WO2009073631A2 - Antibodies to the pcrv antigen of pseudomonas aeruginosa - Google Patents

Antibodies to the pcrv antigen of pseudomonas aeruginosa Download PDF

Info

Publication number
WO2009073631A2
WO2009073631A2 PCT/US2008/085196 US2008085196W WO2009073631A2 WO 2009073631 A2 WO2009073631 A2 WO 2009073631A2 US 2008085196 W US2008085196 W US 2008085196W WO 2009073631 A2 WO2009073631 A2 WO 2009073631A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
region
segment
sequence
identity
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/085196
Other languages
French (fr)
Other versions
WO2009073631A3 (en
Inventor
Christopher R. Bebbington
Kenneth Luehrsen
Geoffrey T. Yarranton
Mark Baer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Humanigen Inc
Original Assignee
Kalobios Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN200880124705.7A priority Critical patent/CN101910197B/en
Priority to MX2010005871A priority patent/MX2010005871A/en
Priority to AU2008333985A priority patent/AU2008333985B2/en
Priority to EA201000903A priority patent/EA201000903A1/en
Priority to NZ586357A priority patent/NZ586357A/en
Priority to EP08856948A priority patent/EP2220117A2/en
Priority to BRPI0819598A priority patent/BRPI0819598A2/en
Priority to CA2706732A priority patent/CA2706732A1/en
Application filed by Kalobios Pharmaceuticals Inc filed Critical Kalobios Pharmaceuticals Inc
Priority to JP2010536228A priority patent/JP5781765B2/en
Publication of WO2009073631A2 publication Critical patent/WO2009073631A2/en
Publication of WO2009073631A3 publication Critical patent/WO2009073631A3/en
Priority to IL206036A priority patent/IL206036A0/en
Priority to ZA2010/03852A priority patent/ZA201003852B/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203—Gram-negative bacteria
    • C07K16/1214—Pseudomonadaceae (F)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/40—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10—Antimycotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55—Fab or Fab'
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Pseudomonas aeruginosa is an opportunistic pathogen that rarely causes disease in healthy people, but is a significant problem for critically ill or immunocompromised individuals. Infection is a major problem in individuals who have cystic fibrosis (CF), where P. aeorginosa is a causative agent in the progressive loss of lung function resulting from recurrent and chronic respiratory tract infections with the bacterium.
  • CF cystic fibrosis
  • Others at risk from Pseudomonas aeruginosa infection include patients on mechanical ventilators, neutropenic cancer patients, and burn patients. P. aeruginosa is often resistant to most antibiotics and new treatment approaches are greatly needed.
  • the type III secretion system is an important virulence factor determinant in that it inhibits host defense system. Upon activation, the type III secretion apparatus translocates toxins into the cytoplasm of the host cell, resulting in cell rounding, lifting, and cell death by necrosis or apoptosis.
  • PcrV is an essential component of the type III secretion apparatus. Blocking of PcrV can inhibit toxin secretion through the Type III secretion system, thereby allowing natural clearance mechanisms to eliminate the bacteria. PcrV is conserved in all P. aeruginosa strains tested thus far.
  • Antibodies to the PcrV antigen of Pseudomonas are known in the art.
  • the current invention provides improved PcrV antibodies, e.g., for the treatment of Pseudomonas aeruginosa infections.
  • the current invention relates to engineered antibodies that bind with high affinity, e.g., at about 50 nM, or about 10 nM or less, to the PcrV antigen from Pseudomonas aeruginosa.
  • Such antibodies are often functional antagonists of the Type III secretion, i.e., the antibody binds to PcrV and inhibits the Type II secretion system.
  • an antibody of the invention may bind to PcrV and recruit multiple cell types of the immune system to stimulate phagocytosis by macrophages, antibody directed cellular cytotoxicity (ADCC) by macrophages or NK cells, activation of the complement cascade, and/or generation of the oxidative burst by neutrophils.
  • ADCC antibody directed cellular cytotoxicity
  • the antibodies of the invention have variable regions with a high degree of identity to human germ-line V H and V L sequences and are less immunogenic in humans.
  • the CDR3 sequences of the heavy and light chains of the present invention comprise a pair of binding specificity determinants (BSD) from the monoclonal anti-PcrV antibody Mabl 66 (Frank et ah, J. Infections Dis. 186: 64-73, 2002).
  • the antibodies of the invention typically are capable of competing with Mabl 66 for binding to a neutralizing epitope on the PcrV protein.
  • the BSD sequence in CDRH3 has the amino acid sequence NRGD IYYDFTY.
  • the BSD in CDRL3 is FWXTP (where X may be either S or G).
  • Complete V-regions are generated in which the BSD forms part of the CDR3 and additional sequences are used to complete the CDR3 and add a FR4 sequence.
  • the portion of the CDR3 excluding the BSD and the complete FR4 are comprised of human germ-line sequences.
  • the CDR3-FR4 sequence excluding the BSD differs from human germ-line sequences by not more than two amino acids on each chain.
  • the CDR3-FR4 is joined to a V-segment that has a high degree identity, e.g., at least 80%, or at least 90%, or more to a human germline V segment.
  • the invention provides an anti-PcrV antibody that exhibits high affinity binding, e.g., 10 nM or better, to PcrV and is an antagonist of the Type III secretion system.
  • an anti-PcrV antibody of the invention that selectively binds to PcrV comprises: a V L region that comprises a CDR3 comprising FWGTP.
  • a V L region that comprises a CDR3 comprising FWGTP.
  • such an antibody has a V L region V-segment has at least 80% identity to a human germline V-segment.
  • the FR4 region typically has at least 90% identity to the FR4 region of a human germline J segment.
  • an anti-PcrV antibody of the invention comprises a CDR3 comprising FWGTP, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human JK2 germline gene segment or at least 90% identity to the JL2 germline sequence; and the V-segment comprises at least 80% identity to a human germline Vkappa I or Vkappa III sequence, or at least 80% identity to a human germline Vlambda sequence.
  • the V L region CDR3 has the sequence Q(Q/H)FWGTPYT.
  • the antibody further comprises a V H region that comprises a CDR3 having a sequence NRGDIYYDFTY, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human JH3 or human JH6 segment and the V-segment comprises at least 80% identity to the human VHl -18 subclass V-segment or to the human VH3-3O.3 V segment.
  • the V H region comprises a CDR3 having a sequence NRGDIYYDFTYA(MZF)DX 1 , wherein X 1 is I, Q, Y, or S.
  • the invention provides an anti-PcrV antibody that binds to PcrV, comprising: a V H region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDX 1 , wherein X 1 is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germine JH6 segment, and the V-segment comprises at least 80% identity to the human germline VHl-18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xl is Y, the FR4 region is not WGQGTSVTVSS.
  • the invention provides an anti-PcrV antibody that binds to PcrV, comprising: a V H region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDX 1 , wherein X 1 is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germline JH6 segment, and the V-segment comprises at least 80% identity to the human germline VHl- 18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xl is Y, the FR4 region is not WGQGTSVTVSS; and a V L region that comprises a CDR3 comprising FW(S/G)TP, a FR4 and a V-segment, wherein the
  • the FR4 of the V H region of an antibody of the invention has the sequence WGQGTX 2 VTVSS, wherein X 2 is T or M.
  • an antibody of the invention has a light chain CDR3 that has the sequence Q(H/Q)FW(G/S)TPYT.
  • the FR4 of the V L region has the sequence FGQGTKLEIK or FGGGTKLTVL.
  • the invention also provides an anti-PcrV antibody where the V H region V-segment has at least 80% identity to the human germline VH3-30.3 segment and the heavy chain region CDRl comprises the sequence X 3 X 4 X 5 X 6 H, wherein X 3 is S, T, or N; X 4 is Y or A; X 5 is A, G, or P; and X6 is M, I, or L; and the heavy chain region CDR2 comprises the sequence X 7 IX 8 YX 9 GX IO X I I X I2 X IS Y(AZI)X 14 SVKG, wherein X 7 is V, F, or N; X 8 is S or W; X 9 is D or N; X 10 is S, K, R or Y; X 11 is N, S, D or E; X 12 is K, I, or E; X13 is Y, S, D or W; and X14 is D or S.
  • the antibody has at least 90% identity to a VH3-30.3 V segment.
  • the CDRl is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH.
  • the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWYADSVKG, VIWYDGRNKYYADSVKG, VIWYDGYNKDYADSVKG, or NIWYDGSSESYIDSVKG.
  • the CDRl is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; and the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWY ADSVKG,
  • the invention also provides an anti-PcrV antibody where the V H region V-segment has at least 80% identity, or at least 90% identity, to the human germline VHl- 18 sub-class V-segment and the CDRl has the sequence DHAIS and the CDR2 has the sequence WISPYSGNPNYAQSLQG.
  • the invention also provides an anti-PcrV antibody that binds to PcrV, comprising: a VH region that has a CDR3 sequence NRGDIYYDFTYAFDI, a CDRl sequence DHAIS and a CDR2 sequence WISPYSGNPNYAQSLQG.
  • the V H region comprises the V-segment region of an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
  • the V H regions can comprise an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
  • the invention also provides an anti-PcrV where the V L region V-segment comprises at least 80% or 90% identity, to a human germline Vkappa I L 12 or Vkappa III sequence; or at least 80% or 90% identity to a human germline Vlambda3 31 or to a Vlambda2 2c sequence.
  • V L region V-segment has at least 80% or 90% identity to the human germline VKI L 12 segment and the CDRl has the sequence RASX15X16X17X18X19X20X21A, where X 15 is Q or E; X 16 is S or G; X 17 is I or V; X 18 is S or D; X 19 is S, R, or T; X 20 is W or Y; and X 21 is L or V; and the CDR2 has the sequence X 21 ASX 22 LX 23 S, wherein X 21 is D or A; X 22 is S, A, or T; and X 23 is E, Q, or K.
  • the CDRl has the sequence RASQGISTYLA, RASQGISSWLA,
  • the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
  • the CDRl has the sequence RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, or RASEGVDRWLA; and the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
  • the invention also provides an anti-PcrV antibody where the V L region V segment has at least 80%, or at least 90%, amino acid sequence identity to the human germline VKIII L2 sequence and the CDRl has the sequence RASNSVGAYNLA or RASQSVSSNLA; or the CDR2 has the sequence (A/G)AS(T/R)RA(T/P).
  • CDRl has the sequence RASNSVGAYNLA or RASQSVSSNLA; and the CDR2 has the sequence (A/G)AS(T/R)RA(T/P).
  • the invention provides an anti-PcrV antibody where the V L region V- segment has at least 80%, or at least 90%, amino acid sequence identity to a human germline Vlambda L3 31 segment and the CDRl has the sequence QGDSLRS(Y/L)YAS; or the CDR2 has the sequence (G/S)KN(N/S)RPS.
  • the CDRl has the sequence QGDSLRS(Y/L)YAS; and the CDR2 has the sequence (G/S)KN(N/S)RPS.
  • the invention provide an anti-PcrV antibody where the V L region V-segment has at least 80%, or at least 90%, amino acid sequence identity to a human germline Vlambda L2 2c segment and the CDRl has the sequence TGTS SD VG A YNY VS or TGTSSDYVS; or the CDR2 has the sequence (E/D)VT(K/N)RPS.
  • the CDRl has the sequence TGTSSDVGAYNYVS or TGTSSDYVS; and the CDR2 has the sequence (E/D)VT(K/N)RPS.
  • An anti-PcrV antibody of the invention can have a region that comprises the V- segment of an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.
  • the V L region can comprise an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.
  • the invention thus provides an anti-PcrV antibody that comprises: a V H region having an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35; and a V L region having an amino acid sequence selected from the group consisting of SEQ ID NO.2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.
  • an antibody of the invention comprises a V H region of SEQ ID NO: 1 and a V L region of SEQ ID NO.2; or a V H region of SEQ ID NO:3 and a V L region of SEQ ID NO:4; or a V H region of SEQ ID NO:5 and a V L region of SEQ ID NO:6; or a V H region of SEQ ID NO:7 and a V L region of SEQ ID NO:8; or a V H region of SEQ ID NO: 11 and a V L region of SEQ ID NO: 12; or a V H region of SEQ ID NO:9 and a V L region of SEQ ID NO: 10; or a V H region of SEQ ID NO: 13 and a V L region of SEQ ID NO: 10; or a V H region of SEQ ID NO: 13 and a V L region of SEQ ID NO:4; or a V H region of SEQ ID NO: 13 and a V L region of SEQ ID NO:37;
  • an anti-PcrV antibody of the invention comprises a heavy chain as set forth in Figure 1 and/or a light chain as set forth in Figure 2; or has at least one, often at least two, and in some embodiments, at least three CDRs from one of the heavy or light chains set forth in Figure 1 or Figure 2, respectively.
  • the CDRl and/or CDR2 sequence is not a germline sequence.
  • the antibody is a Fab' fragment.
  • an antibody of the invention is a Fab, or Fab', that has an affinity of about 10 nM or less. In some embodiments, the antibody has an affinity that is equal or better than, the affinity of a Mab 166 Fab or Fab ' .
  • an antibody of the invention e.g., a Fab
  • the potency of an antibody of the invention is typically equivalent to Mab 166 Fab (within two-fold of the activity in cell-based assays).
  • an antibody of the invention is more potent than Mab 166 in preventing cytotoxicity by P. aeruginosa.
  • the antibody comprises a hinge region.
  • the antibody is an IgG or an IgA.
  • the antibody is PEGylated.
  • the antibody can be di-PEGylated.
  • the V H region or the V L region, or both the V H and V L region amino acid sequences comprise a methionine at the N-terminus.
  • the invention provides a method of treating a patient infected with P. aeruginosa, the method comprising administering a therapeutically effective amount of an antibody as described herein.
  • the antibody is administered intravenously, subcutaneously, or by insufflation.
  • Figure 1 shows sequences of V H regions of anti-PcrV antibodies. CDR sequences are underlined. The VHl sequence is aligned to human germ-line sequence VH1-18. VH3- subclass antibodies are shown aligned to human germ-line sequence VH3-30.3. J-segments are aligned to either human germ-line JH3 or JH6. The VH-segments depicted in Figure 1 correspond to the sequence up to the CDR3 sequence.
  • Figure 2 shows sequences of V L regions of anti-PcrV antibodies. CDR sequences are underlined.
  • Vkappa-subclass antibodies are shown aligned to human germline sequence VKI Ll 2.
  • J-segments are aligned to human germ-line JK2.
  • Vlambda-subclass antibodies are shown aligned to human germline sequence V13 31.
  • J-segments are aligned to human germ- line JL2.
  • Figure 3 shows an exemplary constant region sequence that can be linked to Fab' Heavy and Light Chains.
  • the two cysteine residues in the hinge region available for conjugation of thiol-reactive maleimide derivatives are underlined.
  • the cysteine residues involved in formation of an interchain disulfide bond are boxed.
  • Figure 4 shows a schematic representation of the structure of a di-PEGylated Fab' in which two molecules of mPEG-maleimide are conjugated via thioether linkages to cysteine residues in the hinge region of the Fab' protein.
  • the exemplary antibody is comprised of a human Fd' heavy chain and human kappa light chain linked by a disulphide bond represented by the cross-bar between the two chains. (Fab and PEG components are not to scale.)
  • Figure 5 provides data showing a time course of survival of mice treated with various doses of antibodies to PcrV at the time of challenge with a lethal dose of PA 103.
  • Mabl66 and Fab fragments were co-instilled via the intratracheal route with 1.5 x 106 bacteria (5 mice per group, 4 mice for Mabl66 Fab groups).
  • Control is a nonspecific Fab with no binding to PcrV or any P. aeruginosa protein.
  • Figure 6 provides data showing a body temperature analysis of mice treated with anti-PcrV antibodies. Rectal temperatures are shown for 48 hours or until mortality.
  • Antibody doses A) lO ⁇ g, B) 5 ⁇ g, C) 2.5 ⁇ g, D) 1.25 ⁇ g E) 0.625 ⁇ g F) 0.3125 ⁇ g, G) O.l ⁇ g, H) 0.08 ⁇ g.
  • Figure 7 provides data showing clearance of P. aeruginosa from the lungs of infected mice by anti-PcrV antibodies.
  • Mice were infected with 1.5 x 10 6 cfu PA 103 co- instilled with Mab 166 IgG, Mab 166 Fab or human Fab 1A8 at the doses shown (in ⁇ g).
  • the graph shows cfu / lung isolated from individual mice surviving at 48 h. The number of dead mice at this time point is shown above the figure. Median cfu/ lung for surviving mice in each group is shown with a bar.
  • an "antibody” refers to a protein functionally defined as a binding protein and structurally defined as comprising an amino acid sequence that is recognized by one of skill as being derived from the framework region of an immunoglobulin-encoding gene of an animal that produces antibodies.
  • An antibody can consist of one or more polypeptides substantially encoded by immunoglobulin genes or fragments of immunoglobulin genes.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • a typical immunoglobulin (antibody) structural unit is known to comprise a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD).
  • the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the terms variable light chain (V L ) and variable heavy chain (V H ) refer to these light and heavy chains, respectively.
  • antibody includes antibody fragments that retain binding specificity. For example, there are a number of well characterized antibody fragments.
  • pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab) ! 2, a dimer of Fab which itself is a light chain joined to VH-CHl (Fd) by a disulfide bond.
  • the F(ab) ! 2 may be reduced under mild conditions to break the disulfide linkage in the hinge region thereby converting the (Fab') 2 dimer into an Fab' monomer.
  • the Fab' monomer is essentially a Fab with all or part of the hinge region (see, Fundamental Immunology, W.E.
  • antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that fragments can be synthesized de novo either chemically or by utilizing recombinant DNA methodology.
  • fragments can be synthesized de novo either chemically or by utilizing recombinant DNA methodology.
  • the term antibody as used herein also includes antibody fragments either produced by the modification of whole antibodies or synthesized using recombinant DNA methodologies.
  • Antibodies of the invention include dimers such as V H -V L dimers, V H dimers, or V L dimers, including single chain antibodies (antibodies that exist as a single polypeptide chain), such as single chain Fv antibodies (sFv or scFv) in which a variable heavy and a variable light region are joined together (directly or through a peptide linker) to form a continuous polypeptide.
  • the single chain Fv antibody is a covalently linked V H -V L heterodimer which may be expressed from a nucleic acid including V H - and V L - encoding sequences either joined directly or joined by a pepti de-encoding linker (e.g., Huston, et al.
  • V H and V L are connected to each as a single polypeptide chain, the V H and V L domains associate non-covalently.
  • the antibody can be another fragment, such as a disulfide-stabilized Fv (dsFv).
  • dsFv disulfide-stabilized Fv
  • Other fragments can also be generated, including using recombinant techniques.
  • the scFv antibodies and a number of other structures converting the naturally aggregated, but chemically separated light and heavy polypeptide chains from an antibody V region into a molecule that folds into a three dimensional structure substantially similar to the structure of an antigen-binding site are known to those of skill in the art (see e.g., U.S.
  • antibodies include those that have been displayed on phage or generated by recombinant technology using vectors where the chains are secreted as soluble proteins, e.g., scFv, Fv, Fab, (Fab')2 or generated by recombinant technology using vectors where the chains are secreted as soluble proteins.
  • Antibodies for use in the invention can also include diantibodies and miniantibodies.
  • Antibodies of the invention also include heavy chain dimers, such as antibodies from camelids.
  • VHH domains VHH domains.
  • Antibodies of the invention include single domain antibodies (dAbs) and nanobodies (see, e.g., Cortez-Retamozo, et ah, Cancer Res. 64:2853-2857, 2004).
  • V-region refers to an antibody variable region domain comprising the segments of Framework 1, CDRl, Framework 2, CDR2, and Framework 3, including CDR3 and Framework 4, which segments are added to the V-segment as a consequence of rearrangement of the heavy chain and light chain V-region genes during B-cell differentiation.
  • a "V-segment” as used herein refers to the region of the V-region (heavy or light chain) that is encoded by a V gene.
  • the V-segment of the heavy chain variable region encodes FR1-CDR1-FR2-CDR2 and FR3.
  • the V-segment of the light chain variable region is defined as extending though FR3 up to CDR3.
  • J-segment refers to a subsequence of the variable region encoded comprising a C-terminal portion of a CDR3 and the FR4.
  • An endogenous J-segment is encoded by an immunoglobulin J-gene.
  • CDR complementarity-determining region
