tumors (Villers et al.. 1992). Progression is both local and distant, typically to seminal vesicles, ejaculatory ducts and pelvic lymph nodes and at more advanced stages bone, liver and lungs. Once metastasis has occurred the rate of cancer cell proliferation accelerates
  • Superficial spreading melanoma is the most common type of melanoma. About 7 out of 10 (70%) are this type. They occur mostly in middle-aged people. The most common place in women is on the legs, while in men it is more common on the trunk, particularly the back. They tend to start by spreading out across the surface of the skin: this is known as the radial growth phase. If the melanoma is removed at this stage there is a very high chance of cure. If the melanoma is not removed, it will start to grow down deeper into the layers of the skin. There is then a risk that it will spread in the bloodstream or lymph system to other parts of the body. Nodular melanoma occurs most often on the chest or back.
  • melanoma is most commonly found in middle-aged people. It tends to grow deeper into the skin quite quickly if it is not removed. This type of melanoma is often raised above the rest of the skin surface and feels like a bump. It may be very dark brown-black or black. Lentigo maligna melanoma is most commonly found on the face, particularly in older people. It grows slowly and may take several years to develop. Acral melanoma is usually found on the palms of the hands, soles of the feet or around the toenails.
  • melanoma of the skin include amelanotic melanoma (in which the melanoma loses its pigment and appears as a white area) and desmoplastic melanoma (which contains fibrous scar tissue).
  • Malignant melanoma can start in parts of the body other than the skin but this is very rare.
  • the parts of the body that may be affected are the eye, the mouth, under the fingernails (known as subungual melanoma) the vulval or vaginal tissues, or internally.
  • Diameter - Moles are normally no bigger than the blunt end of a pencil (about 6mm across). Melanomas are usually more than 7mm in diameter. Normal moles can be raised up from the skin and/or may be hairy. Itching, crusting or bleeding may also occur in melanomas - these are less common signs but should not be ignored (cancerbacup internet website).
  • the effects of a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein on tumor response can be evaluated in a murine melanoma model similar to that described in Hermans et al, Cancer Res.
  • Renal cell carcinoma a form of kidney cancer that involves cancerous changes in the cells of the renal tubule, is the most common type of kidney cancer in adults. Why the cells become cancerous is not known. A history of smoking greatly increases the risk for developing renal cell carcinoma. Some people may also have inherited an increased risk to develop renal cell carcinoma, and a family history of kidney cancer increases the risk. People with von Hippel-Lindau disease, a hereditary disease that affects the capillaries of the brain, commonly also develop renal cell carcinoma. Kidney disorders that require dialysis for treatment also increase the risk for developing renal cell carcinoma. The first symptom is usually blood in the urine. Sometimes both kidneys are involved.
  • the cancer metastasizes or spreads easily, most often to the lungs and other organs, and about one- third of patients have metastasis at the time of diagnosis (Medline Plus Medical Encyclopedia Internet website).
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein on tumor response can be evaluated in a murine renal cell carcinoma model similar to that described in Sayers et al, Cancer Res. 50:5414-20, 1990; Salup et al., Immunol. 138:641-7, 1987; and Luan et al, Transplantation 73:1565-72, 2002.
  • Cervical cancer also called cervical carcinoma, develops from abnormal cells on the surface of the cervix. Cervical cancer is one of the most common cancers affecting women. Cervical cancer is usually preceded by dysplasia, precancerous changes in the cells on the surface of the cervix. These abnormal cells can progress to invasive cancer. Once the cancer appears it can progress through four stages. The stages are defined by the extent of spread of the cancer. The more the cancer has spread, the more extensive the treatment is likely to be. There are 2 main types of cervical cancer: (1) Squamous type (epidermoid cancer): This is the most common type, accounting for about 80% to 85% of cervical cancers.
  • This cancer may be caused by sexually transmitted diseases.
  • One such sexual disease is the human papillomavirus, which causes venereal warts.
  • the cancerous tumor grows on and into the cervix.
  • This cancer generally starts on the surface of the cervix and may be diagnosed at an early stage by a Pap smear.
  • Adenocarcinoma This type of cervical cancer develops from the tissue in the cervical glands in the canal of the cervix. Early cervical cancer usually causes no symptoms.
  • the cancer is usually detected by a Pap smear and pelvic exam. This is why you should start having Pap smears and pelvic exams as soon as you become sexually active. Healthy young women who have never been sexually active should have their first annual pelvic exam by age 18.
  • carcinoma in particular squamous cell carcinoma
  • Carcinomas of the head and neck start in the cells that form the lining of the mouth, nose, throat or ear, or the surface layer covering the tongue.
  • cancers of the head and neck can develop from other types of cells. Lymphoma develops from the cells of the lymphatic system. Sarcoma develops from the supportive cells which make up muscles, cartilage or blood vessels. Melanoma starts from cells called melanocytes, which give colour to the eyes and skin.
  • the symptoms of a head and neck cancer will depend on where it is - for example, cancer of the tongue may cause some slurring of speech.
  • the most common symptoms are an ulcer or sore area in the head or neck that does not heal within a few weeks; difficulty in swallowing, or pain when chewing or swallowing; trouble with breathing or speaking, such as persistent noisy breathing, slurred speech or a hoarse voice; a numb feeling in the mouth; a persistent blocked nose, or nose bleeds; persistent earache, ringing in the ear, or difficulty in hearing; a swelling or lump in the mouth or neck; pain in the face or upper jaw; in people who smoke or chew tobacco, pre-cancerous changes can occur in the lining of the mouth, or on the tongue. These can appear as persistent white patches (leukoplakia) or red patches (erythroplakia).
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein
  • the effects of a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein on tumor response can be evaluated in a murine head and neck tumor model similar to that described in Kuriakose et al, Head Neck 22:57-63, 2000; Cao et al, Clin. Cancer Res. 5:1925-34, 1999; Hier et al, Laryngoscope 105: 1077-80, 1995; Braakhuis et al, Cancer Res. 51 :211-4, 1991; Baker, Laryngoscope 95:43-56, 1985; and Dong et ah, Cancer Gene Ther. 10:96-104, 2003.
  • Tumors that begin in brain tissue are known as primary tumors of the brain.
  • Primary brain tumors are named according to the type of cells or the part of the brain in which they begin. The most common primary brain tumors are gliomas. They begin in glial cells. There are many types of gliomas.
  • Astrocytoma The tumor arises from star-shaped glial cells called astrocytes. In adults, astrocytomas most often arise in the cerebrum. In children, they occur in the brain stem, the cerebrum, and the cerebellum.
  • a grade III astrocytoma is sometimes called an anaplastic astrocytoma.
  • a grade IV astrocytoma is usually called a glioblastoma multiforme.
  • Brain stem glioma The tumor occurs in the lowest part of the brain. Brain stem gliomas most often are diagnosed in young children and middle-aged adults.
  • Ependymoma The tumor arises from cells that line the ventricles or the central canal of the spinal cord. They are most commonly found in children and young adults.
  • Oligodendroglioma This rare tumor arises from cells that make the fatty substance that covers and protects nerves. These tumors usually occur in the cerebrum. They grow slowly and usually do not spread into surrounding brain tissue. They are most common in middle-aged adults. The symptoms of brain tumors depend on tumor size, type, and location. Symptoms may be caused when a tumor presses on a nerve or damages a certain area of the brain.
  • Papillary and follicular thyroid cancers account for 80 to 90 percent of all thyroid cancers. Both types begin in the follicular cells of the thyroid. Most papillary and follicular thyroid cancers tend to grow slowly. If they are detected early, most can be treated successfully. Medullary thyroid cancer accounts for 5 to 10 percent of thyroid cancer cases. It arises in C cells, not follicular cells. Medullary thyroid cancer is easier to control if it is found and treated before it spreads to other parts of the body. Anaplastic thyroid cancer is the least common type of thyroid cancer (only 1 to 2 percent of cases). It arises in the follicular cells. The cancer cells are highly abnormal and difficult to recognize.
  • This type of cancer is usually very hard to control because the cancer cells tend to grow and spread very quickly. Early thyroid cancer often does not cause symptoms. But as the cancer grows, symptoms may include: A lump, or nodule, in the front of the neck near the Adam's apple; Hoarseness or difficulty speaking in a normal voice; Swollen lymph nodes, especially in the neck; Difficulty swallowing or breathing; or Pain in the throat or neck (National Cancer Institute's Internet website).
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein on tumor response
  • a murine or rat thyroid tumor model similar to that described in Quidville et al., Endocrinology 145:2561-71, 2004 (mouse model); Cranston et al., Cancer Res. 63:4777-80, 2003 (mouse model); Zhang et ⁇ l., Clin Endocrinol (OxJ). 52:687-94, 2000 (rat model); and Zhang et ⁇ l., Endocrinology 140:2152-8, 1999 (rat model).
  • liver cancer There are two different types of primary liver cancer. The most common kind is called hepatoma or hepatocellular carcinoma (HCC), and arises from the main cells of the liver (the hepatocytes). This type is usually confined to the liver, although occasionally it spreads to other organs. It occurs mostly in people with a liver disease called cirrhosis. There is also a rarer sub-type of hepatoma called Fibrolamellar hepatoma, which may occur in younger people and is not related to previous liver disease. The other type of primary liver cancer is called cholangiocarcinoma or bile duct cancer, because it starts in the cells lining the bile ducts.
  • HCC hepatocellular carcinoma
  • cirrhosis of the liver Most people who develop hepatoma usually also have a condition called cirrhosis of the liver. This is a fine scarring throughout the liver which is due to a variety of causes including infection and heavy alcohol drinking over a long period of time. However, only a small proportion of people who have cirrhosis of the liver develop primary liver cancer. Infection with either the hepatitis B or hepatitis C virus can lead to liver cancer, and can also be the cause of cirrhosis, which increases the risk of developing hepatoma. People who have a rare condition called haemochromatosis, which causes excess deposits of iron in the body, have a higher chance of developing hepatoma.
  • the bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein of the present invention may be used to treat, prevent, inhibit the progression of, delay the onset of, and/or reduce the severity or inhibit at least one of the conditions or symptoms associated with hepatocellular carcinoma.
  • the hepatocellular carcinoma may or may not be associated with an hepatitis (e.g., hepatitis A, hepatitis B, hepatitis C and hepatitis D) infection.
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein on tumor response can be evaluated in a hepatocellular carcinoma transgenic mouse model, which includes the overexpression of transforming growth factor- ⁇ (TFG- ⁇ ) alone (Jhappan et al, Cell, 61 : 1137-1146, 1990; Sandgren et al, MoI. Cell Biol, 13:320- 330, 1993; Sandgren et al, Oncogene 4:715-724, 1989; and Lee et al, Cancer Res.
  • TGF- ⁇ transforming growth factor- ⁇
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein can be evaluated in a human small/non- small cell lung carcinoma xenograft model. Briefly, human tumors are grafted into immunodecicient mice and these mice are treated with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein alone or in combination with other agents which can be used to demonstrate the efficacy of the treatment by evaluating tumor growth (Nemati et al, Clin Cancer Res. 6:2075-86, 2000; and Hu et al, Clin. Cancer Res. 10:7662-70, 2004).
  • tumor response means a reduction or elimination of all measurable lesions or metastases.
  • Disease is generally considered measurable if it comprises lesions that can be accurately measured in at least one dimension as > 20mm with conventional techniques or > 10mm with spiral CT scan with clearly defined margins by medical photograph or X-ray, computerized axial tomography (CT), magnetic resonance imaging (MRI), or clinical examination (if lesions are superficial).
  • Non-measurable disease means the disease comprises of lesions ⁇ 20mm with conventional techniques or ⁇ 10mm with spiral CT scan, and truly non-measurable lesions (too small to accurately measure).
  • Non-measureable disease includes pleural effusions, ascites, and disease documented by indirect evidence.
