WO2008094538A2 - Regulatory t cell epitopes, compositions and uses thereof - Google Patents
Regulatory t cell epitopes, compositions and uses thereof Download PDFInfo
- Publication number
- WO2008094538A2 WO2008094538A2 PCT/US2008/001148 US2008001148W WO2008094538A2 WO 2008094538 A2 WO2008094538 A2 WO 2008094538A2 US 2008001148 W US2008001148 W US 2008001148W WO 2008094538 A2 WO2008094538 A2 WO 2008094538A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- tregitope
- regulatory
- cell
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/08—Antiepileptics; Anticonvulsants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/745—Blood coagulation or fibrinolysis factors
- C07K14/75—Fibrinogen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/79—Transferrins, e.g. lactoferrins, ovotransferrins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0637—Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/50—Cell markers; Cell surface determinants
Definitions
- the invention relates generally to a novel class of T cell epitope compositions (termed “Tregitopes”).
- the invention provides Tregitope compositions, methods for their preparation and use.
- T Reg 'natural' regulatory T cells
- a second form of tolerance occurs in the periphery where mature T cells are converted to an 'adaptive' T Reg phenotype upon activation via their T cell receptor in the presence of IL-10 and TGF-/?.
- the possible roles for these 'adaptive' T Reg cells include dampening immune response following the successful clearance of an invading pathogen as a means of controlling excessive inflammation as might be caused by an allergic reaction or low level chronic infection, or possibly to facilitate co-existence with beneficial symbiotic bacteria and viruses.
- 'Adaptive' T Reg may also play a role in managing the life cycle of human antibodies that have undergone somatic hypermutation. Natural regulatory T cells are a critical component of immune regulation in the periphery.
- Tregs Upon activation through their TCR natural Tregs are capable of suppressing bystander effector T cell responses to unrelated antigens through contact dependent and independent mechanisms.
- the cytokines 5 released by these cells including IL-10 and TGF- ⁇ are capable of inducing antigen- specific adaptive Tregs.
- the antigen specificity of natural Tregs, and more importantly natural Tregs circulating in clinically significant volumes is still unknown.
- regulatory T cell epitopes 10 contained in common autologous proteins such as IgG ("Tregitopes") and for methods for related to their preparation and of use.
- the present invention harnesses the functions of regulatory T cells (T Reg ), particularly those cells that already regulate immune responses to foreign and self
- the invention provides T-cell epitope polypeptide compositions.
- GVHD Graft vs. Host disease
- Allergic reactions Immune rejection of biologic medicines such as monoclonal antibodies, replacement proteins such as FVIII or Insulin, the use of therapeutic toxins such as
- the present invention is directed to a T-cell epitope polypeptide composition comprising at least one polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is
- composition 30 directed to a pharmaceutical composition
- a pharmaceutical composition comprising a polypeptide of the invention and a pharmaceutically acceptable carrier.
- the present invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the invention is directed to a nucleic acid encoding at least one T-cell epitope polypeptide selected from
- BOST 299675.1 vector comprising a nucleic acid of the invention.
- the invention is directed to a cell comprising a vector of the invention.
- the invention is directed to a method of treating or preventing a medical condition in a subject in need thereof comprising 5 administering a therapeutically effective amount of a T-cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the medical condition is selected from the group consisting of: an allergy, an autoimmune disease, a transplant related disorder, graft versus host disease, an enzyme or protein deficiency disorder, a hemostatic disorder, cancer,
- the invention is directed to a kit for preventing or treating a medical condition in a subject, wherein the kit comprises at least one T- cell epitope polypeptide selected from the group consisting of: SEQ ID NOS:4-58.
- the present invention is directed to a method for
- the present invention is directed to a method for stimulating regulatory T cells in a biological sample, comprising: (a) providing a biological sample from a subject; (b) isolating regulatory T-cells from the biological sample; and contacting the isolated regulatory T-cells with an effective amount of a
- Tregitope composition of the invention under conditions wherein the T-regulatory cells are stimulated to alter one or more biological function, thereby stimulating the regulatory T-cells in the biological sample.
- the present invention is directed to a method for repressing immune response in a subject, comprising administering a composition
- the peptide suppresses effector T cell response.
- the peptide suppresses helper T cell response.
- the peptide suppresses B cell response.
- the present invention is directed to a method of suppressing antigen specific immune response in a subject through the administration of a therapeutically effective amount of a composition comprising one or more Tregitopes, wherein the one or more Tregitopes are either covalently 5 bound, non-covalently bound or in admixture with a specific target antigen resulting in the diminution of immune response against the target antigen.