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • the CDRs of each chain are typically referred to as CDRl, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
  • a V H CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
  • a V L CDRl is the CDRl from the variable domain of the light chain of the antibody in which it is found.
  • the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.
  • amino acid sequences of the CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, international
  • ImMunoGeneTics database IMGT
  • AbM ImMunoGeneTics database
  • antigen combining sites are also described in the following: Ruiz et al., IMGT, the international ImMunoGeneTics database. Nucleic Acids Res., 28, 219-221 (2000); and Lefranc,M.-P. IMGT, the international ImMunoGeneTics database. Nucleic Acids Res. Jan l;29(l):207-9 (2001); MacCallum et al, Antibody-antigen interactions: Contact analysis and binding site topography, J. MoI. Biol., 262 (5), 732-745 (1996); and Martin et al, Proc. Natl Acad.
  • Epitopes refers to a site on an antigen to which an antibody binds.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
  • binding specificity determinant refers to the minimum contiguous or non-contiguous amino acid sequence within a CDR region necessary for determining the binding specificity of an antibody.
  • the minimum binding specificity determinants reside within a portion or the full-length of the CDR3 sequences of the heavy and light chains of the antibody.
  • PcrV antagonizing antibody or an "anti-PcrV antibody is an antagonist of the Psendomonas aeruginosa Type III secretion system” are used interchangeably to refer to an antibody that binds to PcrV and inhibits the Type III secretion system. Inhibition occurs when secretion through the Type III secretion system is at least about 10% less, for example, at least about 25%, 50%, 75% less, or totally inhibited, in comparison to secretion when not exposed to the antibody antagonist.
  • anti-PcrV antibody and “PcrV antibody” are used synonymously unless otherewise stated.
  • Equilibrium dissociation constant refers to the dissociation rate constant (k d , time "1 ) divided by the association rate constant (k a , time.i, M "1 ). Equilibrium dissociation constants can be measured using any known method in the art.
  • the antibodies of the present invention are high affinity antibodies. Such antibodies have an affinity better than 500 nM, and often better than 50 iiM or 10 nM.
  • the antibodies of the invention have an affinity in the range of 500 nM to 100 pM, or in the range of 50 or 25 nM to 100 pM, or in the range of 50 or 25 nM to 50 pM, or in the range of 50 nM or 25 nM to 1 pM.
  • humanized antibody refers to an immunoglobulin molecule in CDRs from a donor antibody are grafted onto human framework sequences. Humanized antibodies may also comprise residues of donor origin in the framework sequences. The humanized antibody can also comprise at least a portion of a human immunoglobulin constant region. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
  • Humanization can be performed using methods known in the art ⁇ e.g., Jones et al, Nature 321:522-525; 1986; Riechmann et a/., Nature 332:323-327, 1988; Verhoeyen et al, Science 239:1534- 1536, 1988); Presta, Curr. Op. Struct. Biol 2:593-596, 1992; U.S. Patent No. 4,816,567), including techniques such as "superhumanizing" antibodies (Tan et al, J.
  • a “humaneered” antibody in the context of this invention refers to an engineered human antibody having a binding specificity of a reference antibody.
  • a “humaneered” antibody for use in this invention has an immunoglobulin molecule that contains minimal sequence derived from a donor immunoglobulin.
  • an antibody is “humaneered” by joining a DNA sequence encoding a binding specificity determinant (BSD) from the CDR3 region of the heavy chain of the reference antibody to human V H segment sequence and a light chain CDR3 BSD from the reference antibody to a human V L segment sequence.
  • BSD binding specificity determinant
  • a binding specificity determinant therefore can be a CDR3-FR4, a CDR3, a minimal essential binding specificity determinant of a CDR3 (which refers to any region smaller than the CDR3 that confers binding specificity when present in the V region of an antibody), the D segment (with regard to a heavy chain region), or other regions of CDR3- FR4 that confer the binding specificity of a reference antibody.
  • Methods for humaneering are provided in US patent application publication no. 20050255552 and US patent application publication no. 20060134098.
  • hybrid when used with reference to portions of a nucleic acid or protein, indicates that the nucleic acid or protein comprises two or more subsequences that are not normally found in the same relationship to each other in nature.
  • the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes arranged to make a new functional nucleic acid.
  • a hybrid protein refers to two or more subsequences that are not normally found in the same relationship to each other in nature.
  • recombinant when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
  • recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
  • nucleic acid By the term “recombinant nucleic acid” herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved.
  • an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined are both considered recombinant for the purposes of this invention.
  • a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention.
  • a "recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.
  • the antibody typically binds to PcrV with an affinity of 500 nM or less, and has an affinity of 500OnM or greater, for other antigens.
  • nucleic acid sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues (or nucleotides) that are the same (i.e., about 60% identity, preferably 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection ⁇ see, e.g.
  • sequences are then said to be “substantially identical.”
  • “Substantially identical” sequences also includes sequences that have deletions and/or additions, as well as those that have substitutions, as well as naturally occurring, e.g., polymorphic or allelic variants, and man-made variants.
  • the preferred algorithms can account for gaps and the like.
  • protein sequence identity exists over a region that is at least about 25 amino acids in length, or more preferably over a region that is 50-100 amino acids in length, or over the length of a protein.
  • a “comparison window”, as used herein, includes reference to a segment of one of the number of contiguous positions selected from the group consisting typically of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. MoI.
  • BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention.
  • the terms "isolated,” “purified,” or “biologically pure” refer to material that is substantially or essentially free from components that normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • a protein that is the predominant species present in a preparation is substantially purified.
  • the term “purified” in some embodiments denotes that a protein gives rise to essentially one band in an electrophoretic gel. Preferably, it means that the protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure.
  • the terms "polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymer.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • Constantly modified variants applies to both amino acid and nucleic acid sequences.
  • conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated, e.g., naturally contiguous, sequences.
  • a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
  • nucleic acid variations are "silent variations," which are one species of conservatively modified variations.
  • Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
  • Conservative substitution tables and substitution matrices such as BLOSUM providing functionally similar amino acids are well known in the art.
  • Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
  • Typical conservative substitutions for one another include: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
  • the invention relates to antibodies that bind with high affinity to the PcrV antigen from Pseudomonas aeruginosa and are typically functional antagonists of the Type III secretion system.
  • the antibodies comprise variable regions with a high degree of homology to human germ-line V H and V L sequences.
  • the CDR3 sequences of the heavy and light chains comprise a pair of binding specificity determinants (BSD) from the monoclonal anti- PcrV antibody Mabl66 (Frank et a!., J. Infectious Dis. 186: 64-73, 2002; and U.S. Patent No 6,827,935) and the antibodies of the invention compete with Mabl66 for binding to a neutralizing epitope on the PcrV protein ⁇ see, e.g., U.S. Patent No. 6,827,935).
  • BSD binding specificity determinants
  • the BSD sequence in CDRH3 has the amino acid sequence NRGDIYYDFTY.
  • an antibody of the invention as a heavy chain CDR3 sequence NRGDIYYDFTYA(M/F)DX, where X is I, S, or Q.
  • the BSD in CDRL3 is FWXTP (where X may be either S or G).
  • Complete V- regions are generated in which the BSD forms part of the CDR3 and additional sequences are used to complete the CDR3 and add a FR4 sequence.
  • the portion of the CDR3 excluding the BSD and the complete FR4 are comprised of human germ-line sequences.
  • the CDR3-FR4 sequence excluding the BSD differs from human germ-line sequences by not more than 2 amino acids on each chain.
  • the human germline V- segment repertoire consists of 51 heavy chain V-segments, 40 K light chain V-segments, and 31 ⁇ light chain V-segments, making a total of 3,621 germline V-region pairs.
  • allelic variants for most of these V- segments, but the contribution of these variants to the structural diversity of the germline repertoire is limited.
  • Antibodies or antibodies fragments as described herein can be expressed in prokaryotic or eukaryotic microbial systems or in the cells of higher eukaryotes such as mammalian cells.
  • an antibody that is employed in the invention can be in any format.
  • the antibody can be a complete antibody including a constant region, e.g., a human constant region, or can be a fragment or derivative of a complete antibody, e.g., a Fab, Fab', F(ab') 2 , scFv, Fv, or a single domain antibody, such as a nanobody or a camelid antibody.
  • a heavy chain of an anti-PcrV antibody of the invention comprises a heavy-chain V-region that comprises the following elements: 1 ) human heavy-chain V-segment sequences comprising FRl -CDRl -FR2-CDR2-
  • V-segment sequences that support binding to PcrV in combination with a CDR3-FR4 segment described above together with a complementary V L region are shown in Figure 1.
  • the V-segments can be from the human VHl or VH3 sub-classes.
  • the V-segment is a human V H 3 sub-class segment that has a high degree of amino-acid sequence identity with the germ-line segment VH3-3O.3.
  • the V- segment differs by not more than fifteen residues from VH3-30.3 and preferably not more than seven residues.
  • the FR4 sequence of the antibodies of the invention is provided by a human J segment. There are six heavy chain JH-regions numbered 1 through 6. Thus, the FR4 sequences can be provided by a JHl, JH2, JH3, JH4, JH5 or JH6 gene segment. Typically, the FR4 region of an antibody of the invention has at least 90%, often at least 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99%, or 100% identity, to the FR4 region of the human germline J segment that provides the FR4. [0078] In some embodiments, the FR4 sequence is provided by a human germ-line JH3 segment and has a sequence WGQGTMVTVSS. In other embodiments, the FR4 is provided by a human germ-line JH6 segment and has the sequence WGQGTTVTVSS.
  • the CDRH3 also comprises sequences that are derived from a human J-segment.
  • the CDRH3-FR4 sequence excluding the BSD differs by not more than 2 amino acids from a human germ-line J-segment.
  • the J-segment sequences in CDRH3 are from the same J-segment used for the FR4 sequences.
  • the CDRH3-FR4 region comprises the BSD and a complete human JH3 germ- line gene segment. Exemplary combinations of CDRH3 and FR4 sequences are shown below, in which the BSD is in bold and human germ-line J-segment residues are underlined: CDR3
  • an antibody of the invention comprises a V-segment that has at least 90% identity, or at least 91%, 92% 93%, 94%, 95%, 965, 97%, 98%, 99%, or 100% identity to the germ-line segment VH3 30.3 or to a germline VHl-18 segment; or to one of the V-segments of the V H regions shown in Figure 1, such as a V-segment portion of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
  • the V-segment of the VH region has a CDRl and/or CDR2 as shown in Figure 1.
  • an antibody of the invention may have a CDRl that has the sequence TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; or a CDR2 that has the sequence VIWYNGKEISY ADSVKG, FIS YDGSEKYYAS SVKG, or VISYDGSEKWYADSVKG.
  • the CDR2 of the VH region has a negatively charged amino acid positioned in about the middle, e.g., at position 8 or 9 of the CDR2.
  • an antibody has both a CDRl and a CDR2 from one of the V H region V-segments shown in Figure 1 and a CDR3 that comprises NRGDIYYDFTY, e.g., NRGDIYYDFTYAFDI or NRGDIYYDFTYAMDI.
  • an anti-PcrV antibody of the invention may for example, have a CDR3-FR4 that has the sequence NRGDIYYDFTYAFDIWGQGTMVTVSS, NRGDIYYDFTYAMDIWGQGTMVTVSS, or NRGDIYYDFTYAMDIWGQGTTVTVSS.
  • the antibody may comprise a CDR3 that has the sequence NRGDIYYDFTY A(M/F)D(Q/S).
  • a light chain of an anti-PcrV antibody of the invention comprises at light-chain V- region that comprises the following elements:
  • CDRL3 region comprising the sequence FWXTP (where X may be S or G) 3) a FR4 contributed by a human germ-line J-gene segment.
  • the V L region comprises either a Vlambda or a Vkappa V-segment.
  • Vlambda and Vkappa sequences that support binding in combination with a complementary V ⁇ -region are provided in Figure 2.
  • Vkappa segments are cloned upstream of the human germ-line JK2 segment and Vlambda segments are cloned upstream of the germ-line JL2 segment.
  • the CDRL3 sequence comprises a V-segment and J-segment derived sequences.
  • the J-segment sequences in CDRL3 are from the same J-segment used for FR4.
  • the CDRL3-FR4 region comprises the BSD and the complete human JK2 germ-line gene segment.
  • Exemplary CDRL3-FR4 combinations for kappa chains are shown below in which the BSD is shown in bold and JK2 sequences are underlined: CDR3
  • the FR4 sequence of the antibodies of the invention is provided by a human J segment. There are five human JKappa-region segments labeled 1 though 5 and four
  • the FR4 sequences can be provided by by any of these germline sequences.
  • the FR4 region of an antibody of the invention has at least 90%, often at least 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99%, or 100% identity, to the FR4 region of the human germline J segment that provides the FR4.
  • the Vkappa segments are typically of the VKI or VKIII sub-class.
  • the segments have at least 80% sequence identity to a human germline VKI or VKIII subclass, e.g., at least 80% identity to the human germ-line VKI L12 sequence or to human germline VKIII L2 or VKIIIAl 1 sequence.
  • the Vkappa segment may differ by not more than 18 residues from VKI Ll 2, or 12 residues from VKIII Al 1 or VKIII L2.
  • the V L region V-segment of an antibody of the invention has at least 85% identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the human germline VKI L 12, or to the human germline VkIII L2 sequence, or to human germline VKIII Al l sequence, or to a kappa V-segment sequence of a V L region shown in Figure 2, for example, the V-segment sequence of SEQ ID NOs. 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 37.
  • the V-segment of the V L corresponds to a human germline Vlambda segment. Tims, in some embodiments, the V-segment has at least 85% identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a Vlambda V-segment of a V L region of Figure 2, such as the V-segment sequence of SEQ ID NOs. 28, 30, 32, or 34.
  • the V-segment of the V L region has a CDRl and/or CDR2 as shown in Figure 2.
  • an antibody of the invention may have a CDRl sequence of RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, RASQGISTYLA, or RASEGVDRWLA or CDR2 sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
  • the antibody may have a CDRl sequence of QGDSLRSYYA, TGTSSDVGAYNYVS, or TGTSSDYV; or a CDR2 sequence GKNNRPS, EVTKRPS, or DVTNRPS.
  • an anti-PcrV antibody of the invention may have a
  • the CDR3 may be QQFWSTPYT, QHFWGTPYT, or QHFWSTPYT.
  • an anti-PcrV antibody may comprise an FR4 region that is FGQGTKLEIK or FGGGTKLTVL.
  • an anti-PcrV antibody of the invention can comprise, e.g., both the CDRl and CDR2 from one of the V L regions shown in Figure 2 and a CDR3-FR4 region that is QFWSTPYTFGQGTKLEIK, QHFWGTPYTFGQGTKLEIK, or QHFWSTPYTFGGGTKLTVL.
  • An antibody of the invention may comprise any of the V H regions of SEQ ID NOs. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, or 35 in combination with any of the V L regions of SEQ ID NOs. 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36 or 37.
  • An antibody may be tested to confirm that the antibody retains the activity of antagonizing the Type III secretion system.
  • the antagonist activity can be determined using any number of endpoints, including cytotoxicity assays. Exemplary assays are described, e.g., in U.S. Patent No 6,827,935.
  • An antibody that is administered to treat P. aeruginosa infection preferably retains at least 75%, preferably 80%, 90%, 95%, or 100%, of the Type III secretion pathway antagonist activity of Mabl66 (U.S. Patent No. 6,827,935).
  • a high-affinity antibody may be identified using well known assays to determine binding activity and affinity. Such techniques include ELISA assays as well as binding determinations that employ surface plasmon resonance or interferometry. For example, affinities can be determined by biolayer interferometry using a ForteBio (Mountain View, CA) Octet biosensor.
  • Antibodies of the invention typically compete with Mabl66 for binding to PcrV.
  • the region of PcrV to which Mabl66 binds has been identified (U.S. Patent No. 6,827,935).
  • PcrV or a fragment thereof that binds Mabl66 can be employed in a competitive binding assay.
  • the ability of an antibody described herein to block or compete with Mabl66 for binding to PcrV indicates that the antibody binds to the same epitope as Mabl ⁇ or to an epitope that is close to, e.g., overlapping, with the epitope that is bound by Mabl ⁇ .
  • an antibody described herein e.g., an antibody comprising a V H and V L region combination as shown in Table 1
  • a test antibody is considered to competitively inhibit binding of a reference antibody, if binding of the reference antibody to the antigen is reduced by at least 30%, usually at least about 40%, 50%, 60% or 75%, and often by at least about 90%, in the presence of the test antibody.
  • Many assays can be employed to assess binding, including ELISA, as well as other assays, such as immunoblots.
  • the anti-PcrV antibody need not antagonize the Type III secretion sequences.
  • antibodies of the invention that bind to PcrV can recruit multiple cell types of the immune system to stimulate phagocytosis by macrophages, antibody directed cellular cytotoxicity (ADCC) by macrophages or NK cells, activation of the complement cascade, and/or generation of the oxidative burst by neutrophils, thereby causing bacterial, i.e., P. aeruginosa, death.
  • ADCC antibody directed cellular cytotoxicity
  • Antibody libraries may be expressed in a suitable host cell including mammalian cells, yeast cells or prokaryotic cells.
  • a signal peptide can be introduced at the N-terminus to direct secretion to the extracellular medium.
  • Antibodies may be secreted from bacterial cells such as E. coll with or without a signal peptide. Methods for signal-less secretion of antibody fragments from E. coli are described in US patent application 20070020685.
  • one of the V ⁇ -regions of the invention is combined with one of the VL-regions of the invention and expressed in any of a number of formats in a suitable expression system.
  • the antibody may be expressed as a scFv, Fab, Fab' (containing an immunoglobulin hinge sequence), F(ab') 2 , (formed by di-sulfide bond formation between the hinge sequences of two Fab' molecules), whole immunoglobulin or truncated immunoglobulin or as a fusion protein in a prokaryotic or eukaryotic host cell, either inside the host cell or by secretion.
  • a methionine residue may optionally be present at the N-terminus, for example, in polypeptides produced in signal-less expression systems.
  • Each of the VH-regions described herein may be paired with each of the V L regions to generate an anti-PcrV antibody.
  • VH3 1080-2F was identified from the library paired with two different lambda light chains (1080-2F and 1080-1 IE).
  • the kappa chain 1069-3F was identified paired with VFB 1069-3F and with VH3 1100-3. Exemplary combinations of heavy and light chains are shown in the Table 1.
  • the antibodies of the invention antagonize the P. aeruginosa type III secretion system and typically exhibit high affinity binding to PcrV.
  • High affinity binding between an antibody and an antigen exists if the affinity of the antibody is less than 500 or 100 iiM, for example, less than 50 iiM or less than 25 nM, or less than 10 nM, or less than 1 nM, e.g., less than about 100 pM.
  • the antibodies of the invention typically have an affinity of 50 nM or less, often 10 nM or less, when assayed as Fabs, e.g., using ELISA, surface plasmon resonance assays, or interferometry. Table 1 provides examples of such antibodies.