  • the criteria for objective status are required for protocols to assess solid tumor response. Representative criteria include the following: (1) Complete Response (CR), defined as complete disappearance of all measurable disease; no new lesions; no disease related symptoms; no evidence of non-measurable disease; (2) Partial Response (PR) defined as 30% decrease in the sum of the longest diameter of target lesions (3) Progressive Disease (PD), defined as 20% increase in the sum of the longest diameter of target lesions or appearance of any new lesion; (4) Stable or No Response, defined as not qualifying for CR, PR, or Progressive Disease. (See Therasse et al., supra.)
  • Additional endpoints that are accepted within the oncology art include overall survival (OS), disease-free survival (DFS), objective response rate (ORR), time to progression (TTP), and progression- free survival (PFS) (see Guidance for Industry: Clinical Trial Endpoints for the Approval of Cancer Drugs and Biologies, April 2005, Center for Drug Evaluation and Research, FDA, Rockville, MD.)
  • a bispecific VEGF-A antibody/FGFR soluble receptor combination is used in combination with a second agent for treatment of a neovascular disorder.
  • antagonists of the present invention may be used in combination with conventional cancer therapies such as, e.g., surgery, radiotherapy, chemotherapy, or combinations thereof.
  • other therapeutic agents useful for combination cancer therapy with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein include other anti-angiogenic agents.
  • other therapeutic agents useful for combination therapy with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein include an antagonist of other factors that are involved in tumor growth such as, for example, EGFR, ErbB2 (Her2), ErbB3, ErbB4, or TNF.
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is co-administered with a cytokine (e.g., a cytokine that stimulates an immune response against a tumor).
  • cytokine e.g., a cytokine that stimulates an immune response against a tumor.
  • ADCC antibody dependent cellular cytotoxicity
  • monoclonal antibodies bind to a target cell (e.g., cancer cell) and specific effector cells expressing receptors for the monoclonal antibody (e.g., NK cells, monocytes, granulocytes) bind the monoclonal antibody/target cell complex resulting in target cell death.
  • target cell e.g., cancer cell
  • specific effector cells expressing receptors for the monoclonal antibody e.g., NK cells, monocytes, granulocytes
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is co- administered with a monoclonal antibody against a tumor-associated antigen.
  • the dose and schedule of the MAbs is based on pharmacokinetic and toxicokinetic properties ascribed to the specific antibody co-administered, and should optimize these effects, while minimizing any toxicity that may be associated with administration of a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein.
  • Combination therapy with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein and a monoclonal antibody against a tumor- associated antigen may be indicated when a first line treatment has failed and may be considered as a second line treatment.
  • the present invention also provides using the combination as a first line treatment in patient populations that are newly diagnosed and have not been previously treated with anticancer agents ("de novo patients") and patients that have not previously received any monoclonal antibody therapy (“na ⁇ ve patients”).
  • a bispecific binding protein is also useful in combination therapy with monoclonal antibodies against tumor-associated antigens in the absence of any direct antibody-mediated ADCC of tumor cells.
  • antibodies that block an inhibitory signal in the immune system can lead to augmented immune responses.
  • Examples include (1) antibodies against molecules of the B7R family that have inhibitory function such as, cytotoxic T lymphocyte-associated antigen 4 (CTLA-4), programmed death- 1 (PD-I), B and T lymphocyte attenuator (BTLA); (2) antibodies against inhibitory cytokines like IL-IO, TGF ⁇ ; and (3) antibodies that deplete or inhibit functions of suppressive cells like anti-CD25 or CTLA-4.
  • CTLA-4 cytotoxic T lymphocyte-associated antigen 4
  • PD-I programmed death- 1
  • BTLA B and T lymphocyte attenuator
  • antibodies against inhibitory cytokines like IL-IO, TGF ⁇ antibodies that deplete or inhibit functions of suppressive cells like anti-CD25 or CTLA-4.
  • anti-CTLA4 MAbs in both mice and humans are thought to either suppress function of immune-suppressive regulatory T cells (Tregs) or inhibit the inhibitory signal transmitted through binding of CTLA-4 on T cells to B7- 1 or B7-2 molecules on APCs or tumor cells.
  • Tregs immune-suppressive regulatory T cells
  • Table 8 is a non-exclusive list of monoclonal antibodies approved or being tested for which combination therapy with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is possible.
  • a Bispecific Binding Protein comprising a VEGF-A antibody/soluble
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein as described herein is used in combination with a tyrosine kinase inhibitor.
  • Tyrosine kinases are enzymes that catalyze the transfer of the ⁇ phosphate group from the adenosine triphosphate to target proteins. Tyrosine kinases can be classified as receptor and nonreceptor protein tyrosine kinases. They play an essential role in diverse normal cellular processes, including activation through growth receptors and affect proliferation, survival and growth of various cell types. Additionally, they are thought to promote tumor cell proliferation, induce anti-apoptotic effects and promote angiogenesis and metastasis.
  • protein kinase activation through somatic mutation is a common mechanism of tumorigenesis.
  • Some of the mutations identified are in B-Raf kinase, FLt3 kinase, BCR-ABL kinase, c-KIT kinase, epidermal growth factor (EGFR) and PDGFR pathways.
  • the Her2, VEGFR and c-Met are other significant receptor tyrosine kinase (RTK) pathways implicated in cancer progression and tumorigenesis. Because a large number of cellular processes are initiated by tyrosine kinases, they have been identified as key targets for inhibitors.
  • Tyrosine kinase inhibitors are small molecules that act inside the cell, competing with adenosine triphosphate (ATP) for binding to the catalytic tyrosine kinase domain of both receptor and non-receptor tyrosine kinases. This competitive binding blocks initiation of downstream signaling leading to effector functions associated with these signaling events like growth, survival, and angiogenesis.
  • ATP adenosine triphosphate
  • TKIs are thought to inhibit growth of tumors through direct inhibition of the tumor cell or through inhibition of angiogenesis. Moreover, certain TKIs affect signaling through the VEGF family receptors, including sorafenib and sunitinib. In some cases TKIs have been shown to activate functions of dendritic cells and other innate immune cells, like NK cells. This has been recently reported in animal models for imatinib. Imatinib is a TKI that has shown to enhance killer activity by dendritic cells and NK cells (for review, see Smyth et al, NEJM 354:2282, 2006).
  • BAY 43-9006 (sorafenib, Nexavar®) and SUl 1248 (sunitinib, Sutent®) are two such TKIs that have been recently approved for use in metastatic renal cell carcinoma (RCC).
  • RRC metastatic renal cell carcinoma
  • TKIs include, but are not limited to: Imatinib mesylate (Gleevec®, Novartis); Gefitinib (Iressa®, AstraZeneca); Erlotinib hydrochloride (Tarceva®, Genentech); Vandetanib (Zactima®, AstraZeneca), Tipifarnib (Zarnestra®, Janssen-Cilag); Dasatinib (Sprycel®, Bristol Myers Squibb); Lonafarnib (Sarasar®, Schering Plough); Vatalanib succinate (Novartis, Schering AG); Lapatinib (Tykerb®, Glaxo SmithKline); Nilotinib (Novartis); Lestaurtinib (Cephalon); Pazopanib hydrochloride (Glaxo SmithKline); Axitinib (Pfizer); Canertinib dihydrochloride (Pfizer); Pelitinib
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor is administered in combination with one or more chemotherapeutic agents.
  • Chemotherapeutic agents have different modes of actions, for example, by influencing either DNA or RNA and interfering with cell cycle replication.
  • chemotherapeutic agents that act at the DNA level or on the RNA level are anti-metabolites (such as Azathioprine, Cytarabine, Fludarabine phosphate, Fludarabine, Gemcitabine, cytarabine, Cladribine, capecitabine 6- mercaptopurine, 6-thioguanine, methotrexate, 5-fluoroouracil and hyroxyurea); alkylating agents (such as Melphalan, Busulfan, Cis-platin, Carboplatin, Cyclophosphamide, Ifosphamide, dacarabazine, Procarbazine, Chlorambucil, Thiotepa, Lomustine, Temozolamide); anti-mitotic agents (such as Vinorelbine, Vincristine, Vinblastine, Docetaxel, Paclitaxel); topoisomerase inhibitors (such as Doxorubincin, Amsacrine, Irinotecan, Daunorubi
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is administered in combination with radiotherapy.
  • Certain tumors can be treated with radiation or radiopharmaceuticals. Radiation therapy is generally used to treat unresectable or inoperable tumors and/or tumor metastases. Radiotherapy is typically delivered in three ways. External beam irradiation is administered at distance from the body and includes gamma rays ( 60 Co) and X-rays. Brachytherapy uses sources, for example 60 Co, 137 Cs, 192 Ir, or 125 I, with or in contact with a target tissue.
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein is administered in combination with a hormone or anti-hormone.
  • Certain cancers are associated with hormonal dependency and include, for example, ovarian cancer, breast cancer, and prostate cancer.
  • Hormonal-dependent cancer treatment may comprise use of anti-androgen or anti-estrogen compounds.
  • Hormones and anti-hormones used in cancer therapy include Estramustine phosphate, Polyestradiol phosphate, Estradiol, Anastrozole, Exemestane, Letrozole, Tamoxifen, Megestrol acetate, Medroxyprogesterone acetate, Octreotide, Cyproterone acetate, Bicaltumide, Flutamide, Tritorelin, Leuprorelin, Buserelin and Goserelin.
  • Example 1 Panning for Antibodies that Bind VEGF-A
  • Antibodies that bind to VEGF-A were identified by screening the Dyax Fab 310 phage library (Dyax Corp., Cambridge, MA). The chosen method for selection and screening of the phage- antibody libraries utilized polystyrene immunotubes (NUNC, Denmark) coated with antigen (VEGF- Ai 65, R&D Systems). The antibodies were isolated by increasing the stringency after a few rounds of selection. The first generation of antibodies was in the Fab format. The soluble Fab antibodies were generated by Mlul (#R0198S, New England Biolabs, Beverly, MA) enzyme digestion to remove the geneIII stump from Ml 3 phage. The same strategy of selection, screening, and solubilizing was applied for antibodies in the scFv format.
  • Fab clones binding VEGF-A were identified by a plate based binding assay. Costar (#9018) 96-well plates were coated with 50 ⁇ l VEGF-A (R&D Systems) or PDGF-D (SEQ ID NO: 80) homodimer at 0.6 ⁇ g/ml in 0.1M NaHC ⁇ 3 , pH 9.6 overnight at 4°C. The next day, plates were washed three times with 0.1% Tween-20/PBS (PBST). Each well was filled with 100 ⁇ l of 2% milk (#170- 6404, Bio-Rad)/PBST for one hour at RT for blocking.
  • PBST 0.1% Tween-20/PBS
  • Assay plates were then washed three times with PBST. Each well was filled with 25 ul of 2% milk/PBST, followed by the addition of 25 ul of Fab supernatant. Wells were then mixed and incubated for one hour at RT. Plates were washed three times with PBST.
  • 50 ul of (1 :4000) anti-Human Fab specific pAb-HRP (#31482, Pierce) in 2% milk/PBST was added to each well for one hour at RT. Plates were then washed three times with PBST.
  • TMB TMB
  • stop buffer 50 ul of TMB (STPR-1000-01, BioFX Laboratories)
  • Round 2 PCR reactions add appropriate gly/ser linker sequences to the ends of the proper round 1 PCR products and round 3 PCR reactions overlap the variable light chain lambda, variable light chain kappa, and variable heavy chain products to create scFv products in both LH and HL orientations, which were then cloned into J/> ⁇ LI/NM-digested PIMD21 phage display vector.
  • Example 4 Identification sFabs and scFvs that inhibit VEGF binding to sVEGFR2
  • VEGF-A Fab and scFv clones were screened by a plate-based neutralization assay.
  • Costar (#9018) 96-well plates were coated with 100 ⁇ l of anti-human IgG Fc ⁇ -specific antibody (#109- 005-098, Jackson Immunology) at 1 ⁇ g/ml in 0.1M NaHCO 3 , pH 9.6 overnight at 4°C. The next day, plates were washed three times with 400ul 0.1% Tween-20/PBS (PBST). Each well was filled with 100 ⁇ l of 1% BSA (#A3059-100G, SIGMA)/PBST for one hour at room temperature (RT) for blocking. Plates were washed three times with PBST.
  • VEGFR2-Fc VEGFR2-Fc (SEQ ID NO:81) at 0.2 ⁇ g/ml in 1% BSA/PBST was added to each well for one hour at room temperature.
  • 65 ⁇ l of Fab or scFv supernatant was added to 65 ⁇ l of biotinylated VEGF-A in 1% BSA/PBST at 20ng/ml for 1 hr at room temperature.
  • Blocked assay plates were washed three times with PBST. Each well was filled with lOO ⁇ l of supernatant/biotinylated VEGF-A complex for 1 hr at room temperature. Plates were washed three times with PBST.
  • Example 5 Measurement of Dissociation Rate Constants of Interaction of Human VEGF-A Antagonists with Human VEGF-A via Surface Plasmon Resonance (Biacore)
  • Human VEGF-A antagonists were evaluated for their binding affinity to human VEGF-A.
  • VEGF-A according to their dissociation rate constants using surface plasmon resonance. Dissociation rate constants were measured for the interaction of VEGF-A antagonists with VEGF-A via surface plasmon resonance.
  • the dissociation rate constant (kd (s-i)) is a value that reflects the stability of this complex. It is independent of the concentration and therefore suitable for screening and ranking samples with unknown concentrations.
  • VEGF-A antagonist supernatants selected from a Dyax phage library screening