- the suppressive effect is mediated by natural Treg.
- the suppressive effect is mediated by adaptive Treg.
- the peptide suppresses effector T cell response.
- the peptide suppresses helper T cell response. In another embodiment, the peptide suppresses B cell response. In a particular embodiment, the peptide comprises a sequence selected from the group consisting of: SEQ ID NOS:4-58.
- the present invention is directed to a method for
- the T cell epitopes are selected from the group consisting of: SEQ ID NOS:4-58.
- FIG. 1 is a schematic diagram of immunoglobulin G (IgG).
- FIG. 2 is a series of graphical representations comparing capped and uncapped peptides.
- PBMC were stimulated in culture for 8 days with either CEF (positive control peptide pool) alone (top panels), CEF + Tregitope 289-amide (middle panels), or CEF + Tregitope-289-uncapped (bottom panels).
- CEF positive control peptide pool
- CEF + Tregitope 289-amide top panels
- CEF + Tregitope-289-amide bottom panels
- FIG. 3 shows activation of natural Tregs in the presence of Tregitope.
- Tregitope Human PBMCs were stimulated directly in vitro for four days in the presence of tetanus toxin peptide (TT 830 - S44 ), Tregitope or no stimulus. Cells were stained extracellularly with anti-CD4 and anti-CD25 and then intracellular ⁇ with FoxP3, and analyzed by flow cytometry. Incubation with Tregitope increased the percentage of
- FIG. 4 is a series of bar graphs showing Tregitope induces an up-regulation of T-regulatory cytokines and chemokines and down-regulation of T-effector 5 cytokines and chemokines.
- FIG. 5 is a series of bar graphs showing responses to C3d peptide restimulation following initial stimulation with a) a pool of immunogenic peptides derived from C3d protein (black bars) or b) C3d peptides + Tregitope-289 (light grey).
- FIG. 6 is a bar graph showing co-stimulation with epitopes derived from TSHR, the target antigen of Graves' disease, suppresses immune response to the
- PBMC from a patient with Graves' disease 20 epitopes in PBMC from a patient with Graves' disease.
- PBMC from a patient with Graves' disease were first incubated for 8 days with either 1 ) a pool of TSHR peptides alone or 2) a pool of TSHR peptides and a pool of Tregitope-134, Tregitope-167, and Tregitope-289. Cells were then harvested, washed and incubated (in IL-4 ELISpot plates as described) with 1 ) individual TSHR peptides
- FIG. 7 is a bar graph showing average response of three subjects in response to a commercially available pool of positive control peptides (CEF)
- FIG. 8 is a bar graph showing co-incubation with Tregitope suppresses immune response to peptide epitopes derived from Botulinum neurotoxin. Peripheral blood was drawn from a subject with evidence of anti-BoNT/A
- PBMC peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- Tregitope-134, Tregitope-167, and Tregitope-289 a pool of Tregitopes
- Cells were then harvested, washed and then incubated (in IFN- ⁇ ELISpot plates) with BoNT/A peptides individually in triplicate and in a pool in triplicate. Responses are shown relative to re-stimulation with no
- FIG. 9 is a series of graphs showing Tregitope-289 and Tregitope-134
- PBMCs were isolated from a blood bank donor and stimulated for eight days with CEF alone, CEF + Tregitope-134 or CEF + Tregitope-289. Co- incubation with either of the two Tregitopes lead to a decrease in response to CEF as measured by IFN- ⁇ ELISA (left panel) and to a decrease in proliferation as
- FIG. 10 is a plot showing response to vaccinia peptide.
- PBMCs were isolated from a blood bank donor and stimulated for eight days with CEF alone,
- FIG. 11 is a series of graphs showing Tregitope suppression is mediated by cells with a regulatory phenotype. Tregitope suppression is dependent on CD4+ CD25Hi T cells.
- Left panel PBMC from allergic individuals were stained with anti- CD4 and anti-CD25 antibodies and analyzed by flow cytometry. The CD4+CD25Hi 5 subset (gate) was depleted from the remaining PBMC.
- Center panel CD4+CD25Hi depleted and non-depleted PBMC were co-stimulated HDM lysate with or without Tregitope-289.
- CD4+CD25Hi depleted PBMC were less able to suppress IFN- ⁇ than non-depleted PBMC.
- Right panel co-incubation of HDM lysate and Tregitope-289 leads to decreased proliferation of CD4+ cells in response to HDM
- FIG. 12 is a plot and graph showing expansion of TReg (CD4/CD25 Hi) correlates with IL-10 secretion.