  • an antibody of the invention is more potent in a cellular cyototxicity assay than Mab 166.
  • Antibodies may be produced using any number of expression systems, including both prokaryotic and eukaryotic expression systems. Many such systems are widely available from commercial suppliers.
  • the V H and V L regions may be expressed using a single vector, e.g., in a discistronic expression unit, or under the control of different promoters.
  • the V H and V L region may be expressed using separate vectors.
  • the antibodies of the invention may be expressed with or without a methionine at the N-terminus.
  • a V H or V L region as described herein may optionally comprise a methionine at the N-terminus.
  • An antibody of the invention may be produced in any number of formats, including as a Fab, a Fab', a F(ab')2, a scFv, or a dAB.
  • An antibody of the invention can also include a human constant region.
  • the constant region of the light chain may be a human kappa or lambda constant region.
  • the heavy chain constant region is often a gamma chain constant region, for example, a gamma- 1, gamma-2, gamma-3, or gamma-4 constant region.
  • the antibody may be an IgA.
  • the antibody is "non-immunogenic" when administered to a human.
  • non-immunogenic refers to a PcrV antibody of the invention that does not provoke antibody production against the anti-PcrV antibody when administered to a human.
  • Antibodies can be assessed for immunogenicity using known assays, e.g., an electrochemiluminescence immunoassay described in example 5. Such assays detect the level of antibodies present in a patient, e.g., in a serum sample from the patient, that react with the anti-PcrV antibody that is administered to the patient. An assay is considered to show that the antibody is non-immunogenic when no detectable antibody to the anti-PcrV antibody is present in the sample, e.g., in comparison to a control sample from an individual that was not administered the antibody.
  • the antibody can be conjugated to another molecule, e.g., polyethylene glycol (PEGylation) or serum albumin, to provide an extended half-life in vivo .
  • PEGylation polyethylene glycol
  • serum albumin serum albumin
  • the antibodies of the invention are in the form of a Fab' fragment.
  • a full-length light chain is generated by fusion of a V L -region to human kappa or lambda constant region.
  • Either constant region may be used for any light chain; however, in typical embodiments, a kappa constant region is used in combination with a Vkappa variable region and a lambda constant region is used with a Vlambda variable region.
  • the heavy chain of the Fab' is a Fd' fragment generated by fusion of a V ⁇ -region of the invention to human heavy chain constant region sequences, the first constant (CHl) domain and hinge region.
  • the heavy chain constant region sequences can be from any of the immunoglobulin classes, but is often from an IgG, and may be from an IgGl, IgG2, IgG3 or IgG4.
  • the Fab' antibodies of the invention may also be hybrid sequences, e.g., a hinge sequence may be from one immunoglobulin sub-class and the CHl domain may be from a different sub-class.
  • the heavy chain constant region including the CHl domain and hinge sequence is from human IgGl .
  • the Fab' molecule can be PEGylated using known methods.
  • the hinge region of the heavy chain contains cysteine residues suitable for conjugation to a polyethylene glycol derivative.
  • the hinge sequence may be the complete natural hinge region of an immunoglobulin heavy chain or may be truncated by one or more amino-acids. In some embodiments, the hinge region may be a modified or synthetic sequence. In further embodiments, the hinge is a natural immunoglobulin hinge sequence and contains two cysteine residues.
  • Fab' molecules can be conjugated by site-specific conjugation to maleimide derivatives of methoxy polyethylene glycol (mPEG-mal).
  • the mPEG-mal can have, for example, an average molecular mass of between 10 and 40 kD.
  • the PEG may be branched PEG or linear PEG.
  • the mPEG-mal is a linear molecule and has an approximate molecular weight of 30 kD.
  • One or more molecules of mPEG-mal is conjugated to each Fab' molecule.
  • the mPEG molecules are conjugated via thioether linkages between the maleimide moiety of mPEG-mal and one or more of the cysteine residues in the hinge region of the Fab' heavy chain to form the PEGylated Fab' molecule.
  • the mPEG-mal is conjugated in suitable buffer and under conditions suitable for thioether formation using methods known in the art for conjugation of maleimide derivatives to thiol-groups on proteins.
  • the Fab' may be produced from the expression system in a form in which the hinge cysteine groups are in an oxidized form.
  • the Fab' may be subjected to a reduction step prior to conjugation.
  • Reducing agents suitable for generation of free hinge thiols and methods for selective reduction of hinge cysteines are known in the art and include the use of dithiothreitol (DTT), beta-mercapto-ethanol, beta-mercapto-ethylamine (MEA) and non-thiol reducing agents such as tris(2-carboxyethyl) phosphine.
  • the reduction is carried out under conditions such that the hinge cysteines are selectively reduced and PEGylation occurs predominantly at the hinge.
  • the PEGylated Fab' comprises two molecules of mPEG due to PEGylation of both cysteine residues in the hinge.
  • a mutation may be introduced into the hinge region to replace one of the cysteine residues with another amino acid. Derivatization of such a mutant with mPEG-mal leads to the generation of mono-PEGylated Fab'.
  • hinges are: natural human gamma- 1 hinge for di-PEGylation THTCPPCPA
  • Mutant Hinge-2 for mono-PEGylation THTCPPAPA [0111] Other methods of PEGylation, for example, where the PEG is not introduced at a hinge are also known. For example, Humphreys et ah, supra, describe methods for PEGylation of cysteine residues outside the hinge region by disruption of the interchain disulphide bond between the heavy and light chain of a Fab. [0112] Methods for purification of PEGylated Fab' and separation of the desired mono- or di-PEGylated Fab' from unreacted mPEG-maleimide and Fab' molecules containing higher numbers of PEG moieties are known in the art. Such methods include, for example, size- exclusion or ion-exchange chromatography.
  • the invention also provides methods of treating a patient that has, or is at risk of having, a P. aeruginosa infection by administering an antibody of the invention.
  • a patient has cystic fibrosis, ventilator-associated pneumonia (VAP), cancer-associated neutropenia, or burns.
  • the methods of the invention comprise administering a PcrV antibody as a pharmaceutical composition to an P. aeruginosa-mfected patient in a therapeutically effective amount using a dosing regimen suitable for treatment of the disease.
  • the composition can be formulated for use in a variety of drug delivery systems.
  • One or more physiologically acceptable excipients or carriers can also be included in the compositions for proper formulation.
  • the PcrV antibody is provided in a solution suitable for injection into the patient such as a sterile isotonic aqueous solution for injection.
  • the antibody is dissolved or suspended at a suitable concentration in an acceptable carrier.
  • the carrier is aqueous, e.g., water, saline, phosphate buffered saline, and the like.
  • the compositions may contain auxiliary pharmaceutical substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and the like.
  • compositions of the invention are administered to a patient, e.g., a cystic fibrosis patient having a P. aeruginosa infection, in an amount sufficient to cure or at least partially arrest the disease or symptoms of the disease and its complications.
  • An amount adequate to accomplish this is defined as a "therapeutically effective dose.”
  • a therapeutically effective dose is determined by monitoring a patient's response to therapy. Typical benchmarks indicative of a therapeutically effective dose include amelioration of symptoms of infection in the patient, or a decrease in the levels of P. aeruginosa in the patient. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health, including other factors such as age, weight, gender, administration route, etc. Single or multiple administrations of the antibody may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the methods provide a sufficient quantity of Per V antibody to effectively treat the patient.
  • the antibody may be administered alone, or in combination with other therapies to treat the P. aeruginosa infection
  • the antibody can be administered by injection or infusion through any suitable route including but not limited to intravenous, sub-cutaneous, intramuscular or intraperitoneal routes.
  • the antibody may be administered by insufflation.
  • the antibody may be stored at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4°C and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient.
  • the antibody is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg.
  • the antibody is administered by intravenous infusion over a period of between 15 minutes and 2 hours.
  • the administration procedure is via sub-cutaneous bolus injection.
  • the dose of antibody is chosen in order to provide effective therapy for the patient and is in the range of less than 0.1 mg/kg body weight to 25 mg/kg body weight or in the range 1 mg - 2 g per patient. Preferably the dose is in the range 1 - 10 mg/kg or approximately 50 mg - 1000 mg / patient.
  • the dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, depending on the pharmacokinetics of the antibody (e.g. half-life of the antibody in the circulation) and the pharmacodynamic response (e.g. the duration of the therapeutic effect of the antibody).
  • the in vivo half-life of between about 7 and about 25 days and antibody dosing is repeated between once per week and once every 3 months. In other embodiments, the antibody is administered approximately once per month.
  • the antibody is PEGylated.
  • an antibody of the invention may be PEGylated, e.g., using methods as described herein, and administered to a patient infected with P. aeruginosa.
  • a V H region and/or V L region of the invention may also be used for diagnostic purposes.
  • the V H or V L region may be used for clinical analysis, such as detection of P. aeruginosa in samples from patient that have, or are suspected of having, a P. aeruginosa infection.
  • a V H or V L region of the invention may also be used, e.g., to produce anti-Id antibodies.
  • CDRH3 comprises a D-segment derived sequence (NRGDIYYDFTY) from a previously identified anti-PcrV monoclonal antibody (Mab 166; Frank et al 2002 J. Infectious Dis. 186: 64-73) which constitutes a binding specificity determinant.
  • NRGDIYYDFTY D-segment derived sequence from a previously identified anti-PcrV monoclonal antibody
  • CDR3-FR4 the CDR3-FR4 combination used differed by a single amino acid in CDRH3:
  • CDRL3 comprises a binding specificity determinant from Mab 166 light-chain with the sequence FWXTP (where X may be S or G).
  • FWXTP where X may be S or G.
  • C-terminal residues of CDRL3 and FR4 were contributed by the human germ-line JK2 sequence YTFGQGTKLEIK (JK2 residues within CDRL3 are underlined).
  • the FR4 region was contributed by JL2 germ-line sequence FGGGTKLTVL.
  • the JL2 germline sequence is identical to the JL3 sequence.
  • cassette libraries were constructed as described in US patent application 20060134098 (library 1070).
  • library 1080 full-length lambda chains were screened in combination with VH cassette libraries.
  • Heavy and light chain polypeptides were expressed as mature proteins, i.e., without a signal peptide, and secreted in E. coli cells that express a mutant SecY gene as described in US patent application 20070020685. The peptides therefore were expressed with an N- terminal methionine. Binding of recombinant Fabs to PcrV was identified by a filter-binding assay using nitrocellulose filters coated with GST-PcrV fusion protein as described in US patent application 20050255552. Binding activity was confirmed by antigen ELISA using plates coated with GST-PcrV and affinities were determined by biolayer interferometry using a ForteBio Octet biosensor.
  • Each of the Fabs has high affinity for PcrV.
  • Several Fabs were identified with affinities at least equivalent to Mabl ⁇ Fab (approximately 1.4 nM) determined by biolayer interferometry using a ForteBio (Mountain View, CA) Octet biosensor.
  • VH and VL regions identified as described can be used in various combinations.
  • a V K light chain SEQ ID NO: 12 supports high affinity binding to PcrV in combination with either a V H Comprising SEQ ID NO.l 1, or a V H comprising SEQ ID NO:3.
  • the 1070-9E antibody is an example of a high affinity antibody derived by V-region cassette exchange using methods described in US Patent Application Publication NO. 20060134098. To isolate this antibody, 4 V-region replacement cassettes were constructed". 1) heavy chain front-end cassette (consisting of human VH3 FR1-CDR1-FR2 sequences) 2) heavy chain middle cassette (consisting of human VH3 FR2-CDR2-FR3 sequences)
  • High-affinity anti-PcrV Fabs are also potent antagonists of the P. aeruginosa Type III Secretion system and inhibit P. aeruginosa exotoxin-mediated killing of P3-X63 Ag8 myeloma cells by P. aeruginosa strain PAl 03 in a cell-based cytotoxicity assay.
  • a Fab' consisting of a human Fd' heavy chain of the IgGl sub-class and human kappa light chain linked by an inter-chain disulfide bond involving the C-terminal cysteine of the kappa chain and the cysteine residue C227 of the heavy chain (numbering sequentially from the N-terminus of the mature protein) was PEGylated.
  • the recombinant Fd' heavy chain contains the IgGl CHl domain and the IgGl hinge region including two cysteine residues which are available after reduction for conjugation to maleimide groups.
  • the expressed antibody protein is a disulfide-linked heterodimer of Fd' heavy chain and a kappa light chain, containing a total of 452 amino acids.
  • the sequence of the constant region of an exemplary Fd' is shown in Figure 3.
  • the Fab' is conjugated to polyethylene glycol (PEG).
  • each molecule of Fab' is conjugated to two long-chain PEG molecules by site-specific attachment at the hinge region exploiting the two available reactive thiols on the hinge cysteine residues and a maleimide derivatized PEG, methoxy-polyethylene glycol maleimide (mPEG-mal).
  • mPEG-mal methoxy-polyethylene glycol maleimide
  • the mPEG-mal molecules are conjugated via thioether linkages between the maleimide moiety and the hinge cysteine residues.
  • mPEG-mal with average molecular weight of 30 kD was obtained from NOF Corporation.
  • the Fab' which was expressed and secreted from E. co Ii, was prepared at a concentration of 4 mg/ml in sodium citrate buffer pH 6.5 with 2 mM EDTA.
  • Reducing agent (10 mM MEA at pH 6.5) was added for 30 minutes at room temperature and the reaction mixture was immediately desalted using a Zeba Desalt column (Pierce) pre-equilibrated with 10 mM glycine (pH 3) and 2 niM EDTA.
  • di-PEGylated Fab' was separated from other PEGylated species and from unreacted Fab' using a HiTrap SP sepharose column on an Akta purification system from GE Healthcare.
  • the structure of di-PEGylated Fab' is provided schematically in Figure 4.
  • the exemplary di-PEGylated Fab' PEGylated in this example binds with high affinity to PcrV (affinity of 0.6 nM determined by surface plasmon resonance analysis) and is a potent antagonist of the P. aeruginosa Type III Secretion System.
  • Mono-PEGylated Fab' can be generated using mutant derivatives of Fab' containing only a single hinge cysteine.
  • the sequences of the mutant hinges are: Wild-type human gamma- 1 hinge THTCPPCPA Mutant Hinge- 1 THTAPPCPA
  • Example 3 Cytotoxicity assay for detection of antibodies and Fab fragments with potent neutralization activity against the P. aeruginosa Type HI Secretion System
  • a TT S S -dependent cytotoxicity assay was established using P3-X63-Ag8 (X63) mouse myeloma cells (ATCC) as the target.
  • Cells were cultured in RPMI 1640 (Media Tech) with 10% FBS (Hyclone). About 10 5 cells were infected with P. aeruginosa strain PA103 at a multiplicity of infection (MOI) of 10 in a volume of 0.1 ml culture medium in wells of a 96- well plate in the presence of Fab.
  • MOI multiplicity of infection
  • PAl 03 Prior to addition of Fab and mammalian cells, PAl 03 was grown in MinS medium (Hauser AR et al. (1998) Infect Imrrn in.
  • anti-PcrV antibodies of the invention typically show enhanced potency relative to Mab 166 Fab.
  • Example 4 Effects of an antibody of the invention in vivo using a mouse model of pneumonia.
  • Fab 1A8 has a human VH3 sub-class heavy chain, containing the first constant domain of human IgGl, and a human VKI sub-class kappa light chain.
  • the affinity of Fab 1A8 as determined by Biacore is 0.6 nM.
  • Fab 1A8 binds to PcrV with approximately two-fold higher affinity than Mab 166 Fab.
  • the survival data indicated that both the human Fab 1 A8 and the murine Fab can prevent lethality caused by the highly cytotoxic PA103 strain.
  • Control mice infected with PA103 and treated with an irrelevant control Fab were all dead within 24 hours of inoculation.
  • Treatment of mice with 10 ⁇ g Mab 166 or Fab 1A8 led to the survival of 100% of the mice at 48 hours.
  • Since Fab 1 A8 lacks the antibody Fc-region, antibody effector functions are not required for prevention of lethality.
  • Fab 1A8 was significantly more potent than Mabl66 Fab in prevention of lethality.
  • Fab 1 A8 provided significant protection from lethality at doses of 1.25 ⁇ g and 0.625 ⁇ g/ mouse, doses at which mouse Mabl66 Fab-treated animals showed 100% mortality (P ⁇ 0.05 for differences between Fab 1A8 and Mab 166 Fab at 2.5 ⁇ g, 1.25 ⁇ g and 0.625 ⁇ g doses).
  • the activity of Fab 1A8 is comparable to that of Mab 166 IgG in prevention of lethality.
  • Fab 1A8 is also effective in inducing recovery of body temperature, indicative of protection from sepsis (Figure 6). Untreated mice infected with PA103 show a rapid drop in body temperature within the first few hours of infection. Recovery of body temperature within 12 - 24 hours in the antibody-treated groups correlates with subsequent survival. Doses as low as 1.25 ⁇ g/ mouse of Fab 1 A8 or Mab 166 led to rapid recovery of body temperature and prevented lethality in at least 80% of mice. However, this dose of mouse Mab 166 Fab fragment was insufficient to allow body temperature recovery and all mice in this group were dead at 48 hours post-infection.
  • a second humaneered Fab that has the Mab 166 minimal essential binding specificity determinant was also evaluated in vivo using a mouse model of pneumonia.
  • mice Female Balb/c mice (approximately 20 g in weight; Charles River) were inoculated with 1 x 10 6 P. aeruginosa strain PAl 03 by intra- tracheal administration. Prior to inoculation, PA 103 bacteria were grown overnight in YPT broth at 37°C, diluted 1 :5 in fresh medium and grown for two hours at 37°C until they reached exponential phase. The culture was centrifuged at room temperature for ten minutes at 2000xg and the pellet resuspended in ⁇ 8 mL phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • mice treated only with saline solution showed 100% mortality within 24 hours of bacterial inoculation.
  • Mice treated with 10 ⁇ g Fab 2 showed complete protection from lethality; 100% of the Fab-treated mice survived at 48 hours.
  • a humaneered antibody PEGylated Fab' fragment was evaluated for safety, immunogenicity and plasma/serum half-life in human subjects. Subjects received one dose by intravenous (i.v.) injection at 1, 3, or 10mg/kg.
  • the humaneered antibody was well tolerated at all dose levels.
  • the concentration of drug in the plasma was measured by ELISA using the PcrV antigen immobilized onto a microtiter plate.
  • GST-PcrV was immobilized onto a microtiter plate overnight at 4°C.
  • the plate was washed and all unadsorbed sites blocked with the addition of block/diluent buffer for at least 60 minutes. After washing the plate, analytes were dispensed onto the pre-coated microtiter plate and incubated for at least 60 minutes.
  • the plate was washed and a solution containing a biotinylated antibody specific to the humaneered Fab was added for 45 minutes.
  • the plate was washed and a HRP- conjugate solution added for 30 minutes. After the final wash step, a tetramethylbenzidine (TMB) peroxidase substrate solution was added and incubated for approximately 6 minutes. The reaction was stopped with a phosphoric acid solution. Color develops in proportion to the amount of pegylated Fab present. Plates were read on a plate reader using two filters (450 nm for detection and 620 nm for background). Concentrations were determined on a standard curve obtained by plotting optical density (OD) versus concentration. The calibration curve was generated using a four-parameter logistic fit. The range for this method in human serum is from 0.200 to 12.8 ng/mL in 1% serum (20.0 ng/mL to 1280 ng/mL in 100% serum).
  • the humaneered antibody had a terminal plasma half-life of approximately 14 days.
  • anti-drug antibodies i.e., antibodies generated to the humaneered antibody
  • Antidrug antibodies were measured using an electrochemiluminescent assay (ECLA). Positive controls and negative control serum were diluted 1 :25 with diluent buffer. The controls were further diluted 1:2 by the addition of an equal volume of 0.8% acetic acid (resulting in 2X solutions) and then incubated at ambient temperature for approximately 15 minutes.
  • ECLA electrochemiluminescent assay