  • VEGF-A antagonist supernatants were diluted 1 :3 in running buffer, injected over the surface and allowed to specifically bind to VEGF- A on a sensor chip with an association time of 5 minutes and dissociation time of 5 minutes.
  • Duplicate injections of 10OnM VEGFR-2-Fc5 and 100 nM anti-VEGF-A monoclonal antibody (AvastinTM, Genentech) were used as positive controls.
  • Kinetic binding studies were performed using a flow rate of 30 ul/min.
  • VEGFR-2-Fc5 - VEGF-A interaction was approximately 2.EU s-i and anti- VEGF-A monoclonal antibody AvastinTM Fab - VEGF-A interaction was approximately 8.E-5 s-i.
  • scFv, tandem scFv, and sFab proteins were expressed in the periplasmic space of E.coli cells.
  • Scale of ferment ranged from 25mL shake flask cultures to 2L batch fed systems.
  • E.coli cells were spun down using a centrifuge into a pellet.
  • Wet cell pellet was completely re-suspended in periplasting buffer [0.2M Tris, 20% (w/v) sucrose, Complete EDTA-free protease inhibitor cocktail (Roche) pH 7.5] at a ratio of 2mL per gram of wet cell weight.
  • Lysozyme an enzyme that facilitates the degradation of the cell wall may or may not be included in the procedure.
  • lysozyme 50OuL of re-suspended pellet was transferred to an eppendorf tube and 30U of Ready-Lyse lysozyme (Epicentre) per uL of periplasting buffer used was added and the suspension incubated at room temperature for 5 minutes. After the incubation, the solution was checked for increased viscosity by inversion. If the solution clings to the wall of the tube, then premature cell lysis may be occurring, and the lysozyme is not included in the preparative solution. If the solution does not cling to the tube wall, then the lysozyme is included in the preparative solution.
  • lysozyme 3OU of Ready-Lyse lysozyme (Epicentre) per uL of periplasting buffer used was added and the suspension incubated at room temperature for 4-6minutes. Ice cold water was added at a ratio of 3mL per gram of original wet cell pellet weight and the solution incubated for at least 10 minutes but no longer than 30 minutes. The remaining spherop lasts were pelleted via centrifugation at 15,000xg (or 10,000 - 20,000 RPM, whichever is faster) for at least 15 minutes, but no longer than 45 minutes, at room temperature.
  • the supernatant containing the periplasmic fraction was poured into a new vessel and adjusted to 25mM Imidazole, 50OmM NaCl using weighed out solid. This solution was filtered through a 0.22um filter prior to purification using a bottle top filter (Nalgene).
  • the IMAC column was equilibrated in 5OmM NaPO/t, 50OmM NaCl, 25mM Imidazole pH 7.5 and the periplasmic fraction loaded over it at no faster than 190cm/hr until depleted.
  • Column washed with equilibration buffer until monitors at UV A254nm and UV A280nm are baseline stable for at least 2 CV at a flow rate not to exceed 190cm/hr.
  • Bound protein was eluted competitively using 5OmM NaPO/t, 50OmM NaCl, 40OmM Imidazole, pH 7.5 at no faster than 190cm/hr. Elution fractions were assessed for protein content via UV @ A280nm, analytical size exclusion chromatography, and SDS-PAGE.
  • IMAC elution pool was concentrated using 1OkD MWCO Ultracel centrifugal concentrator (Millipore) with the final concentrate volume being no more than 3% of the volume of gel filtration column used. Concentrate was injected onto column and the protein eluted isocratically at a flow rate not to exceed 76cm/hr and no slower than 34cm/hr. Elution fractions were analyzed by SDS-PAGE, and the appropriate pool made.
  • Example 7 Identification of Neutralizing Anti-human VEGF scFvs Using the 293/KDR/KZ136/C22 VEGF-A-induced Cell-Based Luciferase Assay
  • VEGF-A neutralizing molecules scFv's, Fabs
  • positive controls bevacizumab (anti- VEGF-A monoclonal antibody, Genentech)
  • ranibizumab anti- VEGF-A affinity -matured Fab, Genentech
  • bevacizumab Fab generated in-house were serially diluted from 200 nM down to 12 pM at 1 :5 dilutions along with a non-neutralizer (medium only) in serumfree medium.
  • VEGF-Ai 6S was added at 0.54 nM for a final concentration of 0.26 nM VEGF-A and 100 nM to 6 pM neutralizing molecule or positive control. These were incubated for 60 minutes at 37° C. Following incubation, medium was aspirated off the serum-starved cells and 100 ⁇ l of the above complexes were added and incubated at 37° C for 4 hours.
  • a luciferase assay was performed using the Luciferase Assay System (Promega, E1501) according to the manufacturer's instructions. Briefly, medium was aspirated and 25 ⁇ l IX is Buffer (Promega, E153A) was added to each well. Plates were incubated for 20-30 minutes at RT to equilibrate. Luciferase activity was measured using a microplate luminometer (Berthold Technologies), 40 ⁇ l substrate injection, 1 second integration time. Data was analyzed using analytical software (Spotfire) and ICso values were calculated for each candidate and control.
  • VEGF-Aies binding to its receptor, VEGF-R2 KDR/Flk-1
  • VEGF-R2 KDR/Flk-1
  • STAT signal transducer and activator of transcription
  • SRE serum-response element
  • scFvs listed in Table 6 below were screened in the luciferase assay for neutralizing VEGF-induced activity. Significant inhibition was demonstrated with a number of scFvs screened (reported as IC50 values in Table 6). IC50 values are indicated as nM concentration of scFv needed to neutrlaize VEGF-activity by 50%. Bevacizumab (AvastinrM), LucentisTM, and AvastinTM Fab (generated in-house) were used as controls for activity.
  • Example 8 Proliferation Assay to Determine Neutralizing Activity of VEGFA scFvs on human VEGF-A-stimulated HUVEC Cells
  • VEGF-A scFv was used as a positive control at 2.6 nM.
  • Human VEGF-A scFv was serially diluted in SFM at 500 nM, 50 nM, 5 nM, 0.5 nM, 0.05 nM, 0.005 nM, and 0.0005 nM.
  • Human umbilical vein endothelial cells were plated into 96-well flat-bottom plates in a volume of 100 ⁇ L at a density of 900- 1000 cells per well.
  • the HUVEC cells were plated for 2 days in complete EGM-2 MV media (Lonza, Walkersville, MD) at 37°C, 5% CO2.
  • the cells were serum-starved with SFM for 24 h, stimulated for 24 h with 2.6 nM with or without the serially diluted VEGF-A scFv, and pulsed for 24 h with 1 ⁇ Ci per well of 3H-thymidine, which is incorporated into proliferating cells (all at 37°C, 5% CO2).
  • the cells were harvested and counted using Topcount instrument (Hewlett Packard).
  • VEGF-A antagonists were capable of binding simultaneously to human VEGF-A.
  • VEGF-A antagonists that compete for the same, or an overlapping, binding site (epitope) on the antigen are not able to bind simultaneously and are functionally grouped into a single family or "epitope bin.”
  • VEGF-A antagonists that do not compete for the same binding site on the antigen are able to bind simultaneously and are grouped into separate families or epitope bins.
  • Biacore T 100TM instrument Biacore is only one of a variety of assay formats that are routinely used to assign panels of antibody fragments and monoclonal antibodies to epitope bins.
  • VEGF-A antagonists and the VEGF-A antigen were diluted to 100 nM.
  • VEGF-A antigen was injected and allowed to specifically bind to a VEGF-A antagonist immobilized on the sensor chip.
  • VEGF-A is a dimer, therefore there are two potential binding sites for every VEGF-A antagonist.
  • the primary VEGF-A antagonist that was previously immobilized was injected over VEGF-A.
  • secondary VEGF-A antagonist was injected to observe simultaneous binding to VEGF-A.
  • Results The purified VEGF-A antagonists were assigned into epitope bins using the binding data from the two set of experiments described above.
  • the signal (RU, response units) reported by the BIACORETM is directly correlated to the mass on the sensor chip surface.
  • the level of background signal (RU) associated with the negative controls was established (the same VEGF-A antagonist used as both the primary and secondary antagonists), the binning results were reported as either positive or negative binding. Positive binding indicates that two different VEGF-A antagonists are capable of binding the antigen simultaneously. Negative binding indicates that two different VEGF-A antagonists are not capable of binding the antigen simultaneously.
  • the differential between positive and negative response values in these experiments was used to assign the VEGF-A antagonists into three families or epitope bins (see Table 8).
  • the first epitope bin is represented by VEGF-A antagonist produced by clone c636.
  • a second epitope bin is represented by VEGF-A antagonists c868, clO39, and clO81.
  • c636 was the first to interact with VEGF-A, both c868 and clO39 showed simultaneous binding.
  • c868 or clO39 interacted with VEGF-A first, c636 did not show any binding, therefore c868 and clO39 are overlapping the c636 epitope.
  • VEGF-A antagonist c870 overlapped bin #1 and bin #2.
  • a third epitope bin is represented by VEGF-A antagonist c820 and the positive control VEGF-A antibody (mouse anti VEGF-A monoclonal antibody, R&D Systems). Both of these VEGF-A antagonists showed simultaneous binding in the presence of all the other VEGF-A antagonists. All of the antagonists tested in the binning experiments were shown to neutralize VEGF-A mitogenic activity to some degree.
  • VEGF-A antagonists produced by clones c870 and clO39 were evaluated for their binding affinities to human VEGF-A using surface plasmon resonance.
  • Affinity Determination Kinetic rate constants and equilibrium dissociation constants were measured for the interaction of VEGF-A antagonists with the VEGF-A via surface plasmon resonance.
  • the association rate constant (ka (M-is-i)) is a value that reflects the rate of the antigen- antagonist complex formation.
  • the dissociation rate constant (kd (s-i)) is a value that reflects the stability of this complex. By dividing the association rate constant by the dissociation rate constant (ka/kd) the equilibrium association constant (KA (M I)) is obtained.
  • Anti-His ⁇ and anti- Myc antibodies were mixed in 1 : 1 molar ratio and covalently immobilized to a CM5 sensor chip using amine coupling chemistry to a density of approximately 7500RU.
  • 10 nM of VEGF-A antagonists were injected on separate flow cells at lOul/min for 1 minute, followed with a 1 minute stabilization period.
  • Serial 1 :3 dilutions of VEGF-A from 33.3 nM - 0.14 nM were injected over this surface and allowed to specifically bind to VEGF-A antagonist captured on the sensor chip.
  • Duplicate injections of each VEGF-A concentration were performed with an association time of 5 minutes and dissociation time of 10 minutes.
  • Example 11 Epitope Mapping of Anti- VEGF-A Antibodies
  • Monoclonal human VEGF-A antibodies produced by clone c870 and clO39 were evaluated for their peptide binding to human VEGF-A using the JPT VEGF-A RepliTopeTM slides.
  • Each JPT slide consisted of 3 replicates of the following array. Each array consisted of successive, overlapping 13aa fragments of VEGF-A (spots 1-78), followed by successive, overlapping 20aa fragments of VEGF-A (spots 85-115). In addition, control spots of each test antibody and mouse and human IgG flanked top, bottom, and sides of each array. A series of experiments were completed to determine the binding ability of scFvs c870 and clO39 against the synthetic linear peptides of human VEGF-A protein. The anti-human VEGF-A scFvs were labeled with His/Myc epitope tags.
  • a solution of 10-100 ⁇ g/ml of the antibodies were applied to the peptide slides.
  • Anti-His and/or anti-Myc antibodies were then applied to the slides.
  • Signals were amplified with the Biotinylated Tyramide according to the method specified by the kit (Renaissance® TSATM Biotin System, PerkinElmer, #NEL700A).
  • the bound antibodies were visualized using a streptavidin alkaline phosphatase and a DAKO Permanent Red dye.
  • the region "post ⁇ 7" is the heparin binding domain of the VEGF molecule.
  • Example 12 Testing Cross-reactivity of VEGF- A-binding scFvs and Bispecific Antibodies Against Murine VEGF-A Using the VEGFR2 Phosphorylation Assay
  • VEGF-A neutralizing molecules scFvs, Fabs
  • scFvs, Fabs candidate VEGF-A neutralizing molecules
  • Lysates were incubated for 20 minutes at 4° C on a platform shaker and centrifuged at 3000 rpm for 10 min at 4° C to clear lysates. Lysates were transferred to a fresh 96-well microtiter plate and placed at -20° C until assay.
  • VEGFR2 phosphorylation luminex assay the Intracellular Protein Buffer Reagent Kit (Invitrogen LHB0002) and VEGFR2 [pY1059] Antibody Bead Kit (Invitrogen LHO0601) was used according to manufacturer's instructions. Lysates were thawed and mixed 1 :5 with 80 ⁇ l Assay Diluent. Wells of a luminex vacuum filtration plated were pre-wetted with 200 ⁇ l Working Wash Solution. Diluted beads were added at 25 ⁇ l per well and washed 2X with 200 ⁇ l Working Wash Solution.
  • Results The act of mVEGF-Ai64 binding to human receptor, VEGF-R2 (KDR/Flk-1), induces phosphorylation of the receptor.
  • This luminex-based assay binds total VEGF-R2 to a fluorescentlylabeled bead conjugated to an anti-VEGFR2 antibody.
  • a secondary antibody detecting phophorylation at [pY1059] is used to detect how much VEGFR2 has been phosphorylated.
  • Table 12 a number of scFvs that neutralized human VEGF-A activity also inhibited mouse VEGF activity in this assay. Bispecific antibodies that contained these same scFvs also neutralized mouse VEGF-A activity.
  • Example 13 Proliferation Assay to Determine Neutralizing Activity of scFvs on Mouse VEGFA rVEGF-Ai64)-stimulated HUVEC Cells
  • mice VEGF-A neutralizing scFvs To screen for mouse VEGF-A neutralizing scFvs , a 3H-thymidine assay was run. Recombinant mouse VEGF-Ai64 was used as a positive control at 2.6 nM. DMEM-F12 (1 :1) media with Ix insulin-transferrin-selenium (serum- free media, SFM; Invitrogen, Carlsbad, CA) was used as a negative control. scFv molecules were serially diluted in SFM at 500 nM, 50 nM, 5 nM, 0.5 nM, 0.05 nM, 0.005 nM, and 0.0005 nM.