- TReg CD4/CD25 Hi
- Tregitope-167 15 incubation with Tregitope-167 are similar: increase from 1.67% to 7.5% CD4/CD25N cells and a five-fold increase in IL-10 secretion.
- FIG. 13 is a series of graphs and plots showing Tregitope co-incubation causes suppression of antigen-specific allergic Th2 response.
- Co-culture with Tregitope and Bet v 1 141-155 allergen causes a shift from Th2 effector to Th1/T Reg .
- FIG. 14 is a graph showing Tregitope co-administration causes suppression of effector responses to co-administered protein therapeutic in vivo.
- ANTIGEN-XX see Example 5A
- immunization alone black bars
- provokes a robust response by both IL-4 left bars in pair, left axis
- anti-ANTIGEN-XX antibody titers right bars
- FIG. 15 is a graph showing IL-4 and antibody responses to house mite lysate (HDML) and dust mite antigen.
- HDML immunization black bars
- IL-4 Left bars in pair, left axis
- anti HDM Antigen antibody titers Light bars in each pair, right axis
- These responses are both 5 halved (grey bars) when HDML is co-administered with the murine homologue of Tregitope-289.
- Responses to HDML in sham-immunized animals are negative as expected.
- Responses by Antibody (right bars in pair) and IL-4 ELISpot left bars in pair) are correlated.
- These graphs show 38% suppression in vivo in DM naive mice and 84% percent in the case of pre-sensitized mice. See Example 5B.
- FIG. 16 is a bar graph showing in vivo suppression of T effector response to immunogenic peptide therapeutic ("IPT") by Tregitope co-administration.
- IPT immunogenic peptide therapeutic
- the adaptive immune cascade begins when soluble protein antigens are taken up by Antigen Presenting Cells (APCs) and processed through the Class Il antigen presentation pathway. Protein antigens in the Class Il presentation pathway are degraded by various proteases found in the Endoplasmic Reticulum. Some of the resulting protein fragments are bound to Class Il MHC molecules.
- APCs Antigen Presenting Cells
- Peptide-loaded MHC molecules are trafficked to the cell surface where they are interrogated by CD4+ T cells.
- Peptide fragments that are capable of binding to an MHC molecule and mediating the cell to cell interaction between APC and circulating T cells are referred to as T cell epitopes. Recognition of these peptide- MHC complexes by CD4+ T cells can lead to either an immune activating or
- TCR T cell receptor
- TReg natural T regulatory cells
- Tregitopes T 5 cell epitopes that are capable of binding to MHC molecules and engaging and activating circulating Treg are referred to as Tregitopes.
- TReg natural regulatory T cells
- T regulatory immune responses counterbalance T effector immune response to protein antigens (whether self or foreign).
- a tilt of the balance toward the autoreactive side either by increasing the number or function of autoreactive T effector cells or by diminishing the number or function of T regulatory
- a second form of tolerance occurs in the periphery where mature T cells are converted to an 'adaptive' TReg phenotype upon activation via their T cell receptor in the presence of IL-10 and TGF- ⁇ , usually supplied by bystander T regulatory cells.
- the possible roles for these 'adaptive' TReg cells include dampening
- BOST 299675.1 comprising an Fc portion of an immunoglobulin bestow several desirable properties on a chimeric protein including increased stability, increased serum half life, binding to Fc receptors, and reduced immunogenicity (Lei, T. et a/., Cell. Immunol., 235:12- 20, 2005, Baxevanis, C. et al., Eur. J. Immunol., 16:1013-1016, 1986).
- 5 TReg cells are also instrumental in B cell tolerance.
- B cells express a single low affinity Fc receptor, FcyRIIB on their cell surface (Ravetch, J. et a/., Science, 234:718-725, 1986). This receptor contains the immunoreceptor tyrosine-based inhibition motif sequence (ITIM) in its cytoplasmic domain. Co-ligation of FCyRIIB and the BCR by immune complexes act to trigger the tyrosine phosphorylation of
- Tregitope specific TReg cells it is possible to exploit Tregitope specific TReg cells to suppress unwanted immune responses and to induce adaptive TReg to co-delivered proteins. This discovery has implications for the design of therapeutic regimens and antigen-specific therapies for transplantation, protein therapeutics, allergy, chronic infection,
- Tregitope 25 autoimmunity and vaccine design.
- Administration of a drug, a protein, or an allergen in conjunction with Tregitope can suppress effector immune response.
- Tregitope can be used to deliberately manipulate the immune system toward tolerance.