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The current invention provides high-affinity antibodies to the Pseudomonas aeruginosa PcrV protein that have reduced immunogenicity when administered to treat Pseudomonas aeruginosa infections.

Description

Antibodies to the PcrV antigen of Pseudomonas aeruginosa
CROSS-REFERENCE TO RELATED APPLCIATIONS
[0001] This application claims benefit of U.S. provisional application no. 60/991,679, filed November 30, 2007, which application is herein incorporated by reference.
BACKGROUND OF THE INVENTION
[0002] Pseudomonas aeruginosa (P. aeruginosa) is an opportunistic pathogen that rarely causes disease in healthy people, but is a significant problem for critically ill or immunocompromised individuals. Infection is a major problem in individuals who have cystic fibrosis (CF), where P. aeorginosa is a causative agent in the progressive loss of lung function resulting from recurrent and chronic respiratory tract infections with the bacterium. Others at risk from Pseudomonas aeruginosa infection include patients on mechanical ventilators, neutropenic cancer patients, and burn patients. P. aeruginosa is often resistant to most antibiotics and new treatment approaches are greatly needed. [0003] The type III secretion system is an important virulence factor determinant in that it inhibits host defense system. Upon activation, the type III secretion apparatus translocates toxins into the cytoplasm of the host cell, resulting in cell rounding, lifting, and cell death by necrosis or apoptosis. PcrV is an essential component of the type III secretion apparatus. Blocking of PcrV can inhibit toxin secretion through the Type III secretion system, thereby allowing natural clearance mechanisms to eliminate the bacteria. PcrV is conserved in all P. aeruginosa strains tested thus far.
[0004] Antibodies to the PcrV antigen of Pseudomonas are known in the art. The current invention provides improved PcrV antibodies, e.g., for the treatment of Pseudomonas aeruginosa infections.
BRIEF SUMMARY OF THE INVENTION
[0005] The current invention relates to engineered antibodies that bind with high affinity, e.g., at about 50 nM, or about 10 nM or less, to the PcrV antigen from Pseudomonas aeruginosa. Such antibodies are often functional antagonists of the Type III secretion, i.e., the antibody binds to PcrV and inhibits the Type II secretion system. In some embodiments, an antibody of the invention may bind to PcrV and recruit multiple cell types of the immune system to stimulate phagocytosis by macrophages, antibody directed cellular cytotoxicity (ADCC) by macrophages or NK cells, activation of the complement cascade, and/or generation of the oxidative burst by neutrophils.
[0006] The antibodies of the invention have variable regions with a high degree of identity to human germ-line VH and VL sequences and are less immunogenic in humans. The CDR3 sequences of the heavy and light chains of the present invention comprise a pair of binding specificity determinants (BSD) from the monoclonal anti-PcrV antibody Mabl 66 (Frank et ah, J. Infections Dis. 186: 64-73, 2002). The antibodies of the invention typically are capable of competing with Mabl 66 for binding to a neutralizing epitope on the PcrV protein. [0007] The BSD sequence in CDRH3 has the amino acid sequence NRGD IYYDFTY. The BSD in CDRL3 is FWXTP (where X may be either S or G). Complete V-regions are generated in which the BSD forms part of the CDR3 and additional sequences are used to complete the CDR3 and add a FR4 sequence. Typically, the portion of the CDR3 excluding the BSD and the complete FR4 are comprised of human germ-line sequences. Preferably, the CDR3-FR4 sequence excluding the BSD differs from human germ-line sequences by not more than two amino acids on each chain. The CDR3-FR4 is joined to a V-segment that has a high degree identity, e.g., at least 80%, or at least 90%, or more to a human germline V segment.
[0008] In some aspects, the invention provides an anti-PcrV antibody that exhibits high affinity binding, e.g., 10 nM or better, to PcrV and is an antagonist of the Type III secretion system.
[0009] In many embodiments, an anti-PcrV antibody of the invention that selectively binds to PcrV comprises: a VL region that comprises a CDR3 comprising FWGTP. In typical embodiments, such an antibody has a VL region V-segment has at least 80% identity to a human germline V-segment. The FR4 region typically has at least 90% identity to the FR4 region of a human germline J segment.
[0010] In some embodiments, an anti-PcrV antibody of the invention comprises a CDR3 comprising FWGTP, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human JK2 germline gene segment or at least 90% identity to the JL2 germline sequence; and the V-segment comprises at least 80% identity to a human germline Vkappa I or Vkappa III sequence, or at least 80% identity to a human germline Vlambda sequence. In some embodiments the VL region CDR3 has the sequence Q(Q/H)FWGTPYT. In some embodiments, the antibody further comprises a VH region that comprises a CDR3 having a sequence NRGDIYYDFTY, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human JH3 or human JH6 segment and the V-segment comprises at least 80% identity to the human VHl -18 subclass V-segment or to the human VH3-3O.3 V segment. In some embodiments, the VH region comprises a CDR3 having a sequence NRGDIYYDFTYA(MZF)DX1, wherein X1 is I, Q, Y, or S.
[0011] In further embodiments, the invention provides an anti-PcrV antibody that binds to PcrV, comprising: a VH region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDX1 , wherein X1 is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germine JH6 segment, and the V-segment comprises at least 80% identity to the human germline VHl-18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xl is Y, the FR4 region is not WGQGTSVTVSS.
[0012] In some embodiments, the invention provides an anti-PcrV antibody that binds to PcrV, comprising: a VH region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDX1, wherein X1 is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germline JH6 segment, and the V-segment comprises at least 80% identity to the human germline VHl- 18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xl is Y, the FR4 region is not WGQGTSVTVSS; and a VL region that comprises a CDR3 comprising FW(S/G)TP, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JK2 gene segment or to the FR4 region of the human germline JL2 segment; and the V-segment comprises at least 80% identity to the human germline VKI L12 sequence, or at least 80% identity to a Vkappa III sequence, or at least 80% identity to a human germline Vlambda2 2c or Vlambda3 31 segment.
[0013] In some embodiment, the FR4 of the VH region of an antibody of the invention has the sequence WGQGTX2VTVSS, wherein X2 is T or M.
[0014] In some embodiments, an antibody of the invention has a light chain CDR3 that has the sequence Q(H/Q)FW(G/S)TPYT. [0015] In some embodiments, the FR4 of the VL region has the sequence FGQGTKLEIK or FGGGTKLTVL.
[0016] The invention also provides an anti-PcrV antibody where the VH region V-segment has at least 80% identity to the human germline VH3-30.3 segment and the heavy chain region CDRl comprises the sequence X3X4X5X6H, wherein X3 is S, T, or N; X4 is Y or A; X5 is A, G, or P; and X6 is M, I, or L; and the heavy chain region CDR2 comprises the sequence X7IX8YX9GXIOXI IXI2XISY(AZI)X14SVKG, wherein X7 is V, F, or N; X8 is S or W; X9 is D or N; X10 is S, K, R or Y; X11 is N, S, D or E; X12 is K, I, or E; X13 is Y, S, D or W; and X14 is D or S. In some embodiments, the antibody has at least 90% identity to a VH3-30.3 V segment. In some embodiments, the CDRl is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH. In some embodiments, the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWYADSVKG, VIWYDGRNKYYADSVKG, VIWYDGYNKDYADSVKG, or NIWYDGSSESYIDSVKG. In some embodiments, the CDRl is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; and the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWY ADSVKG,
VIWYDGRNKYYADSVKG, VIWYDGYNKDYADSVKG, or NIWYDGSSESYIDSVKG.
[0017] The invention also provides an anti-PcrV antibody where the VH region V-segment has at least 80% identity, or at least 90% identity, to the human germline VHl- 18 sub-class V-segment and the CDRl has the sequence DHAIS and the CDR2 has the sequence WISPYSGNPNYAQSLQG.
[0018] The invention also provides an anti-PcrV antibody that binds to PcrV, comprising: a VH region that has a CDR3 sequence NRGDIYYDFTYAFDI, a CDRl sequence DHAIS and a CDR2 sequence WISPYSGNPNYAQSLQG.
[0019] In some embodiments the VH region comprises the V-segment region of an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35. For example, the VH regions can comprise an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
[0020] The invention also provides an anti-PcrV where the VL region V-segment comprises at least 80% or 90% identity, to a human germline Vkappa I L 12 or Vkappa III sequence; or at least 80% or 90% identity to a human germline Vlambda3 31 or to a Vlambda2 2c sequence. In some embodiments, VL region V-segment has at least 80% or 90% identity to the human germline VKI L 12 segment and the CDRl has the sequence RASX15X16X17X18X19X20X21A, where X15 is Q or E; X16 is S or G; X17 is I or V; X18 is S or D; X19 is S, R, or T; X20 is W or Y; and X21 is L or V; and the CDR2 has the sequence X21ASX22LX23S, wherein X21 is D or A; X22 is S, A, or T; and X23 is E, Q, or K. In some embodiments, the CDRl has the sequence RASQGISTYLA, RASQGISSWLA,
RASQSISRWVA, or RASEGVDRWLA; or the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS. In some embodiments, the CDRl has the sequence RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, or RASEGVDRWLA; and the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
[0021] The invention also provides an anti-PcrV antibody where the VL region V segment has at least 80%, or at least 90%, amino acid sequence identity to the human germline VKIII L2 sequence and the CDRl has the sequence RASNSVGAYNLA or RASQSVSSNLA; or the CDR2 has the sequence (A/G)AS(T/R)RA(T/P). In some embodiments, CDRl has the sequence RASNSVGAYNLA or RASQSVSSNLA; and the CDR2 has the sequence (A/G)AS(T/R)RA(T/P).
[0022] Further, the invention provides an anti-PcrV antibody where the VL region V- segment has at least 80%, or at least 90%, amino acid sequence identity to a human germline Vlambda L3 31 segment and the CDRl has the sequence QGDSLRS(Y/L)YAS; or the CDR2 has the sequence (G/S)KN(N/S)RPS. In some embodiments, the CDRl has the sequence QGDSLRS(Y/L)YAS; and the CDR2 has the sequence (G/S)KN(N/S)RPS.
[0023] In some embodiments, the invention provide an anti-PcrV antibody where the VL region V-segment has at least 80%, or at least 90%, amino acid sequence identity to a human germline Vlambda L2 2c segment and the CDRl has the sequence TGTS SD VG A YNY VS or TGTSSDYVS; or the CDR2 has the sequence (E/D)VT(K/N)RPS. In some embodiments, the CDRl has the sequence TGTSSDVGAYNYVS or TGTSSDYVS; and the CDR2 has the sequence (E/D)VT(K/N)RPS.
[0024] An anti-PcrV antibody of the invention can have a region that comprises the V- segment of an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37. For example the VL region can comprise an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37. [0025] The invention thus provides an anti-PcrV antibody that comprises: a VH region having an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35; and a VL region having an amino acid sequence selected from the group consisting of SEQ ID NO.2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37. Thus, in some embodiments, an antibody of the invention comprises a VH region of SEQ ID NO: 1 and a VL region of SEQ ID NO.2; or a VH region of SEQ ID NO:3 and a VL region of SEQ ID NO:4; or a VH region of SEQ ID NO:5 and a VL region of SEQ ID NO:6; or a VH region of SEQ ID NO:7 and a VL region of SEQ ID NO:8; or a VH region of SEQ ID NO: 11 and a VL region of SEQ ID NO: 12; or a VH region of SEQ ID NO:9 and a VL region of SEQ ID NO: 10; or a VH region of SEQ ID NO: 13 and a VL region of SEQ ID NO: 10; or a VH region of SEQ ID NO: 13 and a VL region of SEQ ID NO:4; or a VH region of SEQ ID NO: 13 and a VL region of SEQ ID NO:37; or a VH region of SEQ ID NO:21 and a VL region of SEQ ID NO: 18; or a VH region of SEQ ID NO: 17 and a VL region of SEQ ID NO: 18; or a VH region of SEQ ID NO:26 and a VL region of SEQ ID NO:24; or a VH region of SEQ ID NO:25 and a VL region of SEQ ID NO:24; or a VH region of SEQ ID NO:23 and a VL region of SEQ ID NO:24; or a VH region of SEQ ID NO:35 and a VL region of SEQ ID NO:36; or VH region of SEQ ID NO:29 and a VL region of SEQ ID NO:20; or VH region of SEQ ID NO:29 and a VL region of SEQ ID NO:28; or a VH region of SEQ ID NO:29 and a VL region of SEQ ID NO:30; or a Vn region of SEQ ID NO:29 and a VL region of SEQ ID NO:34; or a VH region of SEQ ID NO:3 and a VL region of SEQ ID NO:32.
[0026] In some embodiments, an anti-PcrV antibody of the invention comprises a heavy chain as set forth in Figure 1 and/or a light chain as set forth in Figure 2; or has at least one, often at least two, and in some embodiments, at least three CDRs from one of the heavy or light chains set forth in Figure 1 or Figure 2, respectively. In many embodiments, the CDRl and/or CDR2 sequence is not a germline sequence.
[0027] In some embodiments, the antibody is a Fab' fragment.
[0028] In some embodiments, an antibody of the invention is a Fab, or Fab', that has an affinity of about 10 nM or less. In some embodiments, the antibody has an affinity that is equal or better than, the affinity of a Mab 166 Fab or Fab ' .
[0029] The potency of an antibody of the invention, e.g., a Fab, in inhibiting the activity of the P. aeruginosa Type III Secretion System is typically equivalent to Mab 166 Fab (within two-fold of the activity in cell-based assays). In some embodiments, an antibody of the invention is more potent than Mab 166 in preventing cytotoxicity by P. aeruginosa.
[0030] In some embodiments, the antibody comprises a hinge region. [0031] In other embodiments, the antibody is an IgG or an IgA.. [0032] In some embodiments, the antibody is PEGylated. For example, the antibody can be di-PEGylated.
[0033] In some embodiments, the VH region or the VL region, or both the VH and VL region amino acid sequences comprise a methionine at the N-terminus.
[0034] In a further aspect, the invention provides a method of treating a patient infected with P. aeruginosa, the method comprising administering a therapeutically effective amount of an antibody as described herein. In some embodiments, the antibody is administered intravenously, subcutaneously, or by insufflation.
BRIEF DESCRIPTION OF THE DRAWINGS [0035] Figure 1 shows sequences of VH regions of anti-PcrV antibodies. CDR sequences are underlined. The VHl sequence is aligned to human germ-line sequence VH1-18. VH3- subclass antibodies are shown aligned to human germ-line sequence VH3-30.3. J-segments are aligned to either human germ-line JH3 or JH6. The VH-segments depicted in Figure 1 correspond to the sequence up to the CDR3 sequence. [0036] Figure 2 shows sequences of VL regions of anti-PcrV antibodies. CDR sequences are underlined. Vkappa-subclass antibodies are shown aligned to human germline sequence VKI Ll 2. J-segments are aligned to human germ-line JK2. Vlambda-subclass antibodies are shown aligned to human germline sequence V13 31. J-segments are aligned to human germ- line JL2. [0037] Figure 3 shows an exemplary constant region sequence that can be linked to Fab' Heavy and Light Chains. The two cysteine residues in the hinge region available for conjugation of thiol-reactive maleimide derivatives are underlined. The cysteine residues involved in formation of an interchain disulfide bond are boxed.
[0038] Figure 4 shows a schematic representation of the structure of a di-PEGylated Fab' in which two molecules of mPEG-maleimide are conjugated via thioether linkages to cysteine residues in the hinge region of the Fab' protein. The exemplary antibody is comprised of a human Fd' heavy chain and human kappa light chain linked by a disulphide bond represented by the cross-bar between the two chains. (Fab and PEG components are not to scale.)
[0039] Figure 5 provides data showing a time course of survival of mice treated with various doses of antibodies to PcrV at the time of challenge with a lethal dose of PA 103. Mabl66 and Fab fragments were co-instilled via the intratracheal route with 1.5 x 106 bacteria (5 mice per group, 4 mice for Mabl66 Fab groups). Control is a nonspecific Fab with no binding to PcrV or any P. aeruginosa protein. Mice were treated with antibody doses of: A) lOμg, B) 5μg, C) 2.5μg, D) 1.25μg, *P=0.01 for Fab 1A8 vs. Mabl66 Fab E) 0.625μg *P=0.002 for 1A8 vs. Mabl66 Fab, F) 0.3125μg, G) O.lόμg, H) 0.08μg. P values for differences between treatment groups determined by Mantel-Cox log-rank test.
[0040] Figure 6 provides data showing a body temperature analysis of mice treated with anti-PcrV antibodies. Rectal temperatures are shown for 48 hours or until mortality. Antibody doses: A) lOμg, B) 5μg, C) 2.5μg, D) 1.25μg E) 0.625μg F) 0.3125μg, G) O.lόμg, H) 0.08μg.
[0041] Figure 7 provides data showing clearance of P. aeruginosa from the lungs of infected mice by anti-PcrV antibodies. Mice were infected with 1.5 x 106 cfu PA 103 co- instilled with Mab 166 IgG, Mab 166 Fab or human Fab 1A8 at the doses shown (in μg). The graph shows cfu / lung isolated from individual mice surviving at 48 h. The number of dead mice at this time point is shown above the figure. Median cfu/ lung for surviving mice in each group is shown with a bar.
DETAILED DESCRIPTION OF THE INVENTION [0042] As used herein, an "antibody" refers to a protein functionally defined as a binding protein and structurally defined as comprising an amino acid sequence that is recognized by one of skill as being derived from the framework region of an immunoglobulin-encoding gene of an animal that produces antibodies. An antibody can consist of one or more polypeptides substantially encoded by immunoglobulin genes or fragments of immunoglobulin genes. The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
[0043] A typical immunoglobulin (antibody) structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kD) and one "heavy" chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains, respectively.
[0044] The term "antibody" as used herein includes antibody fragments that retain binding specificity. For example, there are a number of well characterized antibody fragments. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)!2, a dimer of Fab which itself is a light chain joined to VH-CHl (Fd) by a disulfide bond. The F(ab)! 2 may be reduced under mild conditions to break the disulfide linkage in the hinge region thereby converting the (Fab')2 dimer into an Fab' monomer. The Fab' monomer is essentially a Fab with all or part of the hinge region (see, Fundamental Immunology, W.E. Paul, ed., Raven Press, N. Y. (1993), for a more detailed description of other antibody fragments). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that fragments can be synthesized de novo either chemically or by utilizing recombinant DNA methodology. Thus, the term antibody, as used herein also includes antibody fragments either produced by the modification of whole antibodies or synthesized using recombinant DNA methodologies.
[0045] Antibodies of the invention include dimers such as VH-VL dimers, VH dimers, or VL dimers, including single chain antibodies (antibodies that exist as a single polypeptide chain), such as single chain Fv antibodies (sFv or scFv) in which a variable heavy and a variable light region are joined together (directly or through a peptide linker) to form a continuous polypeptide. The single chain Fv antibody is a covalently linked VH-VL heterodimer which may be expressed from a nucleic acid including VH- and VL- encoding sequences either joined directly or joined by a pepti de-encoding linker (e.g., Huston, et al. Proc. Nat. Acad. ScL USA, 85:5879-5883, 1988). While the VH and VL are connected to each as a single polypeptide chain, the VH and VL domains associate non-covalently. Alternatively, the antibody can be another fragment, such as a disulfide-stabilized Fv (dsFv). Other fragments can also be generated, including using recombinant techniques. The scFv antibodies and a number of other structures converting the naturally aggregated, but chemically separated light and heavy polypeptide chains from an antibody V region into a molecule that folds into a three dimensional structure substantially similar to the structure of an antigen-binding site are known to those of skill in the art (see e.g., U.S. Patent Nos. 5,091,513, 5,132,405, and 4,956,778). In some embodiments, antibodies include those that have been displayed on phage or generated by recombinant technology using vectors where the chains are secreted as soluble proteins, e.g., scFv, Fv, Fab, (Fab')2 or generated by recombinant technology using vectors where the chains are secreted as soluble proteins. Antibodies for use in the invention can also include diantibodies and miniantibodies. [0046] Antibodies of the invention also include heavy chain dimers, such as antibodies from camelids. Since the VH region of a heavy chain dimer IgG in a camelid does not have to make hydrophobic interactions with a light chain, the region in the heavy chain that normally contacts a light chain is changed to hydrophilic amino acid residues in a camelid. VH domains of heavy-chain dimer IgGs are called VHH domains. Antibodies of the invention include single domain antibodies (dAbs) and nanobodies (see, e.g., Cortez-Retamozo, et ah, Cancer Res. 64:2853-2857, 2004).