  • Human umbilical vein endothelial cells were plated into 96- well flat bottom plates in a volume of 100 ⁇ L at a density of 900-1000 cells per well.
  • the HUVEC cells were plated for 2 days in complete EGM-2 MV media (Lonza, Walkersville, MD) at 37°C, 5% CO2.
  • the cells were serum-starved with SFM for 24 h, stimulated for 24 h with 2.6 nM with or without the serially diluted VEGF-A scFv, and pulsed for 24 h with 1 ⁇ Ci per well of 3H thymidine, which is incorporated into proliferating cells (all at 37°C, 5% CO2).
  • the cells were harvested and counted using Topcount instrument (Hewlett Packard).
  • Example 14 Construction of Soluble FGFR3IIIc C-term FcS Expression Plasmids to Express the 1 st , 2 nd and 3rd Extracellular Ig like domains or a Truncated form including the 2 nd and 3rd Extracellular Ig like Domains
  • a series of expression constructs containing the first, second and third extracellular Ig like domains of Human FGFR3IIIc or a truncated form with the second and third extracellular Ig like domains of Human FGFR3IIIc were generated. These Human FGFR3IIIc sequence spans were fused with a downstream C-terminal Fc5 sequence. Constructs in this series included the sequence spans mentioned above and a point mutation that yielded a Tryptophan residue at amino acid residue 262 of SEQ ID NO:2 and residue 142 of SEQ ID NO: 10. (The 249 position of the mutation is in reference to the native FGFR3IIIc Amino Acid sequence) instead of a Serine at this position. This mutation is noted as S249W. These constructs were generated via PCR and homologous recombination using DNA fragments encoding the FGFR3IIIc domains noted above, Fc5 fragment and the expression vector pZMP31.
  • the PCR amplification reactions used the 5' oligonucleotides zc62552 ((SEQ ID N0:3) (Forward primer to generate a PCR frag using FGFR3 HIc as template. FGFR3 IIIc starts at E36 of SEQ ID N0:2)). Fragment to be cloned into pZMP31 utilizing the opTPA leader sequence (residues 1-35 of SEQ ID N0:2). The PCR was run with the 3' oligonucleotides zc62557 (SEQ ID N0:4) (Reverse primer to generate a PCR frag using FGFR3 IIIc as template. Fragment will generate a S249W mutation. To be used with a Forward primer nested at 5' end of Rec sequence), and utilized clonetrack ID #102551 Human FGFR3IIIc as template.
  • the second fragment represented a 5' overlap with upstream Human FGFR3IIIc sequence followed by sequence of Human FGFR3IIIc encoding a S249W point mutation and a 3 ' overlap with Fc5 sequence (residues 389-620 of SEQ ID NO:2).
  • the PCR amplification reactions used the 5' oligonucleotides zc62556 (SEQ ID NO:82) (forward primer to generate a PCR frag using FGFR3 IIIc as template. Fragment will generate a S249W mutation. To be used with a reverse primer nested at 3' end of sol. Rec sequence).
  • the PCR was run with the 3' oligonucleotides zc62553 (SEQ ID NO:6): (Reverse primer to generate a PCR frag using FGFR3 IIIc as template. Seq of sol. FGFR3 IIIc to G 375. Fragment will have overlapping Fc5 sequence), and utilized clonetrack ID #102551 Human FGFR3IIIc as template.
  • the third fragment contained Fc5 sequence and represented a 5' overlap with Human FGFR3IIIc and a 3' overlap the pZMP31 vector sequence.
  • the PCR amplification reactions used the 5' oligonucleotides zc62554 (SEQ ID NO:7).
  • the PCR was run with the 3' oligonucleotides zc62555 (SEQ ID NO:8).
  • the PCR amplification reaction conditions to generate the three fragments noted above were as follows: 1 cycle, 95°C, 5 minutes; 25 cycles, 95°C, 30 seconds, followed by 55°C, 30 seconds, followed by 68°C, 1 minute 30 seconds; 1 cycle, 72°C, 7 minutes.
  • the PCR reaction mixtures were run on a 1% agarose gel and the DNA fragments corresponding to the expected size is were extracted from the gel using a QIAquickTM Gel Extraction Kit (Qiagen, Cat. No. 28704).
  • the plasmid pZMP31 is a mammalian expression vector containing an expression cassette having the chimeric CMV enhancer/MPSV promoter, Fsel, Narl and a BgIII site for linearization prior to yeast recombination, an E. coli origin of replication; a mammalian selectable marker expression unit comprising an SV40 promoter, enhancer and origin of replication, a DHFR gene, and the SV40 terminator; and URA3 and CEN-ARS sequences required for selection and replication in S. cerevisiae.
  • the plasmid pZMP31 was digested with BgIII prior to recombination in yeast with the following gel extracted PCR fragments mentioned above. Fifty ⁇ l of competent yeast (S. cerevisiae) cells were combined with 3 ⁇ l of each PCR fragment insert DNA and apx. 50 ng of BgIII digested pZMP31 vector. The mix was transferred to a 0.2 cm electroporation cuvette. The yeast/DNA mixture was electropulsed using power supply (BioRad Laboratories, Hercules, CA) settings of 0.75 kV (5 kV/cm), oo ohms, and 25 ⁇ F.
  • power supply BioRad Laboratories, Hercules, CA
  • Transformation of electrocompetent E. coli host cells was performed using 4 ⁇ l of the yeast DNA preparation and 50 ⁇ l of E. coli cells. The cells were electropulsed at 1.75 kV, 25 ⁇ F, and 400 ohms. Following electroporation, .5 ml LB was added and then the cells were plated in 10 ⁇ l and 30 ⁇ l aliquots on two LB AMP plates (LB broth (Lennox), 1.8% BactoTM Agar (Difco), 100 mg/L Ampicillin).
  • the same process was used to prepare the truncated soluble Human FGFR3IIIc (S249W) Fc5 construct, designated MPET construct #1920 (SEQ ID NOS:9 and 10).
  • the first fragment represented a 5' overlap with an optimized TPA leader in the pZMP31 vector sequence followed by sequence of Human FGFR3IIIc encoding a S249W point mutation and a 3' overlap with downstream Human FGFR3IIIc sequence.
  • the PCR amplification reactions used the 5' oligonucleotides zc62560 ((SEQ ID NO: 11) (Forward primer to generate a PCR frag using FGFR3 IIIc as template. Fragment will generate a Ig D2 D3 form.
  • Sequence of the truncated FGFR3 IHc starts at D 156 of SEQ ID NO:2, upstream of Ig D2. Fragment to be cloned into pZMP31 utilizing the opTPA leader seq.)). The PCR was run with the 3' oligonucleotides zc62557 (SEQ ID NO:4) (Reverse primer to generate a PCR frag using FGFR3 IIIc as template. Fragment will generate a S249W mutation. To be used with a Forward primer nested at 5' end of Rec sequence)), and utilized clonetrack ID #102551 Human FGFR3IIIc as template.
  • This fragment was generated utilizing the same PCR thermocycles noted earlier and introduced into the BgIII digested pzMP31 vector along with the second and third fragments noted above to generate a truncated soluble Human FGFR3IIIc (S249W) Fc5 construct.
  • the supernatants were decanted and the pellets were washed with 1 mL of 70% ethanol and allowed to incubate for 5 minutes at room temperature.
  • the tubes were spun in a microfuge for 10 minutes at 14,000 RPM and the supernatants were decanted off the pellets.
  • the pellets were allowed to dry in the open air for apx. 5 min, then resuspended in 0.4 mis of 37°C, pre-warmed CHO cell tissue culture medium and allowed to incubate at 37°C for 10 minutes.
  • the CHO cells were subjected to nutrient selection and amplification to 50OnM Methotrexate (MTX).
  • the selected CHO lines were designated MECL 1334
  • each CHO pool flask was seeded into a 3L spinner flask to attain a IL working volume at .5e6c/ml using ZM2 medium (SAFC Biosciences Ex-CELL catalog # 68041) with the addition of 5 mM L-glutamine (from 200 mM L- glutamine, Gibco catalog #25030-081), 1 mM sodium pyruvate (from 100 mM Sodium Pyruvate, Gibco catalog #11360-070) without selection.
  • the spinner flasks were cultured at 37°C, 95 rpm and 6% CO2.
  • a series of expression constructs containing the first, second and third extracellular Ig like domains of Human FGFR3mC or a truncated form with the second and third extracellular Ig like domains of Human FGFR3mC were generated. These Human FGFR3mC sequence spans were fused with a downstream C-terminal Fc5, a linker and downstream, c-terminal. scFv sequences specific for binding to VEGF-A. Constructs in this series included the Human FGFR3 m c sequence spans mentioned above and a point mutation that yielded a Tryptophan residue at amino acid position 162 of SEQ ID NO:64 and 142 of SEQ ID NO:62 instead of a Serine at this position.
  • This mutation is noted as S249W. (The position of the mutation is in reference to the native FGFR3 m c Amino Acid sequence). These constructs were generated via PCR and homologous recombination using DNA fragments encoding the FGFR3IIIc domains with Fc5 sequence and the expression vector pZMP31 which contained the VEGF-A scFv sequences 870e6 and 1094.1.
  • the PCR fragment represented a 5' overlap with an optimized TPA leader in the pZMP31 based vector sequences followed by sequence of Human FGFR3 m c encoding a S249W point mutation, Fc5 sequence and a 3' overlap with a linker sequence.
  • the PCR amplification reactions used the 5' oligonucleotides zc62552 (SEQ ID NO: 3) (Forward primer to generate a PCR frag using FGFR3mC as template. Seq of FGFR3mC starts at E23 upstream of Ig Dl. Fragment to be cloned into pZMP31 utilizing the opTPA leader seq).
  • the PCR was run with the 3' oligonucleotides zc60566 (SEQ ID NO: 82) and utilized MPET construct #1917 (SEQ ID NO: 1) as template.
  • the PCR amplification reaction conditions to generate the three fragments noted above were as follows: 1 cycle, 95°C, 5 minutes; 25 cycles, 95°C, 30 seconds, followed by 55°C, 30 seconds, followed by 68°C, 2 minutes; 1 cycle, 72°C, 7 minutes.
  • the PCR reaction mixtures were run on a 1% agarose gel and the DNA fragments corresponding to the expected size is were extracted from the gel using a QIAquickTM Gel Extraction Kit (Qiagen, Cat. No. 28704).
  • the plasmids MVC 709 and MVC 710 are pZMP31 based mammalian expression vectors which contain Murine Fc2, a linker and downstream sequence of the 870e6 (SEQ ID NO:43) or 1094.1 scFv (SEQ ID NO:45), VEGF-A binding sequences. These vectors contain an expression cassette having the chimeric CMV enhancer/MPSV promoter, Fsel, Narl and a BgIII site for linearization prior to yeast recombination, an E.
  • coli origin of replication a mammalian selectable marker expression unit comprising an SV40 promoter, enhancer and origin of replication, a DHFR gene, and the SV40 terminator; and URA3 and CEN-ARS sequences required for selection and replication in S. cerevisiae.
  • the plasmids MVC 709 and MVC 710 were digested with BgIII restriction enzyme prior to recombination in yeast with the following gel extracted PCR fragments mentioned above.
  • Sixty ⁇ l of competent yeast (S. cerevisiae) cells were combined with 5 ⁇ l of each PCR fragment insert DNA and apx. 50 ng of BgIII digested MVC 709 and MVC 710 vectors. The mix was transferred to a 0.2 cm electroporation cuvette.
  • the yeast/DNA mixture was electropulsed using power supply (BioRad Laboratories, Hercules, CA) settings of 0.75 kV (5 kV/cm), ⁇ ohms, and 25 ⁇ F.
  • E. coli host cells (DH 12S) was performed using 4 ⁇ l of the extracted yeast plasmid DNA preparation and 50 ⁇ l of E. coli cells. The cells were electropulsed at 1.75 kV, 25 ⁇ F, and 400 ohms. Following electroporation, .5 ml LB was added and then the cells were plated in 10 ⁇ l and 30 ⁇ l aliquots on two LB AMP plates (LB broth (Lennox), 1.8% BactoTM Agar (Difco), 100 mg/L Ampicillin).
  • This fragment was generated utilizing the same PCR thermocycles noted earlier and introduced into the BgIII digested MVC 709 and MVC 710 vectors to generate a truncated soluble Human FGFR3IIIc (S249W) Fc5, a linker and downstream c-terminal scFv sequences specific for binding to VEGFA construct as described earlier.
  • S249W truncated soluble Human FGFR3IIIc
  • 293F cells (Invitrogen, Carlsbad, CA Cat# R790-07). Mega prep DNA was prepared for each plasmid using a Qiagen Plasmid Mega Kit (Qiagen, Valencia, CA). 293F suspension cells were cultured in 293 Freestyle medium (Invitrogen, Carlsbad, CA Cat# 12338- 018) at 37° C, 6% CO2 in 3 L spinner flasks at 95 RPM. Fresh medium was added immediately prior to transfection to obtain a 1.5 liter working volume at a final density of 1 xlOE6 cells/mL.
  • 293F suspension cells were cultured in 293 Freestyle medium (Invitrogen, Carlsbad, CA Cat# 12338- 018) at 37° C, 6% CO2 in 3 L spinner flasks at 95 RPM. Fresh medium was added immediately prior to transfection to obtain a 1.5 liter working volume at a final density of 1 xlOE6 cells/mL.
  • Opti-MEM medium Invitrogen, Carlsbad, CA Cat# 31985-070
  • Plasmid DNA was diluted in a separate tube of 20 mL Opti-MEM. Each tube was incubated separately at room temperature for 5 minutes, then combined and incubated together for an additional 30 minutes at room temperature with occasional gentle mixing.
  • the lipid-DNA mixture was added to each spinner of 293F cells which were then returned to 37° C, 6% CO2 at 75 RPM. After approximately 96 hours, the conditioned medium was harvested, 0.2 ⁇ M filtered and submitted for protein purification.
  • Conditioned media were delivered to purification as a 0.2 ⁇ sterile filtered deliverable, containing 0.02% Sodium Azide. No further adjustments were made prior to loading the media to the affinity capture column.
  • Elution of bound protein was accomplished via descending pH gradient, formed between the equilibration Buffer A and elution Buffer B of the following composition: 10 mM Mono-Basic Sodium Phosphate, 10 mM Citric Acid Monohydrate, 250 mM [NH4]2S04 at pH 3.0 containing 0.02% sodium azide (w/v). Elution of the large scale process was at 30 mL per minute flow rate while forming a 3 column volume gradient between Buffer A and Buffer B. Fractions (10 mL) were collected over 0.5 mL 2M Tris pH 8.0 buffer, contents were mixed immediately.