[0047] As used herein, "V-region" refers to an antibody variable region domain comprising the segments of Framework 1, CDRl, Framework 2, CDR2, and Framework 3, including CDR3 and Framework 4, which segments are added to the V-segment as a consequence of rearrangement of the heavy chain and light chain V-region genes during B-cell differentiation. A "V-segment" as used herein refers to the region of the V-region (heavy or light chain) that is encoded by a V gene. The V-segment of the heavy chain variable region encodes FR1-CDR1-FR2-CDR2 and FR3. For the purposes of this invention, the V-segment of the light chain variable region is defined as extending though FR3 up to CDR3. [0048] As used herein, the term "J-segment" refers to a subsequence of the variable region encoded comprising a C-terminal portion of a CDR3 and the FR4. An endogenous J-segment is encoded by an immunoglobulin J-gene.
[0049] As used herein, "complementarity-determining region (CDR)" refers to the three hypervariable regions in each chain that interrupt the four "framework" regions established by the light and heavy chain variable regions. The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDRl, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, for example, a VH CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a VL CDRl is the CDRl from the variable domain of the light chain of the antibody in which it is found. [0050] The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.
[0051] The amino acid sequences of the CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, international
ImMunoGeneTics database (IMGT), and AbM (see, e.g., Johnson et al, supra; Chothia & Lesk, 1987, Canonical structures for the hypervariable regions of immunoglobulins. J. MoI. Biol. 196, 901-917; Chothia C. et al., 1989, Conformations of immunoglobulin hypervariable regions. Nature 342, 877-883; Chothia C. et al., 1992, structural repertoire of the human VH segments J. MoI. Biol. 227, 799-817; Al-Lazikani et al, J.MolBiol 1997, 273(4)).
Definitions of antigen combining sites are also described in the following: Ruiz et al., IMGT, the international ImMunoGeneTics database. Nucleic Acids Res., 28, 219-221 (2000); and Lefranc,M.-P. IMGT, the international ImMunoGeneTics database. Nucleic Acids Res. Jan l;29(l):207-9 (2001); MacCallum et al, Antibody-antigen interactions: Contact analysis and binding site topography, J. MoI. Biol., 262 (5), 732-745 (1996); and Martin et al, Proc. Natl Acad. ScL USA, 86, 9268-9272 (1989); Martin, et al, Methods EnzymoL, 203, 121-153, (1991); Pedersen et al, Immimomethods, 1, 126, (1992); and Rees et al, In Sternberg M.J.E. (ed.), Protein Structure Prediction. Oxford University Press, Oxford, 141-172 1996).
[0052] "Epitope" or "antigenic determinant" refers to a site on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
[0053] The term " binding specificity determinant" or "BSD" as used in the context of the current invention refers to the minimum contiguous or non-contiguous amino acid sequence within a CDR region necessary for determining the binding specificity of an antibody. In the current invention, the minimum binding specificity determinants reside within a portion or the full-length of the CDR3 sequences of the heavy and light chains of the antibody.
[0054] As used herein, the terms "PcrV antagonizing antibody" or an "anti-PcrV antibody is an antagonist of the Psendomonas aeruginosa Type III secretion system" are used interchangeably to refer to an antibody that binds to PcrV and inhibits the Type III secretion system. Inhibition occurs when secretion through the Type III secretion system is at least about 10% less, for example, at least about 25%, 50%, 75% less, or totally inhibited, in comparison to secretion when not exposed to the antibody antagonist. The terms "anti-PcrV antibody" and "PcrV antibody" are used synonymously unless otherewise stated. [0055] The term "equilibrium dissociation constant (KD) refers to the dissociation rate constant (kd, time"1) divided by the association rate constant (ka, time.i, M"1). Equilibrium dissociation constants can be measured using any known method in the art. The antibodies of the present invention are high affinity antibodies. Such antibodies have an affinity better than 500 nM, and often better than 50 iiM or 10 nM. Thus, in some embodiments, the antibodies of the invention have an affinity in the range of 500 nM to 100 pM, or in the range of 50 or 25 nM to 100 pM, or in the range of 50 or 25 nM to 50 pM, or in the range of 50 nM or 25 nM to 1 pM.
[0056] As used herein, "humanized antibody" refers to an immunoglobulin molecule in CDRs from a donor antibody are grafted onto human framework sequences. Humanized antibodies may also comprise residues of donor origin in the framework sequences. The humanized antibody can also comprise at least a portion of a human immunoglobulin constant region.. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. Humanization can be performed using methods known in the art {e.g., Jones et al, Nature 321:522-525; 1986; Riechmann et a/., Nature 332:323-327, 1988; Verhoeyen et al, Science 239:1534- 1536, 1988); Presta, Curr. Op. Struct. Biol 2:593-596, 1992; U.S. Patent No. 4,816,567), including techniques such as "superhumanizing" antibodies (Tan et al, J. Immunol 169: 1119, 2002) and "resurfacing" (e.g., Staelens et ah, MoL Immunol 43: 1243, 2006; and Roguska et ah, Proc. Natl Acad. Sc/ USA 91: 969, 1994).
[0057] A "humaneered" antibody in the context of this invention refers to an engineered human antibody having a binding specificity of a reference antibody. A "humaneered" antibody for use in this invention has an immunoglobulin molecule that contains minimal sequence derived from a donor immunoglobulin. Typically, an antibody is "humaneered" by joining a DNA sequence encoding a binding specificity determinant (BSD) from the CDR3 region of the heavy chain of the reference antibody to human VH segment sequence and a light chain CDR3 BSD from the reference antibody to a human VL segment sequence. A "BSD" refers to a CDR3-FR4 region, or a portion of this region that mediates binding specificity. A binding specificity determinant therefore can be a CDR3-FR4, a CDR3, a minimal essential binding specificity determinant of a CDR3 (which refers to any region smaller than the CDR3 that confers binding specificity when present in the V region of an antibody), the D segment (with regard to a heavy chain region), or other regions of CDR3- FR4 that confer the binding specificity of a reference antibody. Methods for humaneering are provided in US patent application publication no. 20050255552 and US patent application publication no. 20060134098.
[0058] The term "hybrid" when used with reference to portions of a nucleic acid or protein, indicates that the nucleic acid or protein comprises two or more subsequences that are not normally found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes arranged to make a new functional nucleic acid. Similarly, a hybrid protein refers to two or more subsequences that are not normally found in the same relationship to each other in nature. [0059] The term "recombinant" when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, e.g., recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all. By the term "recombinant nucleic acid" herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved. Thus an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. Similarly, a "recombinant protein" is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.
[0060] The phrase "specifically (or selectively) binds" to an antibody or "specifically (or selectively) immunoreactive with," when referring to a protein or peptide, refers to a binding reaction where the antibody binds to the protein of interest. In the context of this invention, the antibody typically binds to PcrV with an affinity of 500 nM or less, and has an affinity of 500OnM or greater, for other antigens.
[0061] The terms "identical" or percent "identity," in the context of two or more polypeptide (or nucleic acid) sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues (or nucleotides) that are the same (i.e., about 60% identity, preferably 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection {see, e.g. , NCBI web site). Such sequences are then said to be "substantially identical." "Substantially identical" sequences also includes sequences that have deletions and/or additions, as well as those that have substitutions, as well as naturally occurring, e.g., polymorphic or allelic variants, and man-made variants. As described below, the preferred algorithms can account for gaps and the like. Preferably, protein sequence identity exists over a region that is at least about 25 amino acids in length, or more preferably over a region that is 50-100 amino acids in length, or over the length of a protein. [0062] A "comparison window", as used herein, includes reference to a segment of one of the number of contiguous positions selected from the group consisting typically of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. MoI. Biol 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat 'I. Acad. ScL USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)).
[0063] Preferred examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al, J. MoI. Biol 215:403-410 (1990). BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11 , an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. [0064] The terms "isolated," "purified," or "biologically pure" refer to material that is substantially or essentially free from components that normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified. The term "purified" in some embodiments denotes that a protein gives rise to essentially one band in an electrophoretic gel. Preferably, it means that the protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure. [0065] The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymer.
[0066] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ- carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an α carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
[0067] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[0068] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated, e.g., naturally contiguous, sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to another of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid. One of skill will recognize that in certain contexts each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, often silent variations of a nucleic acid which encodes a polypeptide is implicit in a described sequence with respect to the expression product, but not with respect to actual probe sequences.
[0069] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables and substitution matrices such as BLOSUM providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention. Typical conservative substitutions for one another include: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)). I. Introduction
[0070] The invention relates to antibodies that bind with high affinity to the PcrV antigen from Pseudomonas aeruginosa and are typically functional antagonists of the Type III secretion system. The antibodies comprise variable regions with a high degree of homology to human germ-line VH and VL sequences. The CDR3 sequences of the heavy and light chains comprise a pair of binding specificity determinants (BSD) from the monoclonal anti- PcrV antibody Mabl66 (Frank et a!., J. Infectious Dis. 186: 64-73, 2002; and U.S. Patent No 6,827,935) and the antibodies of the invention compete with Mabl66 for binding to a neutralizing epitope on the PcrV protein {see, e.g., U.S. Patent No. 6,827,935).
[0071] The BSD sequence in CDRH3 has the amino acid sequence NRGDIYYDFTY. In some embodiments, an antibody of the invention as a heavy chain CDR3 sequence NRGDIYYDFTYA(M/F)DX, where X is I, S, or Q. [0072] The BSD in CDRL3 is FWXTP (where X may be either S or G). Complete V- regions are generated in which the BSD forms part of the CDR3 and additional sequences are used to complete the CDR3 and add a FR4 sequence. Typically, the portion of the CDR3 excluding the BSD and the complete FR4 are comprised of human germ-line sequences. In preferred embodiments, the CDR3-FR4 sequence excluding the BSD differs from human germ-line sequences by not more than 2 amino acids on each chain.
[0073] The human germline V- segment repertoire consists of 51 heavy chain V-segments, 40 K light chain V-segments, and 31 λ light chain V-segments, making a total of 3,621 germline V-region pairs. In addition, there are stable allelic variants for most of these V- segments, but the contribution of these variants to the structural diversity of the germline repertoire is limited. The sequences of all human germ-line V-segment genes are known and can be accessed in the V-base database (on the worldwide web at vbase.mrc-cpe.cam.ac.uk), provided by the MRC Centre for Protein Engineering, Cambridge, United Kingdom (see, also Chothia et al, 1992, JMoI Biol 227:776-798; Tomlinson et al, 1995, EMBO J 14:4628- 4638; Cook et al (1995) Immunol. Today 16: 237-242and Williams et al, 1996, J MoI Biol 264:220-232); or the international ImMunoGeneTics database (IMGT). These sequences can be used as reference sources for the human germline segments of the antibodies of the invention.
[0074] Antibodies or antibodies fragments as described herein can be expressed in prokaryotic or eukaryotic microbial systems or in the cells of higher eukaryotes such as mammalian cells.
[0075] An antibody that is employed in the invention can be in any format. For example, in some embodiments, the antibody can be a complete antibody including a constant region, e.g., a human constant region, or can be a fragment or derivative of a complete antibody, e.g., a Fab, Fab', F(ab')2, scFv, Fv, or a single domain antibody, such as a nanobody or a camelid antibody.
II. Heavy Chains
[0076] A heavy chain of an anti-PcrV antibody of the invention comprises a heavy-chain V-region that comprises the following elements: 1 ) human heavy-chain V-segment sequences comprising FRl -CDRl -FR2-CDR2-
FR3
2) a CDRH3 region comprising the amino acid sequence NRGDIYYDFTY 3) a FR4 contributed by a human germ-line J-gene segment.
Examples of V-segment sequences that support binding to PcrV in combination with a CDR3-FR4 segment described above together with a complementary VL region are shown in Figure 1. The V-segments can be from the human VHl or VH3 sub-classes. In some embodiments, the V-segment is a human VH3 sub-class segment that has a high degree of amino-acid sequence identity with the germ-line segment VH3-3O.3. For example the V- segment differs by not more than fifteen residues from VH3-30.3 and preferably not more than seven residues.
[0077] The FR4 sequence of the antibodies of the invention is provided by a human J segment. There are six heavy chain JH-regions numbered 1 through 6. Thus, the FR4 sequences can be provided by a JHl, JH2, JH3, JH4, JH5 or JH6 gene segment. Typically, the FR4 region of an antibody of the invention has at least 90%, often at least 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99%, or 100% identity, to the FR4 region of the human germline J segment that provides the FR4. [0078] In some embodiments, the FR4 sequence is provided by a human germ-line JH3 segment and has a sequence WGQGTMVTVSS. In other embodiments, the FR4 is provided by a human germ-line JH6 segment and has the sequence WGQGTTVTVSS.
[0079] The CDRH3 also comprises sequences that are derived from a human J-segment. Typically, the CDRH3-FR4 sequence excluding the BSD differs by not more than 2 amino acids from a human germ-line J-segment. In typical embodiments, the J-segment sequences in CDRH3 are from the same J-segment used for the FR4 sequences. Thus, in some embodiments, the CDRH3-FR4 region comprises the BSD and a complete human JH3 germ- line gene segment. Exemplary combinations of CDRH3 and FR4 sequences are shown below, in which the BSD is in bold and human germ-line J-segment residues are underlined: CDR3
NRGDIYYDFTYAFDIWGQGTMVTVSS (FR4 = JH3 ) NRGDIYYDFTYAMDIWGQGTMVTVSS (FR4 = JH3 ) NRGDIYYDFTYAMDIWGQGTTVTVSS (FR4 = JH6 )
[0080] In some embodiments, an antibody of the invention comprises a V-segment that has at least 90% identity, or at least 91%, 92% 93%, 94%, 95%, 965, 97%, 98%, 99%, or 100% identity to the germ-line segment VH3 30.3 or to a germline VHl-18 segment; or to one of the V-segments of the VH regions shown in Figure 1, such as a V-segment portion of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35. [0081] In some embodiments, the V-segment of the VH region has a CDRl and/or CDR2 as shown in Figure 1. For example, an antibody of the invention may have a CDRl that has the sequence TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; or a CDR2 that has the sequence VIWYNGKEISY ADSVKG, FIS YDGSEKYYAS SVKG, or VISYDGSEKWYADSVKG. In some embodiments, the CDR2 of the VH region has a negatively charged amino acid positioned in about the middle, e.g., at position 8 or 9 of the CDR2.
[0082] In particular embodiments, an antibody has both a CDRl and a CDR2 from one of the VH region V-segments shown in Figure 1 and a CDR3 that comprises NRGDIYYDFTY, e.g., NRGDIYYDFTYAFDI or NRGDIYYDFTYAMDI. Thus, an anti-PcrV antibody of the invention, may for example, have a CDR3-FR4 that has the sequence NRGDIYYDFTYAFDIWGQGTMVTVSS, NRGDIYYDFTYAMDIWGQGTMVTVSS, or NRGDIYYDFTYAMDIWGQGTTVTVSS. In other embodiments, the antibody may comprise a CDR3 that has the sequence NRGDIYYDFTY A(M/F)D(Q/S). III. Light chains
[0083] A light chain of an anti-PcrV antibody of the invention comprises at light-chain V- region that comprises the following elements:
1) human light-chain V-segment sequences comprising FRl -CDRl -FR2-CDR2-FR3
2) a CDRL3 region comprising the sequence FWXTP (where X may be S or G) 3) a FR4 contributed by a human germ-line J-gene segment.
The VL region comprises either a Vlambda or a Vkappa V-segment. Examples of Vlambda and Vkappa sequences that support binding in combination with a complementary Vπ-region are provided in Figure 2. Vkappa segments are cloned upstream of the human germ-line JK2 segment and Vlambda segments are cloned upstream of the germ-line JL2 segment. [0084] The CDRL3 sequence comprises a V-segment and J-segment derived sequences. In typical embodiments, the J-segment sequences in CDRL3 are from the same J-segment used for FR4. Thus, may differ by not more than 2 amino acids from human kappa germ-line V- segment and J-segment sequences. In some embodiments, the CDRL3-FR4 region comprises the BSD and the complete human JK2 germ-line gene segment. Exemplary CDRL3-FR4 combinations for kappa chains are shown below in which the BSD is shown in bold and JK2 sequences are underlined: CDR3
QQFWSTPYTFGQGTKLEIK (JK2) QHFWGTPYTFGQGTKLEIK (JK2)
[0085] A preferred CDR3-FR4 for lambda chains is shown below in which the BSD is shown in bold and the JL2 sequences are underlined:
CDR3
QHFWSTPYTFGGGTKLTVL (JL2)
[0086] The FR4 sequence of the antibodies of the invention is provided by a human J segment. There are five human JKappa-region segments labeled 1 though 5 and four
JLambda-region segments labeled 1, 2, 3 and 7. Thus, the FR4 sequences can be provided by by any of these germline sequences. Typically, the FR4 region of an antibody of the invention has at least 90%, often at least 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, 99%, or 100% identity, to the FR4 region of the human germline J segment that provides the FR4. [0087] The Vkappa segments are typically of the VKI or VKIII sub-class. In some embodiments, the segments have at least 80% sequence identity to a human germline VKI or VKIII subclass, e.g., at least 80% identity to the human germ-line VKI L12 sequence or to human germline VKIII L2 or VKIIIAl 1 sequence. For example, the Vkappa segment may differ by not more than 18 residues from VKI Ll 2, or 12 residues from VKIII Al 1 or VKIII L2. In other embodiments, the VL region V-segment of an antibody of the invention has at least 85% identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the human germline VKI L 12, or to the human germline VkIII L2 sequence, or to human germline VKIII Al l sequence, or to a kappa V-segment sequence of a VL region shown in Figure 2, for example, the V-segment sequence of SEQ ID NOs. 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 37.
[0088] In some embodiments, the V-segment of the VL corresponds to a human germline Vlambda segment. Tims, in some embodiments, the V-segment has at least 85% identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a Vlambda V-segment of a VL region of Figure 2, such as the V-segment sequence of SEQ ID NOs. 28, 30, 32, or 34.
[0089] In some embodiments, the V-segment of the VL region has a CDRl and/or CDR2 as shown in Figure 2. For example, an antibody of the invention may have a CDRl sequence of RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, RASQGISTYLA, or RASEGVDRWLA or CDR2 sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS. In other embodiments, the antibody may have a CDRl sequence of QGDSLRSYYA, TGTSSDVGAYNYVS, or TGTSSDYV; or a CDR2 sequence GKNNRPS, EVTKRPS, or DVTNRPS. [0090] In particular embodiments, an anti-PcrV antibody of the invention may have a
CDRl and a CDR2 in a combination as shown in one of the V-segments of the VL regions set forth in Figure 2 and a CDR3 sequence that comprises FWXTP, where X is S or G, e.g., the CDR3 may be QQFWSTPYT, QHFWGTPYT, or QHFWSTPYT. In some embodiments, such an anti-PcrV antibody may comprise an FR4 region that is FGQGTKLEIK or FGGGTKLTVL. Thus, an anti-PcrV antibody of the invention, can comprise, e.g., both the CDRl and CDR2 from one of the VL regions shown in Figure 2 and a CDR3-FR4 region that is QFWSTPYTFGQGTKLEIK, QHFWGTPYTFGQGTKLEIK, or QHFWSTPYTFGGGTKLTVL.
IV. Preparation of PcrV antibodies [0091] An antibody of the invention may comprise any of the VH regions of SEQ ID NOs. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, or 35 in combination with any of the VL regions of SEQ ID NOs. 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36 or 37.
[0092] An antibody may be tested to confirm that the antibody retains the activity of antagonizing the Type III secretion system. The antagonist activity can be determined using any number of endpoints, including cytotoxicity assays. Exemplary assays are described, e.g., in U.S. Patent No 6,827,935. An antibody that is administered to treat P. aeruginosa infection preferably retains at least 75%, preferably 80%, 90%, 95%, or 100%, of the Type III secretion pathway antagonist activity of Mabl66 (U.S. Patent No. 6,827,935).
[0093] A high-affinity antibody may be identified using well known assays to determine binding activity and affinity. Such techniques include ELISA assays as well as binding determinations that employ surface plasmon resonance or interferometry. For example, affinities can be determined by biolayer interferometry using a ForteBio (Mountain View, CA) Octet biosensor.
[0094] Antibodies of the invention typically compete with Mabl66 for binding to PcrV. The region of PcrV to which Mabl66 binds has been identified (U.S. Patent No. 6,827,935). PcrV or a fragment thereof that binds Mabl66 can be employed in a competitive binding assay. The ability of an antibody described herein to block or compete with Mabl66 for binding to PcrV indicates that the antibody binds to the same epitope as Mablόό or to an epitope that is close to, e.g., overlapping, with the epitope that is bound by Mablόό. In other embodiments an antibody described herein, e.g., an antibody comprising a VH and VL region combination as shown in Table 1 , can be used as a reference antibody for assessing whether another antibody competes for binding to PcrV. A test antibody is considered to competitively inhibit binding of a reference antibody, if binding of the reference antibody to the antigen is reduced by at least 30%, usually at least about 40%, 50%, 60% or 75%, and often by at least about 90%, in the presence of the test antibody. Many assays can be employed to assess binding, including ELISA, as well as other assays, such as immunoblots.
[0095] In some embodiments, the anti-PcrV antibody need not antagonize the Type III secretion sequences. For example, antibodies of the invention that bind to PcrV can recruit multiple cell types of the immune system to stimulate phagocytosis by macrophages, antibody directed cellular cytotoxicity (ADCC) by macrophages or NK cells, activation of the complement cascade, and/or generation of the oxidative burst by neutrophils, thereby causing bacterial, i.e., P. aeruginosa, death. Furthermore, all antibody variable regions are capable of catalyzing redox reactions from singlet oxygen provided by activated neutrophils, leading to the generation of a variety of highly potent oxidizing agents directly harmful to bacteria (see, e.g., Wentworth et a!., Proc. Natl Acad. Sci USA 97:10930-10935, 2000), including ozone, a potent antibacterial agent which also stimulates inflammatory responses (see, e.g., Babior et al, Proc. Natl. Acad. Sci USA 100:3031-3034, 2003). Indeed, inflammation induced by complement activation and ozone generation has the potential to recruit additional elements of the immune system to further boost immunity. Such antibodies typically have an affinity of 50 nM or less, typically less than about 10 nM. [0096] Non-neutralizing and neutralizing anti-PcrV antibodies used in combination with antibiotics provide a strong therapeutic effect.
[0097] Methods for the isolation of antibodies with V-region sequences close to human germ-line sequences have previously been described (US patent applications 20050255552 and 20060134098). Antibody libraries may be expressed in a suitable host cell including mammalian cells, yeast cells or prokaryotic cells. For expression in some cell systems, a signal peptide can be introduced at the N-terminus to direct secretion to the extracellular medium. Antibodies may be secreted from bacterial cells such as E. coll with or without a signal peptide. Methods for signal-less secretion of antibody fragments from E. coli are described in US patent application 20070020685.
[0098] To generate a PcrV-binding antibody, one of the Vπ-regions of the invention is combined with one of the VL-regions of the invention and expressed in any of a number of formats in a suitable expression system. Thus the antibody may be expressed as a scFv, Fab, Fab' (containing an immunoglobulin hinge sequence), F(ab')2, (formed by di-sulfide bond formation between the hinge sequences of two Fab' molecules), whole immunoglobulin or truncated immunoglobulin or as a fusion protein in a prokaryotic or eukaryotic host cell, either inside the host cell or by secretion. A methionine residue may optionally be present at the N-terminus, for example, in polypeptides produced in signal-less expression systems. Each of the VH-regions described herein may be paired with each of the VL regions to generate an anti-PcrV antibody. For example, VH3 1080-2F was identified from the library paired with two different lambda light chains (1080-2F and 1080-1 IE). The kappa chain 1069-3F was identified paired with VFB 1069-3F and with VH3 1100-3. Exemplary combinations of heavy and light chains are shown in the Table 1.
Table 1- Exemplary antibody heavy-chain and light-chain combinations
Figure imgf000025_0001
[0099] In many embodiments, the antibodies of the invention antagonize the P. aeruginosa type III secretion system and typically exhibit high affinity binding to PcrV. High affinity binding between an antibody and an antigen exists if the affinity of the antibody is less than 500 or 100 iiM, for example, less than 50 iiM or less than 25 nM, or less than 10 nM, or less than 1 nM, e.g., less than about 100 pM. The antibodies of the invention typically have an affinity of 50 nM or less, often 10 nM or less, when assayed as Fabs, e.g., using ELISA, surface plasmon resonance assays, or interferometry. Table 1 provides examples of such antibodies.
[0100] In some embodiments, an antibody of the invention is more potent in a cellular cyototxicity assay than Mab 166.
[0101] Antibodies may be produced using any number of expression systems, including both prokaryotic and eukaryotic expression systems. Many such systems are widely available from commercial suppliers. In embodiments in which an antibody comprises both a VH and VL region, the VH and VL regions may be expressed using a single vector, e.g., in a discistronic expression unit, or under the control of different promoters. In other embodiments, the VH and VL region may be expressed using separate vectors. The antibodies of the invention may be expressed with or without a methionine at the N-terminus. Thus, a VH or VL region as described herein may optionally comprise a methionine at the N-terminus.
[0102] An antibody of the invention may be produced in any number of formats, including as a Fab, a Fab', a F(ab')2, a scFv, or a dAB. An antibody of the invention can also include a human constant region. The constant region of the light chain may be a human kappa or lambda constant region. The heavy chain constant region is often a gamma chain constant region, for example, a gamma- 1, gamma-2, gamma-3, or gamma-4 constant region. In other embodiments, the antibody may be an IgA. [0103] In some embodiments, the antibody is "non-immunogenic" when administered to a human. The term "non-immunogenic" as used here refers to a PcrV antibody of the invention that does not provoke antibody production against the anti-PcrV antibody when administered to a human. Antibodies can be assessed for immunogenicity using known assays, e.g., an electrochemiluminescence immunoassay described in example 5. Such assays detect the level of antibodies present in a patient, e.g., in a serum sample from the patient, that react with the anti-PcrV antibody that is administered to the patient. An assay is considered to show that the antibody is non-immunogenic when no detectable antibody to the anti-PcrV antibody is present in the sample, e.g., in comparison to a control sample from an individual that was not administered the antibody.
V. PEGylation of Antibodies [0104] In some embodiments, e.g., where the antibody is a fragment, the antibody can be conjugated to another molecule, e.g., polyethylene glycol (PEGylation) or serum albumin, to provide an extended half-life in vivo . Examples of PEGylation of antibody fragments are provided in Knight et al. Platelets 15:409, 2004 (for abciximab); Pedley et al., Br. J. Cancer 70:1126, 1994 (for an anti-CEA antibody); Chapman et al, Nature Biotech. 17:780, 1999; and Humphreys, et a!., Protein Eng. Des. 20: 227,2007).
[0105] In some embodiments, the antibodies of the invention are in the form of a Fab' fragment. A full-length light chain is generated by fusion of a VL-region to human kappa or lambda constant region. Either constant region may be used for any light chain; however, in typical embodiments, a kappa constant region is used in combination with a Vkappa variable region and a lambda constant region is used with a Vlambda variable region.
[0106] The heavy chain of the Fab' is a Fd' fragment generated by fusion of a Vπ-region of the invention to human heavy chain constant region sequences, the first constant (CHl) domain and hinge region. The heavy chain constant region sequences can be from any of the immunoglobulin classes, but is often from an IgG, and may be from an IgGl, IgG2, IgG3 or IgG4. The Fab' antibodies of the invention may also be hybrid sequences, e.g., a hinge sequence may be from one immunoglobulin sub-class and the CHl domain may be from a different sub-class. In a preferred embodiment, the heavy chain constant region including the CHl domain and hinge sequence is from human IgGl .
[0107] The Fab' molecule can be PEGylated using known methods. The hinge region of the heavy chain contains cysteine residues suitable for conjugation to a polyethylene glycol derivative. The hinge sequence may be the complete natural hinge region of an immunoglobulin heavy chain or may be truncated by one or more amino-acids. In some embodiments, the hinge region may be a modified or synthetic sequence. In further embodiments, the hinge is a natural immunoglobulin hinge sequence and contains two cysteine residues. [0108] In some embodiments, Fab' molecules can be conjugated by site-specific conjugation to maleimide derivatives of methoxy polyethylene glycol (mPEG-mal). The mPEG-mal can have, for example, an average molecular mass of between 10 and 40 kD. The PEG may be branched PEG or linear PEG. In some embodiments, the mPEG-mal is a linear molecule and has an approximate molecular weight of 30 kD. One or more molecules of mPEG-mal is conjugated to each Fab' molecule. The mPEG molecules are conjugated via thioether linkages between the maleimide moiety of mPEG-mal and one or more of the cysteine residues in the hinge region of the Fab' heavy chain to form the PEGylated Fab' molecule. The mPEG-mal is conjugated in suitable buffer and under conditions suitable for thioether formation using methods known in the art for conjugation of maleimide derivatives to thiol-groups on proteins.
[0109] The Fab' may be produced from the expression system in a form in which the hinge cysteine groups are in an oxidized form. In this case, the Fab' may be subjected to a reduction step prior to conjugation. Reducing agents suitable for generation of free hinge thiols and methods for selective reduction of hinge cysteines are known in the art and include the use of dithiothreitol (DTT), beta-mercapto-ethanol, beta-mercapto-ethylamine (MEA) and non-thiol reducing agents such as tris(2-carboxyethyl) phosphine. In some embodiments, the reduction is carried out under conditions such that the hinge cysteines are selectively reduced and PEGylation occurs predominantly at the hinge. Typically, the PEGylated Fab' comprises two molecules of mPEG due to PEGylation of both cysteine residues in the hinge. In some embodiments, a mutation may be introduced into the hinge region to replace one of the cysteine residues with another amino acid. Derivatization of such a mutant with mPEG-mal leads to the generation of mono-PEGylated Fab'.
[0110] Examples of suitable sequences of hinges are: natural human gamma- 1 hinge for di-PEGylation THTCPPCPA
Mutant Hinge- 1 for mono-PEGylation THTAPPCPA
Mutant Hinge-2 for mono-PEGylation THTCPPAPA [0111] Other methods of PEGylation, for example, where the PEG is not introduced at a hinge are also known. For example, Humphreys et ah, supra, describe methods for PEGylation of cysteine residues outside the hinge region by disruption of the interchain disulphide bond between the heavy and light chain of a Fab. [0112] Methods for purification of PEGylated Fab' and separation of the desired mono- or di-PEGylated Fab' from unreacted mPEG-maleimide and Fab' molecules containing higher numbers of PEG moieties are known in the art. Such methods include, for example, size- exclusion or ion-exchange chromatography.
VI. Administration of PcrV antibodies for the treatment of P. aeruginosa infections.
[0113] The invention also provides methods of treating a patient that has, or is at risk of having, a P. aeruginosa infection by administering an antibody of the invention. In some embodiments, such a patient has cystic fibrosis, ventilator-associated pneumonia (VAP), cancer-associated neutropenia, or burns. The methods of the invention comprise administering a PcrV antibody as a pharmaceutical composition to an P. aeruginosa-mfected patient in a therapeutically effective amount using a dosing regimen suitable for treatment of the disease. The composition can be formulated for use in a variety of drug delivery systems. One or more physiologically acceptable excipients or carriers can also be included in the compositions for proper formulation. Suitable formulations for use in the present invention are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, PA, 17th ed. (1985). For a brief review of methods for drag delivery, see, Langer, Science 249: 1527-1533 (1990). [0114] The PcrV antibody is provided in a solution suitable for injection into the patient such as a sterile isotonic aqueous solution for injection. The antibody is dissolved or suspended at a suitable concentration in an acceptable carrier. In some embodiments the carrier is aqueous, e.g., water, saline, phosphate buffered saline, and the like. The compositions may contain auxiliary pharmaceutical substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and the like.
[0115] The pharmaceutical compositions of the invention are administered to a patient, e.g., a cystic fibrosis patient having a P. aeruginosa infection, in an amount sufficient to cure or at least partially arrest the disease or symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a "therapeutically effective dose." A therapeutically effective dose is determined by monitoring a patient's response to therapy. Typical benchmarks indicative of a therapeutically effective dose include amelioration of symptoms of infection in the patient, or a decrease in the levels of P. aeruginosa in the patient. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health, including other factors such as age, weight, gender, administration route, etc. Single or multiple administrations of the antibody may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the methods provide a sufficient quantity of Per V antibody to effectively treat the patient.
[0116] The antibody may be administered alone, or in combination with other therapies to treat the P. aeruginosa infection
[0117] The antibody can be administered by injection or infusion through any suitable route including but not limited to intravenous, sub-cutaneous, intramuscular or intraperitoneal routes. In some embodiments, the antibody may be administered by insufflation. In an exemplary embodiment, the antibody may be stored at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4°C and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient. The antibody is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg. In other embodiments, the antibody is administered by intravenous infusion over a period of between 15 minutes and 2 hours. In still other embodiments, the administration procedure is via sub-cutaneous bolus injection.
[0118] The dose of antibody is chosen in order to provide effective therapy for the patient and is in the range of less than 0.1 mg/kg body weight to 25 mg/kg body weight or in the range 1 mg - 2 g per patient. Preferably the dose is in the range 1 - 10 mg/kg or approximately 50 mg - 1000 mg / patient. The dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, depending on the pharmacokinetics of the antibody (e.g. half-life of the antibody in the circulation) and the pharmacodynamic response (e.g. the duration of the therapeutic effect of the antibody). In some embodiments, the in vivo half-life of between about 7 and about 25 days and antibody dosing is repeated between once per week and once every 3 months. In other embodiments, the antibody is administered approximately once per month. [0119] In further embodiments, the antibody is PEGylated. For example, an antibody of the invention may be PEGylated, e.g., using methods as described herein, and administered to a patient infected with P. aeruginosa.
[0120] A VH region and/or VL region of the invention may also be used for diagnostic purposes. For example, the VH or VL region may be used for clinical analysis, such as detection of P. aeruginosa in samples from patient that have, or are suspected of having, a P. aeruginosa infection. A VH or VL region of the invention may also be used, e.g., to produce anti-Id antibodies.
EXAMPLES Example 1. Identification of engineered human anti-PcrV Fab molecules.
[0121] Epitope-focused engineered human antibody Fab libraries were generated as described in US patent application 20050255552. V-segment sequences derived from repertoires of human immunoglobulin sequences were cloned upstream of a selected CDR3- FR4 sequence for each of the heavy and light chains. [0122] For heavy-chain repertoires, the CDRH3 comprises a D-segment derived sequence (NRGDIYYDFTY) from a previously identified anti-PcrV monoclonal antibody (Mab 166; Frank et al 2002 J. Infectious Dis. 186: 64-73) which constitutes a binding specificity determinant. The sequence of the complete CDRH3-FR4 sequence for the heavy chain repertoires is shown below. For VHl library 1015, the CDR3-FR4 combination used was:
CDR3
NRGDIYYDFTYAFDIWGQGTMVTVSS (FR4 = JH3)
For VH3 libraries, the CDR3-FR4 combination used differed by a single amino acid in CDRH3: CDR3
NRGDIYYDFTYAMDIWGQGTMVTVSS (FR4 = JH3)
[0123] For light-chain repertoires, human Vkappa or Vlambda sequences comprising FRl- CDRL1-FR2-CDRL2-FR3 were inserted upstream of selected CDRL3-FR4 sequences. The CDRL3 comprises a binding specificity determinant from Mab 166 light-chain with the sequence FWXTP (where X may be S or G). For Vkappa libraries, the C-terminal residues of CDRL3 and FR4 were contributed by the human germ-line JK2 sequence YTFGQGTKLEIK (JK2 residues within CDRL3 are underlined). For Vlambda libraries, the FR4 region was contributed by JL2 germ-line sequence FGGGTKLTVL. The JL2 germline sequence is identical to the JL3 sequence.
[0124] In some cases cassette libraries were constructed as described in US patent application 20060134098 (library 1070). For library 1080, full-length lambda chains were screened in combination with VH cassette libraries.