  • Elution for small scale process employed the same buffers and a 4 column volume gradient from Buffer A to Buffer B at a flow rate of 5 mL per minute. Fractions (4 mL) were collected over 0.25 mL 2 M Tris pH 8.0 buffer. All eluate fractions were mixed immediately to ensure rapid pH neutralization.
  • Small scale SEC was performed on a Pharmacia Superdex 200 prep grade SEC column (16/60 format with 120 mL bed volume). Depending on process scale, a flow rate of either 2.5 mL per minute or 1.5 mL per minute, for either large or small scale respectively, was employed for the SEC step. Fractions under the main symmetric peak were pooled with emphasis on excluding any minor levels of high molecular weight materials from the final product. The final pool was sterile filtered at 0.2 ⁇ and aliquots were made and stored at - 80 0 C. This is the same method is used for processing all FGFR receptors and bispecific binding compositions of a soluble FGF receptor (FGFR) and a VEGF-A antibody.
  • FGFR soluble FGF receptor
  • Example 17 H-Thymidine Proliferation Assay to Determine Neutralizing Activity of Soluble FGF receptors on FGF-stimulated HUVEC cells
  • HUVEC were plated into 96-well flat-bottom plates (Costar) in a volume of 100 ⁇ L at a density of 2000 cells per well.
  • the HUVEC proliferation assay was cultured for 2 days at 37°C, 5% CO2.
  • HUVEC were then pulsed for 18 hr with 1 ⁇ Ci per well of 3H-thymidine (Amersham, TRK120), which is incorporated into proliferating cells (all at 37°C, 5% CO2).
  • the cells were harvested and counted on Packard TopCount NXT plate reader.
  • Example 18 3 H-Thymidine Proliferation Assay to Determine Neutralizing Activity of Soluble FGF receptors on FGF8b-stimulated LNCap cells
  • Soluble human FGFRs (R1-R4) from R&D Systems and FGFRs 3 and 2 from ZymoGenetics were then titrated from 1 -2 ug/ml and serially diluted to 31-15 ng/ml in assay media.
  • LNCap cells were plated into 96- well flat-bottom plates (Costar) in a volume of 100 ⁇ L at a density of 2500 cells per well.
  • the LNCap proliferation assay was cultured for 3 days at 37°C, 5% CO 2 .
  • LNCap were then pulsed for 8 hr with 1 ⁇ Ci per well of H-thymidine (Amersham, TRK120), which is incorporated into proliferating cells (all at 37°C, 5% CO 2 ).
  • the cells were harvested and counted on Packard TopCount NXT plate reader.
  • Example 19 3 H-Thymidine Proliferation Assay to Determine Neutralizing Activity of Soluble FGF receptors on FGF8b-stimulated MCF-7 cells
  • MCF-7 cells are plated into 96-well flat-bottom plates (Costar) in a volume of 100 ⁇ L at a density of 1250 cells per well.
  • the MCF-7 proliferation assay are cultured for 4 days at 37°C, 5% CO 2 .
  • Cells are then be pulsed for 8 hr with 1 ⁇ Ci per well of 3 H-thymidine (Amersham, TRK 120), which is incorporated into proliferating cells (all at 37°C, 5% CO 2 ).
  • the cells are harvested and counted on Packard TopCount NXT plate reader.
  • Example 20 3 H-Thymidine Proliferation Assay to Determine Neutralizing Activity of sFGFR- Fc on FGF-9-stimulated HCO osteoblasts
  • FGFRl-Fc, FGFR2-Fc, FGFR3-Fc, and FGFR4-Fc were serially diluted in ObM assay media at 6 nM, 2 nM, 0.67 nM, 0.22 nM, 0.07 nM, and 0.02 nM.
  • FGFR3-Fc mutants (ZymoGenetics, Seattle, WA) were also similarly diluted.
  • HCO cells were plated in ObM supplemented with 5% FBS and osteoblast growth supplement (ObGS, ScienCell) in 96-well flat-bottom plates in a volume of 100 ⁇ L at a density of 1000 cells per well. The plates were incubated at 37°C, 5% CO 2 overnight.
  • the cells were serum-starved with ObM assay media for 24 h, stimulated for 24 h with 1.2 nM FGF-9 with or without serially diluted FGFR-Fc, and pulsed for 24 h with 1 ⁇ Ci per well of 3 H-thymidine (GE Healthcare Biosciences, Piscataway, NJ), which is incorporated into proliferating cells (all at 37°C, 5% CO 2 ).
  • the cells were harvested and counted on a Packard TopCount NXT.
  • Results demonstrate that the mutant FGFR3-Fc constructs significantly inhibited human osteoblasts proliferation and had IC50s within a 3-fold range of the FGFR3-Fc from R&D Systems as shown in Figure 3 and Figure 2 illustrates that Full-length FGFR3-Fc wild-type and mutant constructs (ZymoGenetics) have similar IC50s.
  • Table 28 FGFR-Fc IC50s in the osteoblast roliferation assay.
  • FGFR-Fcs were diluted to 100 nM with PBS/0.1x BLOTTO/10 ug/ml porcine heparin (Sigma, St. Louis, MO) and then 1 :2 serial dilutions were made, ending at 0.10 nM.
  • 100 ⁇ L of FGFR-Fcs were plated and incubated at 4 0 C overnight. The following day, the plates were washed 5 times with ELISA C and then incubated with 2.5 ⁇ g/mL horseradish peroxidase-conjugated anti-human Fc antibody (Jackson ImmunoResearch Laboratories, West Grove, PA) for 1 h at room temperature with shaking.
  • FGFR3 soluble FGF receptors
  • Fc-tag was used to capture the FGFR molecule onto a Biacore chip previously immobilized with Protein-A.
  • FGF ligands were flowed over the surface in a heparin-containing buffer. While the FGF ligands are monomers, they are believed to associate into dimers in the presence of heparin. Consequently, the bivalent analyte model was determined to be appropriate for these interactions.
  • FGF receptors were characterized for their binding affinity for FGF ligands.
  • Association rate constants (k a (M 4 S 4 )) and dissociation rate constants (k d (s 4 )) were measured for each interaction.
  • the association rate constant is a value that reflects the rate of the ligand-receptor complex formation.
  • the dissociation rate constant is a value that reflects the stability of this complex.
  • Equilibrium binding affinity is typically expressed as either an equilibrium dissociation constant (K D (M)) or an equilibrium association constant (K A (M "1 )).
  • K D is obtained by dividing the dissociation rate constant by the association rate constant (k d /k a ), while K A is obtained by dividing the association rate constant by the dissociation rate constant (k a /k d ).
  • Molecules with similar K D (or a similar K A ) can have widely variable association and dissociation rate constants. Consequently, measuring the k a and k d as well as the K A or K D helps to more uniquely describe the affinity of the ligand-receptor interaction.
  • Biacore T 100TM Binding kinetics and affinity studies were performed on a Biacore T 100TM system (GE Healthcare, Piscataway, NJ). Methods for the Biacore T 100TM were programmed using Biacore T100TM Control Software, v 2.0. Since each of the FGF receptor molecules contained a human Fc domain, biotinylated protein-A (Thermo Fisher Scientific Inc, Rockford, IL) was used as a capture reagent for these studies.
  • Biotinylated protein-A was diluted to concentration of 50 ⁇ g/mL in HBS-EP buffer (10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20; GE Healthcare, Piscataway, NJ), and then captured to all four flow cells of a SA (streptavidin) sensor chip. A density of approximately 1100 RU was obtained for each flow cell. Each FGF receptor molecule was subsequently captured via protein-A onto a separate flow cell of the SA chip at an approximate density of 150-250 RU. The Biacore instrument measures the mass of protein bound to the sensor chip surface, and thus, capture of the receptor was verified for each cycle.
  • HBS-EP buffer 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20; GE Healthcare, Piscataway, NJ
  • HBS-P buffer (10 mM HEPES, 150 mM NaCl, 0.05% Surfactant P20, pH 7.4; GE Healthcare, Piscataway, NJ), containing 50 ⁇ g/mL heparin (Calbiochem, La Jolla, Ca ).
  • the kinetics of binding interactions of the various FGFR3 molecules with FGF6 are detailed in Table 30.
  • the affinity of the full-length FGFR molecule (23 375) was similar to that of the two domain FGFR molecule (143 375).
  • the point mutations increased the affinity for FGF6, with the affinity of S249W > P250R > wild type. In general, this increase in affinity was primarily due to a slower dissociation rate constant.
  • Example 23 H-Thymidine Proliferation Assay to Determine the Inhibition of Proliferation by FGFR-Fc on Tumor Cells
  • FGFR-Fc To determine the ability of FGFR-Fc to inhibit the proliferation of tumor cells, a 3 H- thymidine assay was run. Caki-1 and DU145 tumor cells were plated were plated into 96-well flat- bottom plates at a density of 2000 cells per well and incubated at 37°C, 5% CO 2 overnight. The next day, FGFR-Fc constructs were serially diluted in RPMI 1640 (with 0.5% FBS, 1 mM sodium pyruvate, and 2 mM GlutaMAX) at 20, 10, and 5 ⁇ g/mL and plated onto the cells for 3 days at 37°C, 5% CO 2 .
  • RPMI 1640 with 0.5% FBS, 1 mM sodium pyruvate, and 2 mM GlutaMAX
  • the cells were pulsed for 24 h with 1 ⁇ Ci per well of H-thymidine (GE Healthcare Biosciences, Piscataway, NJ), which is incorporated into proliferating cells.
  • the cells were harvested and counted on a Packard TopCount NXT.
  • Example 24 Inhibition of endothelial cell sprouting by sFGFR-VEGF scFv proteins
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein
  • an in vitro co-culture system of endothelial cells and pericytes are established as described (Darland et al, Dev Biol 264 (2003), 275).
  • HUVECs coated on Cytodex beads are co-cultured with human mesenchymal stem cells (Lonzo) in presence of EGM-2 complete media and D551 fibroblast conditioned media in fibrin gel.
  • VEGF-A antagonist Either at start of the experiment or at Day 7 of the experiment, 0.04-50 nM of control anatgonist, VEGF-A antagonist or a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein are added to the cultures.
  • Cells are fixed on Day 8 after addition of antagonists using PFA.
  • Cells are then stained by IHC using anti-smooth muscle cell actin (aSMA) or anti-PECAM antibodies to identify pericytes and endothelial cells respectively. In wells with control antagonist treatment, these cells form sprouts of endothelial cells protected by a covering of pericytes.
  • aSMA anti-smooth muscle cell actin
  • PECAM anti-PECAM antibodies
  • a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein
  • numbers of sprouts and length of the sprouts are reduced suggesting that the antagonist shows efficacy in this in vitro co-culture model.
  • Cells are stained with anti-PECAM or anti-SMA antibodies followed by secondary antibody (fluorescent conjugated). Cells are then viewed by micoscope and the numbers and lengths of sprouts counted manually for a representative set of 10 beads /well. The averages for the well are then calculated.
  • Example 25 Prophylactic treatment with sFGFR-Fc proteins inhibits growth of A549 lung carcinoma cells in Nu/Nu mice
  • Example 26 Therapeutic treatment with sFGFR-Fc proteins inhibits growth of A549 lung carcinoma cells in Nu/Nu mice
  • mice are injected s.c with the A549 lung carcinoma tumors on Day 0.
  • Example 27 Prophylactic treatment with sFGFR-Fc proteins inhibits growth of DU145 prostate cancer cells in Nu/Nu mice
  • Example 28 Therapeutic treatment with sFGFR-Fc proteins inhibits growth of DU145 prostate carcinoma cells in Nu/Nu mice
  • mice are injected s.c with the DU145 prostate carcinoma tumors on Day 0.
  • Example 29 Prophylactic treatment with bispecific binding proteins inhibits growth of A549 lung carcinoma cells a cells in Nu/Nu mice
  • mice are injected s. c with the A549 lung carcinoma tumors on Day 0.
  • Tumor volume is monitored 3X/week.
  • Example 31 Prophylactic treatment with bispecific binding protein inhibits growth of DU145 prostate cancer cells in Nu/Nu mice
  • mice injected with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein indicate efficacy of the antagonist for inhibition of tumor growth.
  • Tumor growth is monitored 3X/week for 4 weeks using caliper measurements. Tumor volume is calculated using the formula / / 2*(B)2*L (mm3). At the end of the study (24hrs after last dose), mice are terminated and tumors weighed and submitted for histology. Tumors are fixed in NBF and are then tested for blood vessel density by immunohistochemistry using the MECA-32 antibody that is specific for mouse endothelial cells.
  • Example 32 Therapeutic treatment with bispecific binding proteins inhibits growth of DU145 prostate carcinoma cells in Nu/Nu mice
  • mice are injected s.c with the DU145 prostate carcinoma tumors on Day 0.
  • Tumor volume is monitored 3X/week.
  • Significantly smaller tumors in mice injected with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein, as compared to mice injected with control reagent indicate efficacy of the antagonist for inhibition of tumor growth.
  • mice are terminated and tumors weighed. Tumors are also submitted for histological analysis for microvessel density. [354] Results: Significantly smaller tumors in mice injected with a bispecific binding protein comprising a VEGF-A antibody/soluble FGF receptor bispecific binding protein as compared to mice injected with control reagent, indicate efficacy of the antagonist for inhibition of tumor growth.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2010/028877 2009-03-27 2010-03-26 Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination Ceased WO2010111625A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
MX2011009810A MX2011009810A (es) 2009-03-27 2010-03-26 Composiciones y metodos para usar proteinas de union multiespecificas que comprenden una combinacion anticuerporeceptor.
AU2010229705A AU2010229705A1 (en) 2009-03-27 2010-03-26 Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination
CN2010800230893A CN102448984A (zh) 2009-03-27 2010-03-26 使用包含抗体-受体组合的多特异性结合蛋白的组合物和方法
US13/260,408 US20120134993A1 (en) 2009-03-27 2010-03-26 Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination
JP2012502294A JP2012521768A (ja) 2009-03-27 2010-03-26 抗体−受容体の組み合わせを含む多特異的結合性タンパク質を用いるための組成物および方法
EP10722828A EP2411407A1 (en) 2009-03-27 2010-03-26 Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US16402309P 2009-03-27 2009-03-27
US61/164,023 2009-03-27

Publications (1)

Publication Number Publication Date
WO2010111625A1 true WO2010111625A1 (en) 2010-09-30

Family

ID=42332479

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/028877 Ceased WO2010111625A1 (en) 2009-03-27 2010-03-26 Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination

Country Status (8)

Country Link
US (1) US20120134993A1 (https=)
EP (1) EP2411407A1 (https=)
JP (1) JP2012521768A (https=)
KR (1) KR20110134494A (https=)
CN (1) CN102448984A (https=)
AU (1) AU2010229705A1 (https=)
MX (1) MX2011009810A (https=)
WO (1) WO2010111625A1 (https=)

Cited By (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3013851A4 (en) * 2013-06-25 2016-12-28 Sépia Pesquisa E Desenvolvimento MODULATORS OF BRADYKININ RECEPTORS AND THEIR USE
WO2017091850A1 (en) * 2015-11-30 2017-06-08 Pieris Australia Pty Ltd. Novel anti-angiogenic fusion polypeptides
WO2018011421A1 (en) 2016-07-14 2018-01-18 Genmab A/S Multispecific antibodies against cd40 and cd137
US9879081B2 (en) 2013-06-25 2018-01-30 Samsung Electronics Co., Ltd. Protein complex, bispecific antibody including the protein complex, and method of preparation thereof
EP3161000A4 (en) * 2014-06-28 2018-05-02 Kodiak Sciences Inc. Dual pdgf/vegf antagonists
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
WO2018178396A1 (en) 2017-03-31 2018-10-04 Genmab Holding B.V. Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof
WO2019025545A1 (en) 2017-08-04 2019-02-07 Genmab A/S BINDING AGENTS BINDING TO PD-L1 AND CD137 AND THEIR USE
US10363290B2 (en) 2014-10-17 2019-07-30 Kodiak Sciences Inc. Butyrylcholinesterase zwitterionic polymer conjugates
WO2020060406A1 (en) 2018-09-19 2020-03-26 Lava Therapeutics B.V. Novel bispecific antibodies for use in the treatment of hematological malignancies
WO2020070313A1 (en) 2018-10-04 2020-04-09 Genmab Holding B.V. Pharmaceutical compositions comprising bispecific anti-cd37 antibodies
WO2020094744A1 (en) 2018-11-06 2020-05-14 Genmab A/S Antibody formulation
US10702608B2 (en) 2013-09-08 2020-07-07 Kodiak Sciences Inc. Factor VIII zwitterionic polymer conjugates
WO2020159368A1 (en) 2019-02-01 2020-08-06 Lava Therapeutics B.V. Novel cd40-binding antibodies
NL2022494B1 (en) 2019-02-01 2020-08-19 Lava Therapeutics B V Novel CD40-binding antibodies
EP3792283A1 (en) 2019-09-16 2021-03-17 Lava Therapeutics B.V. Treatment of cancer comprising administration of vgamma9vdelta2 t cell receptor binding antibodies
US11066465B2 (en) 2015-12-30 2021-07-20 Kodiak Sciences Inc. Antibodies and conjugates thereof
WO2021156258A1 (en) 2020-02-04 2021-08-12 BioNTech SE Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137
WO2021185934A1 (en) 2020-03-18 2021-09-23 Genmab A/S Antibodies binding to b7h4
US11155610B2 (en) 2014-06-28 2021-10-26 Kodiak Sciences Inc. Dual PDGF/VEGF antagonists
WO2022008646A1 (en) 2020-07-08 2022-01-13 LAVA Therapeutics N.V. Antibodies that bind psma and gamma-delta t cell receptors
WO2022029011A1 (en) 2020-08-06 2022-02-10 BioNTech SE Binding agents for coronavirus s protein
US11359015B2 (en) 2015-07-15 2022-06-14 Genmab A/S Humanized or chimeric CD3 antibodies
WO2022122973A1 (en) 2020-12-10 2022-06-16 LAVA Therapeutics N.V. Antibodies that bind gamma-delta t cell receptors
WO2022180271A1 (en) 2021-02-26 2022-09-01 LAVA Therapeutics N.V. Antibodies that bind CD123 and gamma-delta T cell receptors
WO2022234146A1 (en) 2021-05-07 2022-11-10 Genmab A/S PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3
WO2022268740A1 (en) 2021-06-21 2022-12-29 Genmab A/S Combination dosage regime of cd137 and pd-l1 binding agents
WO2023037333A1 (en) 2021-09-13 2023-03-16 Janssen Biotech, Inc CD33 X Vδ2 MULTISPECIFIC ANTIBODIES FOR THE TREATMENT OF CANCER
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
WO2023067138A1 (en) 2021-10-21 2023-04-27 LAVA Therapeutics N.V. Uses of gamma delta t cell activating antibodies
EP3998083A4 (en) * 2019-07-12 2023-08-23 Chugai Seiyaku Kabushiki Kaisha Anti-mutation type fgfr3 antibody and use therefor
WO2023174521A1 (en) 2022-03-15 2023-09-21 Genmab A/S Binding agents binding to epcam and cd137
US11819531B2 (en) 2009-12-18 2023-11-21 Kodiak Sciences Inc. Multifunctional zwitterionic polymer conjugates
EP4285926A1 (en) 2022-05-30 2023-12-06 LAVA Therapeutics N.V. Combination treatment for chronic lymphocytic leukemia
US11845805B2 (en) 2020-09-10 2023-12-19 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma
EP4292609A1 (en) 2022-06-15 2023-12-20 LAVA Therapeutics N.V. Compositions comprising antibodies that bind gamma-delta t cell receptors
EP4292610A1 (en) 2022-06-15 2023-12-20 LAVA Therapeutics N.V. Variant antibodies that bind gamma-delta t cell receptors
US11858995B2 (en) 2020-09-10 2024-01-02 Genmab A/S Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia
WO2024010445A1 (en) 2022-07-06 2024-01-11 ACADEMISCH ZIEKENHUIS LEIDEN (h.o.d.n. LUMC) Bispecific antibody and uses thereof
US11912784B2 (en) 2019-10-10 2024-02-27 Kodiak Sciences Inc. Methods of treating an eye disorder
US12071476B2 (en) 2018-03-02 2024-08-27 Kodiak Sciences Inc. IL-6 antibodies and fusion constructs and conjugates thereof
EP4438624A1 (en) 2023-03-27 2024-10-02 LAVA Therapeutics N.V. Antibodies that bind nectin-4 and gamma-delta t cell receptors
WO2024200573A1 (en) 2023-03-27 2024-10-03 LAVA Therapeutics N.V. Nectin-4 binding agents and methods of use
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3
WO2025003280A1 (en) 2023-06-30 2025-01-02 Genmab A/S Antibodies binding to fibroblast activation protein alpha and death receptor 4
WO2025012118A2 (en) 2023-07-07 2025-01-16 LAVA Therapeutics N.V. 5t4 binding agents and methods of use
WO2025024780A1 (en) 2023-07-27 2025-01-30 LAVA Therapeutics N.V. Antibodies that bind gamma-delta t cell receptors for the treatment of cancer
WO2025056778A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists
US12435154B2 (en) 2020-05-08 2025-10-07 Genmab A/S Bispecific antibodies against CD3 and CD20
EP4678661A2 (en) 2015-01-08 2026-01-14 Genmab A/S Bispecific antibodies against cd3 and cd20
US12617854B2 (en) 2015-07-15 2026-05-05 Genmab A/S Humanized or chimeric CD3 antibodies

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HK1219533A1 (zh) * 2013-03-15 2017-04-07 Intermune, Inc. 蛋白质组学ipf标志物
KR102060187B1 (ko) 2013-07-19 2019-12-27 삼성전자주식회사 Vegf-c, vegf-d 및/또는 안지오포이에틴-2를 동시에 저해하는 융합 폴리펩타이드 및 이의 용도
CN104177492B (zh) * 2014-07-21 2017-02-22 暨南大学 FGFR2c胞外段类似物及其编码基因与应用
KR102470456B1 (ko) 2014-09-26 2022-11-23 얀센 파마슈티카 엔.브이. Fgfr 억제제를 사용한 치료에 반응할 암 환자를 확인하는 데 있어서 fgfr 돌연변이 유전자 패널의 사용
CA3138083A1 (en) 2014-12-22 2016-06-30 Systimmune, Inc. Bispecific tetravalent antibodies and methods of making and using thereof
US12428483B2 (en) 2014-12-22 2025-09-30 Systimmune, Inc. Bispecific tetravalent antibodies and methods of making and using thereof
CN116199744B (zh) * 2023-03-23 2024-06-25 湖南中晟全肽生物科技股份有限公司 一种结合fgfr2受体的多肽及其用途

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003020906A2 (en) * 2001-08-31 2003-03-13 Abmaxis, Inc. Multivalent protein conjugate with multiple ligand-binding domains of receptors

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004536579A (ja) * 2001-04-13 2004-12-09 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド 血管内皮増殖因子2
WO2005087812A1 (en) * 2004-03-05 2005-09-22 Ludwig Institute For Cancer Research Multivalent antibody materials and methods for vegf/pdgf family of growth factors
BRPI0510716A (pt) * 2004-05-05 2007-11-20 Merrimack Pharmaceuticals Inc uso de um agente de ligação bi-especìfico, agente de ligação bi-especìfico, composição de um agente de ligação bi-especìfico, e, kit
EP2083081A1 (en) * 2005-07-22 2009-07-29 Five Prime Therapeutics, Inc. Compositions and methods of treating disease with FGFR fusion proteins
US20090304719A1 (en) * 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
EP2604279A1 (en) * 2008-03-27 2013-06-19 ZymoGenetics, Inc. Compositions and methods for inhibiting PDGFRBETA and VEGF-A

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003020906A2 (en) * 2001-08-31 2003-03-13 Abmaxis, Inc. Multivalent protein conjugate with multiple ligand-binding domains of receptors

Non-Patent Citations (215)