[0125] Heavy and light chain polypeptides were expressed as mature proteins, i.e., without a signal peptide, and secreted in E. coli cells that express a mutant SecY gene as described in US patent application 20070020685. The peptides therefore were expressed with an N- terminal methionine. Binding of recombinant Fabs to PcrV was identified by a filter-binding assay using nitrocellulose filters coated with GST-PcrV fusion protein as described in US patent application 20050255552. Binding activity was confirmed by antigen ELISA using plates coated with GST-PcrV and affinities were determined by biolayer interferometry using a ForteBio Octet biosensor.
[0126] The sequences of the V-regions of exemplary high-affinity anti-PcrV antibodies are shown in Figure 1 and Figure 2.
[0127] Each of the Fabs has high affinity for PcrV. Several Fabs were identified with affinities at least equivalent to Mablόό Fab (approximately 1.4 nM) determined by biolayer interferometry using a ForteBio (Mountain View, CA) Octet biosensor.
[0128] VH and VL regions identified as described can be used in various combinations. For example, a VK light chain SEQ ID NO: 12 supports high affinity binding to PcrV in combination with either a VHComprising SEQ ID NO.l 1, or a VH comprising SEQ ID NO:3.
[0129] The 1070-9E antibody is an example of a high affinity antibody derived by V-region cassette exchange using methods described in US Patent Application Publication NO. 20060134098. To isolate this antibody, 4 V-region replacement cassettes were constructed". 1) heavy chain front-end cassette (consisting of human VH3 FR1-CDR1-FR2 sequences) 2) heavy chain middle cassette (consisting of human VH3 FR2-CDR2-FR3 sequences)
1) light chain front-end cassette (consisting of human VKl FRl -CDRl -FR2 sequences)
2) light chain middle cassette (consisting of human VKl FR2-CDR2-FR3 sequences). Each cassette was assembled with additional V-region sequences from Mab 166 and the selected CDR3-FR4 region and expressed as Fab fragments in E. coli TOPlO cells transformed with a plasmid over-expresssing a mutant SecY gene to allow secretion of signal-less Fabs. Cassette Fab libraries were then screened on GST-PcrV coated filters to identify PcrV binders. Selected sequences from Fabs supporting PcrV binding were then recombined and re-screened to identify fully-human V-segments supporting high-affinity binding to PcrV. [0130] Fab 1070-9E, isolated by cassette recombination, has an affinity for recombinant PcrV of 1.48 nM, determined by biolayer interferometry.
[0131] High-affinity anti-PcrV Fabs are also potent antagonists of the P. aeruginosa Type III Secretion system and inhibit P. aeruginosa exotoxin-mediated killing of P3-X63 Ag8 myeloma cells by P. aeruginosa strain PAl 03 in a cell-based cytotoxicity assay. Example 2. PEGylated Fab'
[0132] In this example, a Fab' consisting of a human Fd' heavy chain of the IgGl sub-class and human kappa light chain linked by an inter-chain disulfide bond involving the C-terminal cysteine of the kappa chain and the cysteine residue C227 of the heavy chain (numbering sequentially from the N-terminus of the mature protein) was PEGylated. The recombinant Fd' heavy chain contains the IgGl CHl domain and the IgGl hinge region including two cysteine residues which are available after reduction for conjugation to maleimide groups. Thus the expressed antibody protein is a disulfide-linked heterodimer of Fd' heavy chain and a kappa light chain, containing a total of 452 amino acids. The sequence of the constant region of an exemplary Fd' is shown in Figure 3. [0133] To generate an immunoconjugate with a reduced rate of in vivo clearance and thus an improved pharmacokinetic profile, the Fab' is conjugated to polyethylene glycol (PEG). In di-PEGylated Fab', each molecule of Fab' is conjugated to two long-chain PEG molecules by site-specific attachment at the hinge region exploiting the two available reactive thiols on the hinge cysteine residues and a maleimide derivatized PEG, methoxy-polyethylene glycol maleimide (mPEG-mal). The mPEG-mal molecules are conjugated via thioether linkages between the maleimide moiety and the hinge cysteine residues.
[0134] To generate di-PEGylated Fab', mPEG-mal with average molecular weight of 30 kD was obtained from NOF Corporation. The Fab', which was expressed and secreted from E. co Ii, was prepared at a concentration of 4 mg/ml in sodium citrate buffer pH 6.5 with 2 mM EDTA. Reducing agent (10 mM MEA at pH 6.5) was added for 30 minutes at room temperature and the reaction mixture was immediately desalted using a Zeba Desalt column (Pierce) pre-equilibrated with 10 mM glycine (pH 3) and 2 niM EDTA. mPEG-mal was added for 1 hour at room temperature and di-PEGylated Fab' was separated from other PEGylated species and from unreacted Fab' using a HiTrap SP sepharose column on an Akta purification system from GE Healthcare. [0135] The structure of di-PEGylated Fab' is provided schematically in Figure 4. The exemplary di-PEGylated Fab' PEGylated in this example binds with high affinity to PcrV (affinity of 0.6 nM determined by surface plasmon resonance analysis) and is a potent antagonist of the P. aeruginosa Type III Secretion System.
[0136] Mono-PEGylated Fab' can be generated using mutant derivatives of Fab' containing only a single hinge cysteine. The sequences of the mutant hinges are: Wild-type human gamma- 1 hinge THTCPPCPA Mutant Hinge- 1 THTAPPCPA
Mutant Hinge-2 THTCPPAPA
Example 3 - Cytotoxicity assay for detection of antibodies and Fab fragments with potent neutralization activity against the P. aeruginosa Type HI Secretion System
[0137] A TT S S -dependent cytotoxicity assay was established using P3-X63-Ag8 (X63) mouse myeloma cells (ATCC) as the target. Cells were cultured in RPMI 1640 (Media Tech) with 10% FBS (Hyclone). About 105 cells were infected with P. aeruginosa strain PA103 at a multiplicity of infection (MOI) of 10 in a volume of 0.1 ml culture medium in wells of a 96- well plate in the presence of Fab. Prior to addition of Fab and mammalian cells, PAl 03 was grown in MinS medium (Hauser AR et al. (1998) Infect Imrrn in. 66.1413-1420) to induce expression of the TTSS. After incubation for three hours at 37°C with 5% CO2, with various concentrations of anti-PcrV Fab, cells were transferred to 12 x 75 mm flow-cytometry tubes and stained with propidium iodide (Sigma) according to the manufacturer's instructions. The proportion of permeabilized cells was quantified by flow cytometry using a FACS Caliber flow cytometer. Data were analyzed using Prism4 software (Graphpad). (Cytotoxicity was normalized to dead cells in untreated samples). For comparison of the potency of different Fabs, mean concentrations required for 50% inhibition (IC50) were obtained from at least 3 independent assays. Results for several exemplary Fabs are shown in Table 2 below. Table 2. Potency of Fabs in cytotoxicity assay
Figure imgf000035_0001
[0138] Each of the Fabs tested shows potent neutralization of the TTSS and protection of mammalian cells from cytotoxicity.
[0139] Several Fabs are more potent in this assay than Mab 166 Fab. Thus, anti-PcrV antibodies of the invention typically show enhanced potency relative to Mab 166 Fab.
Example 4. Effects of an antibody of the invention in vivo using a mouse model of pneumonia. [0140] Experiments were performed in vivo using humaneered Fabs to evaluate the effects of the antibodies in a mouse model of pneumonia. Fab 1A8 has a human VH3 sub-class heavy chain, containing the first constant domain of human IgGl, and a human VKI sub-class kappa light chain. The affinity of Fab 1A8 as determined by Biacore is 0.6 nM. Fab 1A8 binds to PcrV with approximately two-fold higher affinity than Mab 166 Fab. [0141] An acute lethality model of Pseudomonas pneumonia was used to assess the in vivo efficacy of Fab 1A8 in comparison with Mab 166. P. aeruginosa strain PA 103 was instilled directly into the lungs of mice at a dose of 1.5 x 106 cm / mouse by intratracheal administration, an inoculum shown previously to be sufficient to lead to lethality in 100% of the animals (3 x LD90) (Sawa et al, Nat Med. 5:392-8, 1999). Survival and body temperature were monitored for 48 hours and surviving mice at this time point were sacrificed for determination of bacterial counts in the lungs. The survival data (Figure 5) indicated that both the human Fab 1 A8 and the murine Fab can prevent lethality caused by the highly cytotoxic PA103 strain. Control mice infected with PA103 and treated with an irrelevant control Fab, were all dead within 24 hours of inoculation. Treatment of mice with 10 μg Mab 166 or Fab 1A8 led to the survival of 100% of the mice at 48 hours. Since Fab 1 A8 lacks the antibody Fc-region, antibody effector functions are not required for prevention of lethality. Fab 1A8 was significantly more potent than Mabl66 Fab in prevention of lethality. Fab 1 A8 provided significant protection from lethality at doses of 1.25 μg and 0.625 μg/ mouse, doses at which mouse Mabl66 Fab-treated animals showed 100% mortality (P<0.05 for differences between Fab 1A8 and Mab 166 Fab at 2.5 μg, 1.25 μg and 0.625 μg doses). The activity of Fab 1A8 is comparable to that of Mab 166 IgG in prevention of lethality.
[0142] Fab 1A8 is also effective in inducing recovery of body temperature, indicative of protection from sepsis (Figure 6). Untreated mice infected with PA103 show a rapid drop in body temperature within the first few hours of infection. Recovery of body temperature within 12 - 24 hours in the antibody-treated groups correlates with subsequent survival. Doses as low as 1.25 μg/ mouse of Fab 1 A8 or Mab 166 led to rapid recovery of body temperature and prevented lethality in at least 80% of mice. However, this dose of mouse Mab 166 Fab fragment was insufficient to allow body temperature recovery and all mice in this group were dead at 48 hours post-infection. [0143] Surviving mice at 48 hours post-challenge were also analyzed for the presence of residual Pseudomonas in the lungs. Remarkably, both Mab 166 and the Fab 1 A8 fragments analyzed stimulated significant clearance of bacteria (Figure 7). After 48 hours, the bacterial counts were reduced at least 1000-fold from the infectious dose of 1.5 x 106 cm/ mouse in all mice treated with 10 μg Fab 1A8. 80% of mice treated with this dose of Fab 1A8 showed no detectable Pseudomonas in the lungs after 48 hours. Higher residual bacterial counts were detected in mice treated with mouse Mab 166 Fab. Human Fab 1A8 has comparable potency to the whole IgG Mab 166 in this analysis indicating that Fc-effector functions do not contribute significantly to the ability of the antibody to stimulate bacterial clearance
[0144] A second humaneered Fab that has the Mab 166 minimal essential binding specificity determinant was also evaluated in vivo using a mouse model of pneumonia.
Female Balb/c mice (approximately 20 g in weight; Charles River) were inoculated with 1 x 106 P. aeruginosa strain PAl 03 by intra- tracheal administration. Prior to inoculation, PA 103 bacteria were grown overnight in YPT broth at 37°C, diluted 1 :5 in fresh medium and grown for two hours at 37°C until they reached exponential phase. The culture was centrifuged at room temperature for ten minutes at 2000xg and the pellet resuspended in ~8 mL phosphate buffered saline (PBS). Bacteria were quantified by absorbance at 600 nm and bacterial colony- forming units verified by colony growth on tryptic soy (TS) agar plates (Teknova, Half Moon Bay, CA). Antibody Fab 2 fragment was premixed with bacteria immediately prior to intratracheal instillation. Infected mice were monitored for body temperature (rectal temperatures) and survival for 48 hours.
[0145] Control mice treated only with saline solution showed 100% mortality within 24 hours of bacterial inoculation. Mice treated with 10 μg Fab 2 showed complete protection from lethality; 100% of the Fab-treated mice survived at 48 hours.
[0146] This example thus shows that humaneered antibodies of the invention exhibit potent in vivo activity against P. aeruginosa. The Fabs are more potent than a parent M 166 Fab in vivo. Example 5. Evaluation of a humaneered Fab for immuno genie ity in human.
[0147] A humaneered antibody PEGylated Fab' fragment was evaluated for safety, immunogenicity and plasma/serum half-life in human subjects. Subjects received one dose by intravenous (i.v.) injection at 1, 3, or 10mg/kg.
[0148] The humaneered antibody was well tolerated at all dose levels. The concentration of drug in the plasma was measured by ELISA using the PcrV antigen immobilized onto a microtiter plate. GST-PcrV was immobilized onto a microtiter plate overnight at 4°C. The plate was washed and all unadsorbed sites blocked with the addition of block/diluent buffer for at least 60 minutes. After washing the plate, analytes were dispensed onto the pre-coated microtiter plate and incubated for at least 60 minutes. The plate was washed and a solution containing a biotinylated antibody specific to the humaneered Fab was added for 45 minutes. The plate was washed and a HRP- conjugate solution added for 30 minutes. After the final wash step, a tetramethylbenzidine (TMB) peroxidase substrate solution was added and incubated for approximately 6 minutes. The reaction was stopped with a phosphoric acid solution. Color develops in proportion to the amount of pegylated Fab present. Plates were read on a plate reader using two filters (450 nm for detection and 620 nm for background). Concentrations were determined on a standard curve obtained by plotting optical density (OD) versus concentration. The calibration curve was generated using a four-parameter logistic fit. The range for this method in human serum is from 0.200 to 12.8 ng/mL in 1% serum (20.0 ng/mL to 1280 ng/mL in 100% serum).
Figure imgf000038_0001
[0149] The humaneered antibody had a terminal plasma half-life of approximately 14 days.
[0150] The presence of anti-drug antibodies, i.e., antibodies generated to the humaneered antibody, was tested at: pre-infusion, day 8, day 15 day 29 and day 70 post infusion. Antidrug antibodies were measured using an electrochemiluminescent assay (ECLA). Positive controls and negative control serum were diluted 1 :25 with diluent buffer. The controls were further diluted 1:2 by the addition of an equal volume of 0.8% acetic acid (resulting in 2X solutions) and then incubated at ambient temperature for approximately 15 minutes. Samples were then diluted an additional 1 :2 with Label Master Mix (Antibody-Biotin and Antibody - SulfoTag at 0.5 μg/mL final working concentrations) resulting in a final 1 : 100 dilution. All controls were then incubated for one hour at room temperature with gentle shaking. The Streptavidin-coated standard MA2400 96-well microtiter plate was blocked by adding diluent buffer for 60 minutes. Diluent buffer was removed from plate wells by aspiration and controls were added to the plate and incubated for 60 minutes. The plate was aspirated and washed, and IX MesoScaleDiscovery® (MSD) Read Buffer T with surfactant was added. The plates were read on an MSD electrochemiluminescence detector within 1 minute. Intensity of relative light units (RLU) produced are in proportion to the amount of anti-drug antibody present [0151] No anti-dnig antibodies were detected at any time point. This example thus demonstrates that there was no detectable immunogenicity of the humaneered antibody in humans.
[0152] The following provides an exemplary listing of anti-PcrV antibody V-regions of the invention:
Exemplary Anti-PcrV V-regions
SEQ ID NO:1 Vh (VHl)
EIQLVQSGAEVKKPGASVKVSCKASGYTFTDHAISWVRQAPGQGLEWMGWISPYSGNPN YAQSLQGRVSLTTDRSTRTAYMELRSLKSDDTAVYYCARNRGDIYYDFTYAFDIWGQGTM VTVSS
SEQ ID NO: 2 VkI
DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGRAPKLLIYAASSLQSGVP SRFSGSGSGTGFTLTISSLQPEDVATYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 3 Vh
QVQLVESGGGVVQPGGSLRLSCAASGFTFSTAGMHWVRQAPGKGLEWVAVIWYNGKEIS YADSVKGRFTVSRDNPKNTLYLQMSSLRTEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS
SEQ ID NO: 4 VkI
DIQMTQSPSSLSASVGDRVTITCRASQSISRWVAWYQQRPGKAPNLLIYDASSLKSGVP SRFSGSGSGTEFTLTISSLQPEDIATYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 5 Vh
QVQLVESGGGVVQPGRSLRLSCTASGFSFSSYGMHWVRQAPGKGLEWVAVIWYNGKEIS
YADSVKGRFTVSRDNPKNTLYLQMSSLRTEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM
VTVSS
SEQ ID NO: 6 VkI
AIQLTQSPSFLSASVGDRVTITCRASQGISTYLAWYQQKPGKAPKLLIYAASSLQSGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCQQFWSTPYTFGQGTKLEIK SEQ ID NO: 7 Vh
QVQLVESGGGLVQPGRSLRLSCVGSGFTFSSYGIHWVRQAPGKGLEWVAVIWYNGKEIS
YADSVKGRFTVSRDNLKNTLYLQMSSLRTEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM
VTVSS SEQ ID NO: 8 VkI
DIQMTQSPSFLSASVGDRVTITCRASQGISTYLAWYQQKRGKAPKLLISAASSLQSGVP SRFSGSVSGTDFTLTISSLQSEDFAVYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 9 Vh QVQLVESGGGLVQPGRSLRLSCVGSGFTFSSYGIHWVRQAPGKGLEWVAVIWYNGKEIS YADSVKGRFTVSRDNPKNTLYLQMSSLRTEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS
SEQ ID NO: 10 VkI DIQLTQSPSFLSASVGDRVTITCRASQGISTYLAWYQQKPGKAPKLLIYDASALQSGVP SRFSGSGSGTEFTLTISSLQPEDVATYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 11 Vh
EVQLVESGGGWQPGGSLRLSCAASGFTFSTAGMHWVRQAPGKGLEWVAVIWYNGKEIS YADSVKGRFTVFRDNPKNTLYLQMSSLRTEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS SEQ ID NO: 12 VkI
DIQMTQSPSSLSASVGDRVTITCRASQSISRWVAWYQQRPGKAPNLLIYDASSLKSGVP SRFSGSGSGTEFTLTISSLQPEDIATYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 13 Vh
QVQLVESGGGWQPGRSLRLSCAASGFTFSSYPLHWVRQAPGKGLEWVSFISYDGSEKYY ASSVKGRFTISRDNSENTLYLQMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTMV TVSS
SEQ ID NO: 14 Vk
DIQLTQSPSFLSASVGDRVTITCRASQGISTYLAWYQQKPGKAPKLLIYDASALQSGVPS RFSGSGSGTEFTLTISSLQPEDVATYYCQQFWSTPYTFGQGTKLEIK SEQ ID NO: 15 Vh
EVQLVESGGGWQPGRSLRLSCTASGFSFSSYGMHWVRQAPGKGLEWVAVIWYDGRNKY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS SEQ ID NO: 16 VkIII
EIVLTQFPGTLSLSPGERATLSCRASQNVGSAYLAWYQQKPGQAPRLLIYGASRRAPGI PDRFSGSGSGTDFTLTINRLEPEDFAVYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 17 Vh EVQLVESGGGWQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGYNKD YADSVKGRFTISRDNSKNTLYLQINSLRAEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS
SEQ ID NO: 18 VkIII EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIP ARFSGSGSGTEFTLTISSLQSEDFAVYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 19 Vh
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYPLHWVRQAPGKGLEWVSFISYDGSEKY YASSVKGRFTISRDNSENTLYLQMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS
SEQ ID NO: 20 VkIII
EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLFYAASTRATGIP ARFSGSGSGTEFTLTISSLQSEDFAVYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 21 Vh
EVQLVESGGGLVQPGRSLRLSCVGSGFTFSSYGIHWVRQAPGKGLEWVANIWYDGSSES YIDSVKGRFTVSRDDSRNTVYLQMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS
SEQ ID NO:22 VkIII
EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIP
ARFSGSGSGTEFTLTISSLQSEDFAVYYCQQFWSTPYTFGQGTKLEIK
SEQ ID NO: 23 VH
EVQLVESGGGVVQPGRSLRLSCAASGFTFSNYPMHWVRQAPGKGLEWVAVISYDGSEKWYADSVKGRFTI SRDNSKNTLYLEMNSLRPEDTAVYYCARNRGDIYYDFTYAMDQWGQGTTVTVSS SEQ ID NO: 24 VK
DIQLTQSPSTLSASVGDSVTITCRASEGVDRWLAWYQQKPGRAPKLLIYDASTLQSGVPS RFSGSGSGTEFSLTISSLQPDDVATYYCQHFWGTPYTFGQGTKLEIK
SEQ ID NO: 25 VH EVQLVESGGGVVQPGRSLRLSCAASGFTFSNYPMHWVRQAPGKGLEWVAVISYDGSEKWYADSVKGRFTI SRDNSKNTLYLEMNSLRPEDTAVYYCARNRGDIYYDFTYAMDSWGQGTTVTVSS SEQ ID NO: 24 VK
DIQLTQSPSTLSASVGDSVTITCRASEGVDRWLAWYQQKPGRAPKLLIYDASTLQSGVPS RFSGSGSGTEFSLTISSLQPDDVATYYCQHFWGTPYTFGQGTKLEIK
SEQ ID NO: 26 VH
EVQLVESGGGWQPGRSLRLSCAASGFTFSNYPMHWVRQAPGKGLEWVAVISYDGSEKWY ADSVKGRFTI SRDNSKNTLYLEMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTTVTVSS SEQ ID NO : 24 VK
DIQLTQSPSTLSASVGDSVTITCRASEGVDRWLAWYQQKPGRAPKLLIYDASTLQSGVPS RFSGSGSGTEFSLTISSLQPDDVATYYCQHFWGTPYTFGQGTKLEIK
SEQ ID NO: 35 VH EVQLVESGGGVVQPGRSLRLSCAASGFTFSNYPMHWVRQAPGKGLEWVAVISYDGSEKWYADSVKGRFTI SRDNSKNTLYLEMNSLRPEDTAVYYCARNRGDIYYDFTYAMDYWGQGTTVTVSS
SEQ ID NO: 36 VK
DIQLTQSPSTLSASVGDSVTITCRASEGVDRWLAWYQQKPGRAPKLLIYDASTLQSGVPS RFSGSGSGTEFSLTISSLQPDDVATYYCQHFWSTPYTFGQGTKLEIK
V-regions of Exemplary Antibodies with Lambda light chain SEQ ID NO: 27 Vh
EVQLVESGGGWQPGRSLRLSCAASGFTFSSYPLHWVRQAPGKGLEWVSFISYDGSEKY YASSVKGRFTISRDNSENTLYLQMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS SEQ ID no: 28 Vl
QSALTQPASVSGSPGQSITISCTGTSSDYVSWYQQHPGKAPKLIIYDVTNRPSGVPDRF SGSKSGNTASLTISGLQAEDEADYYCQHFWSTPYTFGGGTKLTVL
SEQ ID NO: 29 Vh
EVQLVESGGGWQPGRSLRLSCAASGFTFSSYPLHWVRQAPGKGLEWVSFISYDGSEKY YASSVKGRFTISRDNSENTLYLQMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTM VTVSS SEQ ID NO: 30 Vl
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGI PD RFSGSSSGNTASLTITGAQAEDEADYYCQHFWSTPYTFGGGTKLTVL
Additional VL regions:
SEQ ID NO: 32 Vl
SSELTQDPAVSVALGQTVTITCQGDSLRSLYASWYQQKPGQAPVLVLYSKNSRPSGIPD RFSGSSSGNTASLTITGARAEDEADYYCQHFWSTPYTFGGGTKLTVL
SEQ ID NO: 34 Vl
QSVLTQPPSASGSPGQSVTISCTGTSSDVGAYNYVSWYQQYPGKVPKLIIYEVTKRPSG VPDRFSGSKSGNTASLTVSGLRAEDEADYYCQHFWSTPYTFGGGTKLTVL SEQ ID NO: 37 VkI
DIQMTQSPSSLSASVGDRVTITCRASQSISRWVAWYQQRPGKAPNLLIYDASSLKSGVPSRFSGSGSGTEFTLTI SSLQPEDIATYYCQQFWGTPYTFGQGTKLEIK [0153] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
[0154] All publications, accession numbers, patents, and patent applications cited in this specification are herein incorporated by reference as if each was specifically and individually indicated to be incorporated by reference.