* Cited by examiner, † Cited by third party
Title
AHMAD ET AL., EXPERT REV MOL MED, vol. 1O, 2008, pages E16
AHN ET AL., HUM. GENE THER., vol. 14, 2003, pages 1389 - 99
ALFTHAN ET AL., PROTEIN ENG., vol. 8, 1995, pages 725 - 731
ALLEN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1068, 1991, pages 133
ALLEN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1150, 1993, pages 9
ALLEN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1150, no. 9, 1993
ALMOG ET AL., PROTEINS, vol. 31, 1998, pages 128 - 138
ALTSCHUL, BULL. MATH. BIO., vol. 48, 1986, pages 603
AMSTER ET AL., NUC. ACIDS RES., vol. 8, 1980, pages 2055 - 2065
ANDERSON ET AL., CANCER RES., vol. 50, 1990, pages 1853
ANDERSON ET AL., INFECT. IMMUN., vol. 31, 1981, pages 1099
ARUFFO ET AL., CELL, vol. 61, 1990, pages 1303 - 1313
ATWELL ET AL., MOLECULAR IMMUNOLOGY, vol. 33, 1996, pages 1301 - 1312
BAKER, LARYNGOSCOPE, vol. 95, 1985, pages 43 - 56
BAKKER-WOUDENBERG ET AL., EUR. J. CLIN. MICROBIOL. INFECT. DIS., vol. 12, no. 1, 1993, pages 61
BARTUS ET AL., SCIENCE, vol. 281, 1998, pages 1161
BATCHELOR ET AL., CANCER CELL, vol. 11, 2007, pages 83 - 95
BAUMGARTNCR ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 29094 - 29101
BEHRENS, CLIN CANCER RES., vol. 14, 2008, pages 6014 - 6022
BELLO ET AL., CLIN. CANCER RES., vol. 8, 2002, pages 3539 - 48
BENJAMIN, ANN. REV. IMMUNOL., vol. 2, 1984, pages 67 - 101
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BONNING ET AL., I. GEN. VIROL., vol. 75, 1994, pages 1551 - 1556
BOSS ET AL., NUC. ACIDS RES., vol. 12, 1984, pages 3791 - 3806
BOTHWELL ET AL., NATURE, vol. 298, 1982, pages 380 - 382
BOYTON; ALTMANN, CLIN. EXP. IMMUNOL., vol. 149, 2007, pages 1 - 8
BRAAKHUIS ET AL., CANCER RES., vol. 51, 1991, pages 211 - 4
BRAHIMI-HORN; POUYSSEGUR, BULL. CANCER, vol. 93, 2006, pages E73
BREINER ET AL., GENE, vol. 18, 1982, pages 165 - 174
BREMER, PHARM. BIO/ECHNOL., vol. 10, 1997, pages 239
CANFIELD; MORRISON, J. EXP. MED., vol. 173, 1991, pages 1483
CAO ET AL., CLIN. CANCER RES., vol. 5, 1999, pages 1925 - 34
CAO YIHAI ET AL: "Therapeutic targets of multiple angiogenic factors for the treatment of cancer and metastasis.", ADVANCES IN CANCER RESEARCH 2007 LNKD- PUBMED:17419947, vol. 97, 2007, pages 203 - 224, XP008124688, ISSN: 0065-230X *
CARTER; MERCHANT, CURR. OPIN. BIOTECHNOL., vol. 8, 1997, pages 449 - 454
CASANOVAS ET AL., CANCER CELL, vol. 8, 2005, pages 299 - 309
CHAMBERS ET AL., ANN. REV. IMMUNAL., vol. 19, 2001, pages 565 - 94
CHAMOW ET AL., TIBTECH, vol. 14, 1996, pages 52 - 60
CHASIN ET AL., SOM. CELL. MOLEC. GENET., vol. 12, 1986, pages 555
CHAUDRI ET AL., FEBS LETTERS, vol. 450, 1999, pages 23 - 26
CHAZENBALK; RAPOPORT, J. BIOL. CHEM., vol. 270, 1995, pages 1543 - 1549
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CICCARONE ET AL., FOCUS, vol. 15, 1993, pages 80
CLAASSEN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 802, 1984, pages 428
COHEN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1063, 1991, pages 95
CORSARO; PEARSON, SOMATIC CELL GENETICS, vol. 7, 1981, pages 603
CRANSTON ET AL., CANCER RES., vol. 63, 2003, pages 4777 - 80
DEGEN ET AL., J. NEUROSURG., vol. 99, 2003, pages 893 - 8
DONG ET AL., CANCER GENE THER., vol. 10, 2003, pages 96 - 104
DORKIN ET AL., ONCOGENE, vol. 18, 1999, pages 2755 - 2761
DROCOURT ET AL., NUCL. ACIDS RES., vol. 18, 1990, pages 4009
DUNCAN ET AL., NATURE, vol. 332, 1988, pages 563
ELLIS; HICKLIN, NAT. REV. CANCER, vol. 8, 2008, pages 579
ELLISON ET AL., DNA, vol. 1, 1981, pages 11 - 18
ELLISON ET AL., NUCLEIC ACIDS RES., vol. 10, 1982, pages 4071 - 4079
ELSHEIKH ET AL., BREAST CANCER RES., vol. 9, 2007
ENGELHARD ET AL., NEUROSUGERY, vol. 48, 2001, pages 616 - 24
ESWARAKUMAR ET AL., CYTOKINE GROWTH FACTOR REV., vol. 16, 2005, pages 139 - 149
FAN ET AL., TRENDS PHARMACOL. SCI., vol. 16, 1995, pages 57
FARES ET AL., ENDOCRINOLOGY, vol. 139, 1998, pages 2459 - 2464
FERRARA ET AL., NAT MED, vol. 9, 2003, pages 669
FIDLER, NAT NEW BIOL., vol. 242, 1973, pages 148 - 9
FOLKMAN, NATURE MED., vol. 1, 1995, pages 27
GATIGNOL ET AL., MOL. GEN. GENET., vol. 207, 1987, pages 342
GETZOFF ET AL., ADV. IN IMMUNOL., vol. 43, 1988, pages 1 - 98
GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1989, pages 191 - 202
GIRI ET AL., CLIN CANCER RES., vol. 5, 1999, pages 1063 - 1071
GLEESON ET AL., J. GEN. MICROBIOL., vol. 132, 1986, pages 3459 - 3465
GNANAPRAGASAM ET AL., ONCOGENE, vol. 21, 2002, pages 5069 - 5080
GOMBOTZ; PETTIT, BIOCONJUGATE CHEM., vol. 6, 1995, pages 332
GRAHAM; VAN DER EB, VIROLOGY, vol. 52, 1973, pages 456
GREF ET AL., PHARM. BIOTECHNOL., vol. 10, 1997, pages 167
GROSE, CYTOKINE GROWTH FACTOR REV., vol. 16, 2005, pages 179 - 186
HALLEWELL ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 5260 - 5268
HARASYM ET AL., ADV. DRUG DELIV. REV., vol. 32, 1998, pages 99
HAWLEY-NELSON ET AL., FOCUS, vol. 15, 1993, pages 73
HEER ET AL., J PATHOL., vol. 204, 2004, pages 578 - 586
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915
HENNECKE ET AL., PROTEIN ENG., vol. 11, 1998, pages 405 - 410
HERMANS ET AL., CANCER RES., vol. 63, 2003, pages 8408 - 13
HERVITZ ET AL., N. ENGL. J. MED., vol. 350, 2004, pages 2335 - 2342
HIER ET AL., LARYNGOSCOPE, vol. 105, 1995, pages 1077 - 80
HILL-PERKINS; POSSEE,.I, GEN. VIROL., vol. 71, 1990, pages 971 - 976
HIRAKI ET AL., LUNG CANCER, vol. 35, 2002, pages 329 - 33
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL., MOL. IMMUNOL., vol. 28, 1991, pages 1027 - 1037
HOPP ET AL., BIOTECHNOLOGY, vol. 6, 1988, pages 1204 - 1210
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 1991
HOSSE ET AL., PROTEIN SCI., vol. 15, 2006, pages 14 - 27
HU ET AL., CANCER RES., vol. 56, 1996, pages 3055 - 3061
HU ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 7662 - 70
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
HUSSAIN ET AL., ONCOLOGY, vol. 49, 1992, pages 237 - 40
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
ISHIKAWA ET AL., CANCER SCI., vol. 95, 2004, pages 98 - 103
JHAPPAN ET AL., CELL, vol. 61, 1990, pages 1137 - 1146
KANO MITSUNOBU R ET AL: "VEGF-A and FGF-2 synergistically promote neoangiogenesis through enhancement of endogenous PDGF-B-PDGFRbeta signaling.", JOURNAL OF CELL SCIENCE 15 AUG 2005 LNKD- PUBMED:16105884, vol. 118, no. Pt 16, 15 August 2005 (2005-08-15), pages 3759 - 3768, XP002593101, ISSN: 0021-9533 *
KARLIN ET AL., J. MOL. EVOL., vol. 22, 1985, pages 195 - 208
KATO ET AL., BIOL. PHARM. BULL., vol. 16, 1993, pages 960
KATO; SUGIYAMA, CRIT. REV. THER. DRUG CARRIER SYST., vol. 14, 1997, pages 287
KENTEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 6661 - 6665
KHANDEKAR ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 32190 - 32197
KIM, DRUGS, vol. 46, 1993, pages 618
KINDSVOGEL ET AL., DNA, vol. 1, 1982, pages 335 - 343
KNOWLES, WORLD J. UROL., vol. 25, 2007, pages 581 - 593
KOIDE ET AL., J. MOL. BIOL., vol. 284, 1998, pages 1141 - 1151
KOIKE ET AL., HEPATOLOGY, vol. 19, 1994, pages 810 - 819
KONDO ET AL., EUR. J. IMMUNOL., vol. 23, 1993, pages 245 - 249
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KURIAKOSE ET AL., HEAD NECK, vol. 22, 2000, pages 57 - 63
KWABI-ADDO ET AL., ENDOCRINE-RELATED CANCER, vol. 11, no. 4, 2004, pages 709 - 724
KWABI-ADDO ET AL., PROSTATE, vol. 46, 2001, pages 163 - 172
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759
LEE ET AL., CANCER RES., vol. 52, 1992, pages 5162 - 5170
LI ET AL., ARCH. OLOLARYNGOL. HEAD NECK SURG., vol. 127, 2001, pages 1319 - 24
LI ET AL., J CLIN LNVEST., vol. 118, 2008, pages 2697 - 2710
LJUNGGREN; MALMBERG, NATURE REV. IMMUNUL., vol. 7, 2007, pages 329 - 339
LO, BENNY; K.C., A., ANTIBODY ENGINEERING, 2004
LOO ET AL., IMMUNOGENETICS, vol. 42, 1995, pages 333 - 341
LU ET AL., J. IMMUNOL. METHODS, vol. 267, 2002, pages 213 - 226
LUAN ET AL., TRANSPLANTATION, vol. 73, 2002, pages 1565 - 72
LUCKOW ET AL., J. VIROL., vol. 67, 1993, pages 4566 - 4579
LUMNICZKY ET AL., CANCER GENE THER., vol. 9, 2002, pages 44 - 52
MANIATIS ET AL., NATURE, vol. 341, 1989, pages 24
MARTINET ET AL., EUR. J. SURG. ONCOL., vol. 29, 2003, pages 351 - 7
MATTHEWS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 9026 - 9030
MEIJER ET AL., ENDOCRINE-RELATED CANCER, vol. 15, 2008, pages 101 - 111
MEIJER ET AL., J. MOL. BIOL., vol. 358, 2006, pages 764 - 772
MORRISON, SCIENCE, vol. 229, 1985, pages 1202
MOSMAN, J. LMMUNOL. METH., vol. 65, 1983, pages 55 - 63
MURAHASHI ET AL., BIOL. PHARM. BULL., vol. 20, 1997, pages 259
MURAKAMI ET AL., CANCER RES., vol. 53, 1993, pages 1719 - 1723
MUYLDERMANS; LAUWEREYS, J. MOL. RECOG., vol. 12, 1999, pages 131 - 140
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444
NEMATI ET AL., CLIN CANCER RES., vol. 6, 2000, pages 2075 - 86
NEUFELD ET AL., FASEB J., vol. 13, 1999, pages 9 - 22
NEUMANN ET AL., EMBO J., vol. 1, 1982, pages 841 - 845
NGUYEN ET AL., EMBO J., vol. 19, 2000, pages 921 - 930
NICHOLES ET AL., AMERICAN JOURNAL OF PATHOLOGY, vol. 160, 2002, pages 2295 - 2307
OGAWA ET AL., CANCER GENE THER., vol. 9, 2002, pages 633 - 640
OGAWA T ET AL: "Anti-tumor angiogenesis therapy using soluble receptors: enhanced inhibition of tumor growth when soluble fibroblast growth factor receptor-1 is used with soluble vascular endothelial growth factor receptor", CANCER GENE THERAPY, NORWALK, CT, US LNKD- DOI:10.1038/SJ.CGT.7700478, vol. 9, no. 8, 1 August 2002 (2002-08-01), pages 633 - 640, XP002312418, ISSN: 0929-1903 *
OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214
OLSEN ET AL., PNAS, vol. 101, 2004, pages 935 - 940
ORTEGA ET AL., FRON. BIOSCI., vol. 4, 1999, pages 141 - 152
OSTRO ET AL., AMERICAN J. HOSP. PHARM., vol. 46, 1989, pages 1576
PACK; PLUCKTHUN, BIOCHEM., vol. 31, 1992, pages 1579 - 1584
PADLAN, MOL. IMMUNOL., vol. 31, 1994, pages 169 - 217
PANTOLIANO ET AL., BIOCHEM., vol. 30, 1991, pages 10117 - 10125
PCARSON, METH. ENZYMOL., vol. 183, 1990, pages 63
PCARSON; LIPMAN, PROC. NAT'L ACAD. SCI. USA, vol. 85, 1988, pages 2444
PEARSON, METH. ENZYMOL., vol. 183, 1990, pages 63
PESSI ET AL., NATURE, vol. 362, 1993, pages 367 - 369
PETROVA, EXP. CELL RES., vol. 253, 1999, pages 117 - 130
PHARMACIA LKB BIOTECHNOLOGY, 1988
PRESTA ET AL., CYTOKINE GROWTH FACTOR REV., vol. 16, 2005, pages 159 - 178
PUTNEY, CURR. OPIN. CHEM. BIOL., vol. 2, 1998, pages 548
PUTNEY; BURKE, NATURE BIOTECHNOLOGY, vol. 16, 1998, pages 153
QIU ET AL., NATURE BIOTECHNOL., vol. 25, 2007, pages 921 - 929
QUIDVILLE ET AL., ENDOCRINOLOGY, vol. 145, 2004, pages 2561 - 71
RAMONT ET AL., EXP. CELL RES., vol. 29, 2003, pages 1 - 10
RAYMOND ET AL., YEAST, vol. 14, 1998, pages 11 - 23
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
ROBINSON; SAUER, BIOCHEMISTRY, vol. 35, 1996, pages 109 - 116
ROBINSON; SAUER, PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 5929 - 5934
RUSCONI; KOHLER, NATURE, vol. 314, 1985, pages 330 - 334
SAFWAT ET AL., J. EXP. THER. ONCOL., vol. 3, 2003, pages 161 - 8
SAITOH ET AL., ONCOGENE, vol. 5, 1990, pages 1195 - 2000
SALUP ET AL., IMMUNOL., vol. 138, 1987, pages 641 - 7
SANDGREN ET AL., MOL. CELL BIOL., vol. 13, 1993, pages 320 - 330
SANDGREN ET AL., ONCOGENE, vol. 4, 1989, pages 715 - 724
SANDLER ET AL., N ENGL. J. MED., vol. 355, 2006, pages 2542 - 2550
SATHORNSUMETEE SITH ET AL: "Antiangiogenic therapy in malignant glioma: Promise and challenge", CURRENT PHARMACEUTICAL DESIGN, BENTHAM SCIENCE PUBLISHERS, NL, vol. 13, no. 35, 1 January 2007 (2007-01-01), pages 3545 - 3558, XP002570212, ISSN: 1381-6128 *
SAYERS ET AL., CANCER RES., vol. 50, 1990, pages 5414 - 20
SCATCHARD, ANN. NYACAD. SCI., vol. 51, 1949, pages 660 - 672
SCHENBORN; GOIFFIN, PROMEGA NOTES, vol. 41, 1993, pages 11
SCHERPHOF ET AL., ANN. NY. ACAD. SCI., vol. 446, 1985, pages 368
SCHIRMACHER ET AL., AM. .I PATHOL., vol. 139, 1991, pages 231 - 241
SCHUENEMAN ET AL., CANCER RES., vol. 63, 2003, pages 4009 - 16
SELLERS, SIAM J. APPL. MATH., vol. 26, 1974, pages 787
SENGUPTA ET AL., ONCOLOGY, vol. 48, 1991, pages 258 - 61
SENO ET AL., NUC. ACIDS RES., vol. 11, 1983, pages 719 - 726
SEPULVEDA E, CANCER RES., vol. 49, 1989, pages 6108 - 6117
SHAW ET AL., CELL, vol. 56, 1989, pages 563 - 572
SHIMIZU ET AL., BIOL. PHARM. BULL., vol. 20, 1997, pages 881
SINKAR ET AL., J. BIOSCI. (BANGALORE), vol. 11, 1987, pages 47 - 58
SMALLSHAW ET AL., PROTEIN ENG., vol. 12, 1999, pages 623 - 630
SMYTH ET AL., NEJM, vol. 354, 2006, pages 2282
SONDERMANN ET AL., NATURE, vol. 406, 2000, pages 267
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
SRIVASTAVA, NEOPLASIA, vol. 3, 2001, pages 535 - 46
STACKER; ACHEN, GROWTH FACTORS, vol. 17, 1999, pages 1 - 11
STAMENKOVIC ET AL., CELL, vol. 66, 1991, pages 1133 - 1144
TAKEDA ET AL., J. EXP. MED., vol. 195, 2002, pages 161 - 9
TANG ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 15682 - 15686
TAO ET AL., J. EXP. MED., vol. 178, 1993, pages 661
TERMAN ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 187, 1992, pages 1579 - 1586
THERASSE ET AL., J. NATL. CANCER INST., vol. 92, 2000, pages 205 - 216
TOSHKOV ET AL., HEPATOLOGY, vol. 20, 1994, pages 1162 - 1172
VRIES ET AL., SCIENCE, vol. 255, 1992, pages 989 - 991
WANG ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 6169 - 6178
WANG; SEMENZA, J. BIOL. CHEM., vol. 270, 1995, pages 1230
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WASSEF ET AL., METH. ENZYMOL, vol. 149, 1987, pages 124
WATANABE ET AL., NEUROL. RES., vol. 24, 2002, pages 485 - 90
WET ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 725
WIBERG ET AL., BIOTECHNOL BIOENG, vol. 94, 2006, pages 396 - 405
WIGLER ET AL., CELL, vol. 14, 1978, pages 725
WILCOX ET AL., J. CLIN. INVEST., vol. 109, 2002, pages 651 - 9
WINES ET AL., J. IMMUNOL., vol. 164, 2000, pages 5313
ZACHARY, INTL. J. BIOCHEM. CELL BIO., vol. 30, 1998, pages 1169 - 1174
ZAKI ET AL., J. INVEST. DERMATOL., vol. 118, 2002, pages 366 - 71
ZAPATA ET AL., PROTEIN ENG., vol. 8, 1995, pages 1057 - 1062
ZHANG ET AL., CLIN ENDOCRINOL (OXF)., vol. 52, 2000, pages 687 - 94
ZHANG ET AL., ENDOCRINOLOGY, vol. 140, 1999, pages 2152 - 8
ZUO ET AL., PROTEIN ENGINEERING, vol. 13, 2000, pages 361 - 367

Cited By (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11819531B2 (en) 2009-12-18 2023-11-21 Kodiak Sciences Inc. Multifunctional zwitterionic polymer conjugates
EP3013851A4 (en) * 2013-06-25 2016-12-28 Sépia Pesquisa E Desenvolvimento MODULATORS OF BRADYKININ RECEPTORS AND THEIR USE
US9879081B2 (en) 2013-06-25 2018-01-30 Samsung Electronics Co., Ltd. Protein complex, bispecific antibody including the protein complex, and method of preparation thereof
US9920096B2 (en) 2013-06-25 2018-03-20 Sepia Pesquisa E Desenvolvimento Bradykinin receptor modulators and use thereof
US11590235B2 (en) 2013-09-08 2023-02-28 Kodiak Sciences Inc. Factor VIII zwitterionic polymer conjugates
US10702608B2 (en) 2013-09-08 2020-07-07 Kodiak Sciences Inc. Factor VIII zwitterionic polymer conjugates
US12214044B2 (en) 2013-09-08 2025-02-04 Kodiak Sciences Inc. Factor VIII zwitterionic polymer conjugates
EP3161000A4 (en) * 2014-06-28 2018-05-02 Kodiak Sciences Inc. Dual pdgf/vegf antagonists
US11155610B2 (en) 2014-06-28 2021-10-26 Kodiak Sciences Inc. Dual PDGF/VEGF antagonists
US11071771B2 (en) 2014-10-17 2021-07-27 Kodiak Sciences Inc. Butyrylcholinesterase zwitterionic polymer conjugates
US10363290B2 (en) 2014-10-17 2019-07-30 Kodiak Sciences Inc. Butyrylcholinesterase zwitterionic polymer conjugates
EP4678661A2 (en) 2015-01-08 2026-01-14 Genmab A/S Bispecific antibodies against cd3 and cd20
US12617854B2 (en) 2015-07-15 2026-05-05 Genmab A/S Humanized or chimeric CD3 antibodies
US11359015B2 (en) 2015-07-15 2022-06-14 Genmab A/S Humanized or chimeric CD3 antibodies
EA035586B1 (ru) * 2015-11-30 2020-07-10 Пиерис Острелиа Пти Лтд. Новые антиангиогенные слитые белки
WO2017091850A1 (en) * 2015-11-30 2017-06-08 Pieris Australia Pty Ltd. Novel anti-angiogenic fusion polypeptides
US11066465B2 (en) 2015-12-30 2021-07-20 Kodiak Sciences Inc. Antibodies and conjugates thereof
WO2018011421A1 (en) 2016-07-14 2018-01-18 Genmab A/S Multispecific antibodies against cd40 and cd137
EP4527854A2 (en) 2017-03-09 2025-03-26 Genmab A/S Antibodies against pd-l1
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
WO2018178396A1 (en) 2017-03-31 2018-10-04 Genmab Holding B.V. Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof
WO2019025545A1 (en) 2017-08-04 2019-02-07 Genmab A/S BINDING AGENTS BINDING TO PD-L1 AND CD137 AND THEIR USE
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
US12071476B2 (en) 2018-03-02 2024-08-27 Kodiak Sciences Inc. IL-6 antibodies and fusion constructs and conjugates thereof
WO2020060405A1 (en) 2018-09-19 2020-03-26 Lava Therapeutics B.V. Dual acting cd1d immunoglobulin
WO2020060406A1 (en) 2018-09-19 2020-03-26 Lava Therapeutics B.V. Novel bispecific antibodies for use in the treatment of hematological malignancies
WO2020070313A1 (en) 2018-10-04 2020-04-09 Genmab Holding B.V. Pharmaceutical compositions comprising bispecific anti-cd37 antibodies
WO2020094744A1 (en) 2018-11-06 2020-05-14 Genmab A/S Antibody formulation
NL2022494B1 (en) 2019-02-01 2020-08-19 Lava Therapeutics B V Novel CD40-binding antibodies
WO2020159368A1 (en) 2019-02-01 2020-08-06 Lava Therapeutics B.V. Novel cd40-binding antibodies
EP3998083A4 (en) * 2019-07-12 2023-08-23 Chugai Seiyaku Kabushiki Kaisha Anti-mutation type fgfr3 antibody and use therefor
EP3792283A1 (en) 2019-09-16 2021-03-17 Lava Therapeutics B.V. Treatment of cancer comprising administration of vgamma9vdelta2 t cell receptor binding antibodies
WO2021052995A1 (en) 2019-09-16 2021-03-25 Lava Therapeutics B.V. TREATMENT OF CANCER COMPRISING ADMINISTRATION OF Vγ9Vẟ2 T CELL RECEPTOR BINDING ANTIBODIES
US11912784B2 (en) 2019-10-10 2024-02-27 Kodiak Sciences Inc. Methods of treating an eye disorder
WO2021155916A1 (en) 2020-02-04 2021-08-12 BioNTech SE Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137
WO2021156258A1 (en) 2020-02-04 2021-08-12 BioNTech SE Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137
WO2021185934A1 (en) 2020-03-18 2021-09-23 Genmab A/S Antibodies binding to b7h4
US11261254B1 (en) 2020-03-18 2022-03-01 Genmab A/S Antibodies
US12435154B2 (en) 2020-05-08 2025-10-07 Genmab A/S Bispecific antibodies against CD3 and CD20
WO2022008646A1 (en) 2020-07-08 2022-01-13 LAVA Therapeutics N.V. Antibodies that bind psma and gamma-delta t cell receptors
WO2022029011A1 (en) 2020-08-06 2022-02-10 BioNTech SE Binding agents for coronavirus s protein
US11858995B2 (en) 2020-09-10 2024-01-02 Genmab A/S Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia
US11845805B2 (en) 2020-09-10 2023-12-19 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma
WO2022122973A1 (en) 2020-12-10 2022-06-16 LAVA Therapeutics N.V. Antibodies that bind gamma-delta t cell receptors
WO2022180271A1 (en) 2021-02-26 2022-09-01 LAVA Therapeutics N.V. Antibodies that bind CD123 and gamma-delta T cell receptors
WO2022234146A1 (en) 2021-05-07 2022-11-10 Genmab A/S PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3
WO2022268740A1 (en) 2021-06-21 2022-12-29 Genmab A/S Combination dosage regime of cd137 and pd-l1 binding agents
WO2023037333A1 (en) 2021-09-13 2023-03-16 Janssen Biotech, Inc CD33 X Vδ2 MULTISPECIFIC ANTIBODIES FOR THE TREATMENT OF CANCER
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
WO2023067138A1 (en) 2021-10-21 2023-04-27 LAVA Therapeutics N.V. Uses of gamma delta t cell activating antibodies
WO2023174521A1 (en) 2022-03-15 2023-09-21 Genmab A/S Binding agents binding to epcam and cd137
WO2023174952A1 (en) 2022-03-15 2023-09-21 Genmab A/S Binding agents binding to epcam and/or cd137
WO2023232805A1 (en) 2022-05-30 2023-12-07 LAVA Therapeutics N.V. Combination treatment for chronic lymphocytic leukemia
EP4285926A1 (en) 2022-05-30 2023-12-06 LAVA Therapeutics N.V. Combination treatment for chronic lymphocytic leukemia
WO2023242319A1 (en) 2022-06-15 2023-12-21 LAVA Therapeutics N.V. Variant antibodies that bind gamma-delta t cell receptors
EP4292610A1 (en) 2022-06-15 2023-12-20 LAVA Therapeutics N.V. Variant antibodies that bind gamma-delta t cell receptors
EP4292609A1 (en) 2022-06-15 2023-12-20 LAVA Therapeutics N.V. Compositions comprising antibodies that bind gamma-delta t cell receptors
WO2023242320A1 (en) 2022-06-15 2023-12-21 LAVA Therapeutics N.V. Compositions comprising antibodies that bind gamma-delta t cell receptors
NL2032398B1 (en) 2022-07-06 2024-01-23 Academisch Ziekenhuis Leiden Bispecific antibody and uses thereof
WO2024010445A1 (en) 2022-07-06 2024-01-11 ACADEMISCH ZIEKENHUIS LEIDEN (h.o.d.n. LUMC) Bispecific antibody and uses thereof
WO2024200573A1 (en) 2023-03-27 2024-10-03 LAVA Therapeutics N.V. Nectin-4 binding agents and methods of use
EP4438624A1 (en) 2023-03-27 2024-10-02 LAVA Therapeutics N.V. Antibodies that bind nectin-4 and gamma-delta t cell receptors
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3
WO2025003280A1 (en) 2023-06-30 2025-01-02 Genmab A/S Antibodies binding to fibroblast activation protein alpha and death receptor 4
US12351650B2 (en) 2023-06-30 2025-07-08 Genmab A/S Antibodies binding to fibroblast activation protein alpha and death receptor 4
WO2025012118A2 (en) 2023-07-07 2025-01-16 LAVA Therapeutics N.V. 5t4 binding agents and methods of use
WO2025024780A1 (en) 2023-07-27 2025-01-30 LAVA Therapeutics N.V. Antibodies that bind gamma-delta t cell receptors for the treatment of cancer
WO2025056180A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists
WO2025056778A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists

Also Published As

Publication number Publication date
EP2411407A1 (en) 2012-02-01
CN102448984A (zh) 2012-05-09
AU2010229705A1 (en) 2011-10-20
MX2011009810A (es) 2011-09-30
US20120134993A1 (en) 2012-05-31
KR20110134494A (ko) 2011-12-14
JP2012521768A (ja) 2012-09-20

Similar Documents

Publication Publication Date Title
US20120134993A1 (en) Compositions and methods for using multispecific-binding proteins comprising an antibody-receptor combination
AU2014202867B2 (en) Compositions and methods for inhibiting PDGFRbeta and VEGF-A
US7740850B2 (en) PDGFRβ-specific antibodies
KR101862832B1 (ko) Pan―her 항체 조성물
JP6423357B2 (ja) 二重特異性EGFR/c−Met抗体
US20110081345A1 (en) Single chain fc, methods of making and methods of treatment
CN115151563A (zh) 使用抗ox40抗体与抗pd1或抗pdl1抗体组合治疗癌症的方法
CN114728063B (zh) 用抗ox40抗体和多重激酶抑制剂治疗癌症
EP2985292A1 (en) Epidermal growth factor receptor antibody
KR20230142768A (ko) Ccdc112를 기반으로 하는 종양세포 성장을 억제하는 방법 및 적용
WO2025067442A1 (zh) 抗fgfr2抗体和包含其的多特异性结合分子
HK40076664A (en) Methods of cancer treatment using anti-ox40 antibodies in combination with anti-pd1 or anti-pdl1 antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080023089.3

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10722828

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2010722828

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: MX/A/2011/009810

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 7204/DELNP/2011

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2012502294

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2010229705

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2010229705

Country of ref document: AU

Date of ref document: 20100326

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20117025299

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13260408

Country of ref document: US