Claims

WHAT IS CLAIMED IS:
1. An anti-PcrV antibody comprising a VL region that comprises a CDR3 comprising FWGTP, wherein the anti-PcrV antibody selectively binds to PcrV.
2. The antibody of claim 1, wherein the antibody comprises a VH region that has a CDR3 comprising a sequence NRGDIYYDFTY
3. The antibody of claim 1 , wherein the VL region segment has at least 80% identity to a human germline V-segment.
4. The antibody of claim 1 , wherein the VL region comprises a FR4 that has at least 90% identity to the FR4 region of a human germline Jkappal, Jkappa2, Jkappa 3, Jkappa4, or Jkappa5 segment or at least 90% identity to the FR4 region of a human germline Jlambda 1, Jlambda2, Jlambda3, or Jlambda7 segment
5. The antibody of any one of the preceding claims, wherein the VL region comprises a FR4 that has at least 90% identity to the FR4 region of the human JK2 germline gene segment or at least 90% identity to the JL2 germline sequence; and a V- segment that has at least 80% identity to a human germline Vkappa I or Vkappa III sequence, or at least 80% identity to a human germline Vlambda sequence.
6. The antibody of any one of the preceding claims, wherein the a VL region CDR3 has the sequence Q(Q/H)FWGTPYT.
7. The antibody of any one of the preceding claims, further comprising: a VH region that comprises a CDR3 having a sequence NRGDIYYDFTY, a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human JH3 or human JH6 segment and the V-segment comprises at least 80% identity to the human VHl- 18 subclass V-segment or to the human VH3-3O.3 V segment.
8. The antibody of any one of the preceding claims, wherein the VH region comprises a CDR3 having a sequence NRGDIYYDFTYA(MyF)DX1, wherein X1 is I, Q, Y, or S.
9. An anti-PcrV antibody that binds to PcrV, comprising: a VH region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDX1, wherein X1 is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germine JH 6 segment, and the V-segment comprises at least 80% identity to the human germline VHl -18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xi is Y, the FR4 region is not WGQGTSVTVSS.
10. An anti-PcrV antibody that binds to PcrV, comprising: a VH region that comprises a CDR3 having a sequence NRGDIYYDFTYAMDXi, wherein Xi is I, Q, Y, or S; a FR4 and a V-segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JH3 segment or the FR4 region of the human germline JH6 segment, and the V-segment comprises at least 80% identity to the human germline VHl-18 subclass V-segment or to the human germline VH3-30.3 subclass V segment, with the proviso that when Xi is Y, the FR4 region is not WGQGTSVTVSS; a VL region that comprises a CDR3 comprising FW(S/G)TP, a FR4 and a V- segment, wherein the FR4 comprises at least 90% identity to the FR4 region of the human germline JK2 gene segment or to the FR4 region of the human germline JL2 segment; and the V-segment comprises at least 80% identity to the human germline VKI Ll 2 sequence, or at least 80% identity to a Vkappa III sequence, or at least 80% identity to a human germline Vlambda2 2c or Vlambda3 31 segment.
11. The antibody of any one of the preceding claims, wherein the FR4 of the VH region has the sequence WGQGTX2VTVSS, wherein X2 is T or M.
12. The antibody of any one of claims 9 through 11, wherein the light chain CDR3 has the sequence Q(H/Q)FW(G/S)TPYT.
13. The antibody of any one of the preceding claims wherein the FR4 of the VL region has the sequence FGQGTKLEIK or FGGGTKLT VL.
14. The antibody of any one of the preceding claims, wherein the VH region V-segment has at least 80% identity to the human germline VH3-30.3 segment and the heavy chain region CDRl comprises the sequence X3X4X5X6H, wherein X3 is S, T, or N; X4 is Y or A; X5 is A, G, or P; and Xe is M, I, or L; and the heavy chain region CDR2 comprises the sequence X7IX8 YX9GX10X1 iX12Xi3Y(A/I)X14SVKG, wherein X7 is V, F, or N; X8 is S or W; X9 is D or N; X10 is S, K, R or Y; X11 is N, S, D or E; X12 is K, I, or E; X13 is Y, S, D or W; and X14 is D or S.
15. The antibody of claim 14, wherein the VH region V-segment has at least 90% identity to a VH3-3O.3 V segment.
16. The antibody of claim 14 or claim 15, wherein the CDRl is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; or the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWYADSVKG, VIWYDGRNKYYADSVKG, VIWYDGYNKDYADSVKG, or NIWYDGSSESYIDSVKG.
17. The antibody of claim 14 or claim 15, wherein the CDR 1 is TAGMH, SYGIH, SYGMH, SYPLH, or NYPMH; and the CDR2 is VIWYNGKEISYADSVKG, FISYDGSEKYYASSVKG, VISYDGSEKWYADSVKG, VIWYDGRNKYYADSVKG, VIWYDGYNKDYADSVKG, or NIWYDGSSESYIDSVKG.
18. The antibody of any one of claims 1 through 13, wherein the VH region V-segment has at least 80% identity to the human germline VHl- 18 sub-class V-segment and the CDRl has the sequence DHAIS and the CDR2 has the sequence WISPYSGNPNYAQSLQG.
19. The antibody of claim 18, wherein the VH region V-segment has at least 90% identity to the human germline VH 1-18 sub-class V-segment.
20. An anti-PcrV antibody that binds to PcrV, comprising: a VH region that has a CDR3 sequence NRGDIY YDFT Y AFDI, a CDRl sequence DHAIS and a CDR2 sequence WISPYSGNPNYAQSLQG.
21. The antibody of claim 20, wherein the V-segment of the VH region comprises at least 80% identity to the human germline VH 1-18 subclass V-segment.
22. The antibody of any one of the preceding claims, wherein the VH region comprises the V-segment region of an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
23. The antibody of claim 22, wherein the VH region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35.
24. The antibody of any one of the preceding claims, wherein the VL region V-segment comprises at least 90% identity to a human germline Vkappa I L 12 or Vkappa III sequence, or at least 90% identity to a human germline Vlambda3 31 or to a Vlambda2 2 c sequence
25. The antibody of any one of the preceding claims 1 to 20, wherein the VL region V-segment has at least 80% amino acid sequence identity to the human germline VKI L12 segment and the CDRl has the sequence RASX15X16X17X18X19X20X21A, where X15 is Q or E; X16 is S or G; Xi7 is I or V; Xi8 is S or D; Xi9 is S, R, or T; X2o is W or Y; and X21 is L or V; and the CDR2 has the sequence X21ASX22LX23S, wherein X21 is D or A; X22 is S, A, or T; and X23 is E, Q, or K.
26. The antibody of claim 25, wherein the VL region V-segment has at least 90% identity to the human germline VKI L 12 segment.
27. The antibody of claim 25 or claim 26, wherein the CDRl has the sequence RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, or RASEGVDRWLA; or the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
28. The antibody of any one of claim 25, 26, or 27, wherein the CDRl has the sequence RASQGISTYLA, RASQGISSWLA, RASQSISRWVA, or RASEGVDRWLA; and the CDR2 has the sequence AASSLQS, DASSLKS, AASSLQS, DASALQS, or DASTLQS.
29. The antibody of any one of the preceding claims 1 to 23, wherein the VL region V segment has at least 80% amino acid sequence identity to the human germline VKIII L2 sequence and the CDRl has the sequence RASNSVGAYNLA or RASQSVSSNLA; and the CDR2 has the sequence (A/G)AS(T/R)RA(T/P).
30. The antibody of claim 29, wherein the VL region V-segment has at least 90% identity to the human germline VKIII L2 segment
31. The antibody of any one of the preceding claims 1 to 23, wherein the VL region V-segment has at least 80% amino acid sequence identity to a human germline Vlambda3 31 segment and the CDRl has the sequence QGDSLRS(Y/L)YAS; and the CDR2 has the sequence (G/S)KN(N/S)RPS.
32. The antibody of claim 31 , wherein the VL region V-segment has at least 90% identity to the human germline Vlambda3 31 segment.
33. The antibody of any one of the preceding claims 1 to 23, wherein the VL region V-segment has at least 80% amino acid sequence identity to a human germline Vlambda2 2c segment and the CDRl has the sequence TGTSSDVGA YNYVS or TGTSSDYVS; and the CDR2 has the sequence (E/D)VT(K/N)RPS.
34. The antibody of claim 33, wherein the VL region V-segment has at least 90% identity to the human germline Vlambda2 2c segment.
35. The antibody of any one of the preceding claims, wherein the VL region comprises the V-segment of an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.
36. The antibody of claim 35, wherein the VL region comprises an amino acid sequence selected from the group consisting of SEQ SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.
37. The antibody of any one of the preceding claims, wherein the antibody is an antagonist of the Psendomonas aeruginosa Type III secretion system.
38. The antibody of any one of the preceding claims, wherein the antibody is a Fab' fragment.
39. The antibody of any one of the preceding claims, wherein the antibody is an IgG.
40. The antibody of any one of the preceding claims, wherein the antibody is PEGylated
41. The antibody of claim 40, wherein the antibody is di-PEGylated.
42. The antibody of any one of the preceding claims, wherein the VH region or the VL region, or both the VH and VL region amino acid sequences comprise a methionine at the N-terminus.
43. An anti-PcrV antibody that is an antagonist of the Type III secretion system, comprising: a VH region having an amino acid sequence selected from the group consisting of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 26, 27, 29, and 35; and VL region having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 28, 30, 32, 34, 36, and 37.]
44. The antibody of claim 43, wherein the VH region or the VL region, or both the VH and VL regions have a methionine present at the N-terminus.
45. The antibody of claim 43, wherein the antibody is a di-PEGylated Fab'.
46. A method of treating a patient infected with P. aeruginosa, the method comprising administering an antibody of any one of the preceding claims.
47. The method of claim 46, wherein the antibody is not immunogenic in humans.
48. The method of claim 46, wherein the antibody is administered intravenously, subcutaneously or by insufflation.
PCT/US2008/085196 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa Ceased WO2009073631A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
BRPI0819598A BRPI0819598A2 (en) 2007-11-30 2008-12-01 antibodies to pseudomonas aeruginosa pcrv antigen
AU2008333985A AU2008333985B2 (en) 2007-11-30 2008-12-01 Antibodies to the PcrV antigen of pseudomonas aeruginosa
EA201000903A EA201000903A1 (en) 2007-11-30 2008-12-01 ANTITEL TO PCRV-ANTIGEN PSEUDOMONAS AERUGINOSA
NZ586357A NZ586357A (en) 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa
EP08856948A EP2220117A2 (en) 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa
CA2706732A CA2706732A1 (en) 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa
JP2010536228A JP5781765B2 (en) 2007-11-30 2008-12-01 Antibody against PcrV antigen of Pseudomonas aeruginosa
CN200880124705.7A CN101910197B (en) 2007-11-30 2008-12-01 Antibodies to the PCRV antigen of pseudomonas aeruginosa
MX2010005871A MX2010005871A (en) 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa.
IL206036A IL206036A0 (en) 2007-11-30 2010-05-27 ANTIBODIES TO THE PcrV ANTIGEN OF PSEUDOMONAS AERUGINOSA AND USES THEREOF
ZA2010/03852A ZA201003852B (en) 2007-11-30 2010-05-28 Antibodies to the pcrv of pseudomonas aeruginosa

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US99167907P 2007-11-30 2007-11-30
US60/991,679 2007-11-30

Publications (2)

Publication Number Publication Date
WO2009073631A2 true WO2009073631A2 (en) 2009-06-11
WO2009073631A3 WO2009073631A3 (en) 2009-09-24

Family

ID=40527381

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/085196 Ceased WO2009073631A2 (en) 2007-11-30 2008-12-01 Antibodies to the pcrv antigen of pseudomonas aeruginosa

Country Status (15)

Country Link
US (3) US8044181B2 (en)
EP (1) EP2220117A2 (en)
JP (1) JP5781765B2 (en)
KR (1) KR20100097719A (en)
CN (1) CN101910197B (en)
AU (1) AU2008333985B2 (en)
BR (1) BRPI0819598A2 (en)
CA (1) CA2706732A1 (en)
EA (1) EA201000903A1 (en)
IL (1) IL206036A0 (en)
MX (1) MX2010005871A (en)
NZ (1) NZ586357A (en)
SG (1) SG186017A1 (en)
WO (1) WO2009073631A2 (en)
ZA (1) ZA201003852B (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010091189A1 (en) * 2009-02-04 2010-08-12 Kalobios Pharmaceuticals, Inc. Combination antibiotic and antibody therapy for the treatment of pseudomonas aeruginosa infection
WO2010104052A1 (en) * 2009-03-11 2010-09-16 塩野義製薬株式会社 Humanized pcrv antibody having anti-pseudomonal activity
JP2013515079A (en) * 2009-12-22 2013-05-02 カロバイオス ファーマシューティカルズ インコーポレイティッド Methods for treating Staphylococcus infections in patients with low levels of pathogenic Pseudomonas aeruginosa infection
US8501179B2 (en) 2008-01-10 2013-08-06 Shionogi & Co., Ltd. Antibody against PcrV
US10072098B2 (en) 2012-03-02 2018-09-11 Ablynx N.V. Pseudomonas aeruginosa PCRV binding single variable domain antibodies
RU2687588C2 (en) * 2011-11-07 2019-05-15 МЕДИММЬЮН ЭлЭлСи Methods of combined therapy using binding materials with psl and pcrv pseudomonas

Families Citing this family (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9453251B2 (en) 2002-10-08 2016-09-27 Pfenex Inc. Expression of mammalian proteins in Pseudomonas fluorescens
EP1774017B1 (en) 2004-07-26 2013-05-15 Pfenex Inc. Process for improved protein expression by strain engineering
US9580719B2 (en) 2007-04-27 2017-02-28 Pfenex, Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
US9394571B2 (en) * 2007-04-27 2016-07-19 Pfenex Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
US8512950B2 (en) 2010-07-21 2013-08-20 Saint Louis University Biolayer interferometry measurement of biological targets
RS57024B1 (en) * 2011-06-10 2018-05-31 Medimmune Ltd Anti-pseudomonas psl binding molecules and uses thereof
JP2015535005A (en) * 2012-11-06 2015-12-07 メディミューン,エルエルシー Combination therapy with anti-Pseudomonas Psl and PcrV binding molecules
CN107922482A (en) 2015-05-01 2018-04-17 英伊布里克斯有限合伙公司 Type III excretory system targeted molecular
CN114106178A (en) 2015-07-16 2022-03-01 印希比股份有限公司 Fusion protein that binds DR5 multivalent and multispecific
EA201892525A1 (en) * 2016-05-05 2019-04-30 Дзе Трастиз Оф Дзе Юниверсити Оф Пенсильвания DNA ANTIBODY DESIGNS FOR USE AGAINST PSEUDOMONAS AERUGINOSA
EP4491718A3 (en) 2018-03-14 2025-03-26 Seattle Children's Hospital (DBA Seattle Children's Research Institute) Il-13 receptor alpha 2 targeted, zetakine directed t cell immunotherapy
EP3830124A1 (en) * 2018-08-01 2021-06-09 Cephalon, Inc. Anti-cxcr2 antibodies and uses thereof
BR112021023335A2 (en) * 2019-06-11 2022-01-04 Regeneron Pharma Isolated recombinant or antigen-binding fragment thereof and isolated monoclonal or antigen-binding fragment thereof, pharmaceutical composition, isolated polynucleotide molecule, vector, cell, method of decreasing the risk of acquiring p. aeruginosa, and methods of decreasing the bacterial load in a subject with a p. aeruginosa, of increasing survival or the probability of survival of a subject suffering from p. aeruginosa or a subject at risk of infection with p. aeruginosa, to improve or reduce the severity, duration, or frequency of occurrence of at least one symptom of a p. aeruginosa, to increase survival or the likelihood of survival of a subject suffering from cystic fibrosis
WO2021244421A1 (en) * 2020-06-01 2021-12-09 Staidson (Beijing) Biopharmaceuticals Co., Ltd. Antibodies specifically recognizing pseudomonas pcrv and uses thereof

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US225552A (en) * 1880-03-16 Disintegrating-mill
US108565A (en) * 1870-10-25 Improvement in snow-plows
US134098A (en) * 1872-12-17 Improvement in gage-cocks
GB8720833D0 (en) 1987-09-04 1987-10-14 Celltech Ltd Recombinant dna product
US5219998A (en) * 1990-06-04 1993-06-15 Levin Robert H Yeast-derived epidermal growth factor
GB9012995D0 (en) 1990-06-11 1990-08-01 Celltech Ltd Multivalent antigen-binding proteins
EP0938506B1 (en) 1996-07-16 2003-11-05 Plückthun, Andreas, Prof. Dr. Immunoglobulin superfamily domains and fragments with increased solubility
US7141393B2 (en) 1996-12-26 2006-11-28 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Interleukin-18-receptor proteins
CA2318536C (en) 1998-11-25 2009-11-17 Mcw Research Foundation, Inc. Method of and compositions for immunization with the pseudomonas v antigen
DE19918418C1 (en) * 1999-04-23 2000-10-19 Siegfried Mueller Flower box for balconies etc has side holder arms locked in place at the opposite side walls by bolts and the inserted plant basket for mechanical stability with resistance to storms and safety against theft
AU2001238677A1 (en) 2000-02-28 2001-09-12 Idec Pharmaceuticals Corporation Method for preparing anti-mif antibodies
EP1353688B1 (en) * 2001-01-26 2006-12-06 MCW Research Foundation, Inc. Method and compositions for immunization with the pseudomonas v antigen
CA2374027A1 (en) 2001-03-13 2002-09-13 The Minister Of National Defence Cloning, expression, sequencing, and functional enhancement of monoclonal scfv antibody against venezuelan equine encephalitis virus(vee)
EP1479695B1 (en) * 2003-05-14 2010-02-17 Kenta Biotech AG Human monoclonal antibody specific for lipopolysaccharides (LPS) of serotype IATS O6 of Pseudomonas aeruginosa
JP4782700B2 (en) 2004-01-20 2011-09-28 カロバイオス ファーマシューティカルズ インコーポレイティッド Transfer of antibody specificity using minimally required binding determinants
EP2343380B1 (en) * 2004-11-16 2019-06-12 Humanigen, Inc. Immunoglobulin variable region cassette exchange
EP1915394B1 (en) 2005-05-20 2021-01-27 Lonza Biologics plc. High-level expression of recombinant antibody in a mammalian host cell
EP1726650A1 (en) 2005-05-27 2006-11-29 Universitätsklinikum Freiburg Monoclonal antibodies and single chain antibody fragments against cell-surface prostate specific membrane antigen
US20090317329A2 (en) 2005-07-05 2009-12-24 Baker Idi Heart & Diabetes Institute Holdings Limited Anticoagulation agent and uses thereof
EP1987066B1 (en) 2006-02-22 2010-12-29 University of Zürich Methods for treating demyelinating diseases
SG158112A1 (en) 2006-06-02 2010-01-29 Aveo Pharmaceuticals Inc Hepatocyte growth factor (hgf) binding proteins
EP2044123B1 (en) 2006-06-21 2013-03-13 Oncotherapy Science, Inc. Tumor-targeting monoclonal antibodies to fzd10 and uses thereof

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8501179B2 (en) 2008-01-10 2013-08-06 Shionogi & Co., Ltd. Antibody against PcrV
WO2010091189A1 (en) * 2009-02-04 2010-08-12 Kalobios Pharmaceuticals, Inc. Combination antibiotic and antibody therapy for the treatment of pseudomonas aeruginosa infection
WO2010104052A1 (en) * 2009-03-11 2010-09-16 塩野義製薬株式会社 Humanized pcrv antibody having anti-pseudomonal activity
EA021101B1 (en) * 2009-03-11 2015-04-30 Шионоги Энд Ко., Лтд. HUMANIZED PcrV ANTIBODY HAVING ANTI-PSEUDOMONAL ACTIVITY
US9085611B2 (en) 2009-03-11 2015-07-21 Shionogi & Co., Ltd. Humanized PcrV antibody having anti-pseudomonal activity
JP2013515079A (en) * 2009-12-22 2013-05-02 カロバイオス ファーマシューティカルズ インコーポレイティッド Methods for treating Staphylococcus infections in patients with low levels of pathogenic Pseudomonas aeruginosa infection
US8642039B2 (en) 2009-12-22 2014-02-04 Kalobios Pharmaceuticals, Inc. Method of treating a staphylococcus infection in a patient having a low-level pathogenic Pseudomonas aeruginosa infection
RU2687588C2 (en) * 2011-11-07 2019-05-15 МЕДИММЬЮН ЭлЭлСи Methods of combined therapy using binding materials with psl and pcrv pseudomonas
US10072098B2 (en) 2012-03-02 2018-09-11 Ablynx N.V. Pseudomonas aeruginosa PCRV binding single variable domain antibodies
US11312788B2 (en) 2012-03-02 2022-04-26 Ablynx N.V. Pseudomonas aeruginosa PcrV binding single variable domain antibodies

Also Published As

Publication number Publication date
US20090191186A1 (en) 2009-07-30
KR20100097719A (en) 2010-09-03
CN101910197A (en) 2010-12-08
IL206036A0 (en) 2010-11-30
JP2011505381A (en) 2011-02-24
BRPI0819598A2 (en) 2017-05-09
MX2010005871A (en) 2010-06-09
ZA201003852B (en) 2014-11-26
SG186017A1 (en) 2012-12-28
NZ586357A (en) 2012-10-26
US8877191B2 (en) 2014-11-04
US8044181B2 (en) 2011-10-25
EP2220117A2 (en) 2010-08-25
CA2706732A1 (en) 2009-06-11
AU2008333985A1 (en) 2009-06-11
JP5781765B2 (en) 2015-09-24
US20150030614A1 (en) 2015-01-29
US20120020986A1 (en) 2012-01-26
AU2008333985B2 (en) 2015-02-05
EA201000903A1 (en) 2011-02-28
CN101910197B (en) 2014-09-24
WO2009073631A3 (en) 2009-09-24

Similar Documents

Publication Publication Date Title
AU2008333985B2 (en) Antibodies to the PcrV antigen of pseudomonas aeruginosa
US12428473B2 (en) Combination therapies using anti-pseudomonas PSL and PCRV binding molecules
JP2011505381A5 (en)
US8653242B2 (en) Therapeutic antibodies against flagellated Pseudomonas aeruginosa
AU2017204447B2 (en) Anti-pseudomonas psl binding molecules and uses thereof
US20150284450A1 (en) Combination therapies using anti-pseudomonas psl and pcrv binding molecules
US20100272736A1 (en) Combination antibiotic and antibody therapy for the treatment of pseudomonas aeruginosa infection
HK40131736A (en) Methods for treating multidrug resistant bacterial infections
HK1201453B (en) Combination therapies using anti- pseudomonas psl and pcrv binding molecules

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880124705.7

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08856948

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2008333985

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2706732

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 206036

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2010536228

Country of ref document: JP

Ref document number: MX/A/2010/005871

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2008333985

Country of ref document: AU

Date of ref document: 20081201

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 586357

Country of ref document: NZ

REEP Request for entry into the european phase

Ref document number: 2008856948

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2008856948

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20107014345

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201000903

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 4733/DELNP/2010

Country of ref document: IN

ENP Entry into the national phase

Ref document number: PI0819598

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20100527