- the peptides of the current invention are useful in the selective engagement
- cytokines and chemokines help to suppress autoimmune responses that would otherwise hinder the function of the extra cellular proteins.
- systemic application of the peptides of the invention can be used as a generalized immune suppressant useful for controlling severe autoimmune reactions such as, for example, MS flare-ups, allergic reactions, transplant reactions, or uncontrolled response to infection.
- severe autoimmune reactions such as, for example, MS flare-ups, allergic reactions, transplant reactions, or uncontrolled response to infection.
- topically applied to joints In a more controlled application, topically applied to joints
- the peptide of the invention can be used to suppress localized autoimmune responses.
- the peptides can suppress highly specific immune reactions while leaving the balance of the immune system intact. For example, through the
- the immune system can be trained to "tolerate" the co-delivered antigen by converting the phenotype of responding effector T cells to that of adaptive regulatory T cells.
- T cell epitopes i.e., capable of binding to both MHC molecules and TCRs
- T cell epitope clusters epitopes capable of binding to multiple MHC alleles and multiple TCRs, are key to satisfying this latter
- biological sample refers to any sample of 5 tissue, cells or secretions from an organism.
- transplantation refers to the process of taking a cell, tissue, or organ, called a “transplant” or “graft” from one subject and placing it or them into a (usually) different subject .
- the subject who provides the transplant is called the “donor”, and the subject who received the transplant is called the 10 "recipient”.
- An organ or graft transplanted between two genetically different subjects of the same species is called an “allograft”.
- a graft transplanted between subjects of different species is called a "xenograft”.
- medical condition includes, but is not limited to, any condition or disease manifested as one or more physical and/or psychological 15 symptoms for which treatment and/or prevention is desirable, and includes previously and newly identified diseases and other disorders.
- the term "immune response” refers to the concerted action of lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including 20 antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of cancerous cells, metastatic tumor cells, malignant melanoma, invading pathogens, cells or tissues infected with pathogens, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- the term "effective amount" of a composition is a quantity sufficient to achieve a desired therapeutic and/or prophylactic effect, e.g., an amount that results in the prevention of, or a decrease in, the symptoms associated with a disease that is being treated.
- the amount of a composition of the invention administered to the subject will depend on the type and severity of the disease and 30 on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It will also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
- the compositions of the present invention can also be administered in combination with each other or with one or more 35 additional therapeutic compounds.
- T cell epitope means a protein determinant, 7 to 30 amino acids in length, and capable of specific binding to HLA molecules and interacting with specific TCRs. Generally, T cell epitopes are linear and do not express specific three dimensional characteristics. T cell epitopes are not affected 5 by the presence of denaturing solvents.
- B cell epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as 10 specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- subject refers to any living organism in which an immune response is elicited.
- subject includes, but is not limited to, 15 humans, nonhuman primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs, and the like.
- the term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or 20 female, are intended to be covered.
- MHC complex refers to a protein complex capable of binding with a specific repertoire of polypeptides known as HLA ligands and transporting said ligands to the cell surface.
- MHC Ligand means a polypeptide capable of 25 binding to one or more specific MHC alleles.
- HLA ligand is interchangeable with the term MHC Ligand.
- Cells expressing MHC/Ligand complexes on their surface are referred to as "Antigen Presenting Cells” (APCs).
- T Cell Receptor or TCR refers to a protein complex expressed by T cells that is capable of engaging a specific repertoire of 30 MHC/Ligand complexes as presented on the surface of APCs.
- T cell epitope means an MHC ligand capable of interacting with specific T cell receptors (TCRs).
- T cell epitopes can be predicted by in silico methods (De Groot, A. et al., AIDS Res. Hum. Retroviruses, 13:539-541 , 1997; Schafer, J. et al., Vaccine, 16:1880-1884, 1998; De Groot, A. et al., Vaccine, 35 19:4385-95, 2001 ; De Groot, A. et al., Vaccine, 21 :4486-504, 2003).
- MHC Binding Motif refers to a pattern of amino acids in a protein sequence that predicts binding to a particular MHC allele.
- T-cell epitope cluster refers to polypeptide that contains between about 4 to about 40 MHC binding motifs. In particular 5 embodiments, the T-cell epitope cluster contains between about 5 to about 35 MHC binding motifs, between about 8 and about 30 MHC binding motifs; and between about 10 and 20 MHC binding motifs.
- EpiBar refers to a single 9-mer frame that is predicted to be reactive to at least four different HLA alleles. Sequences of known 10 immunogens that contain EpiBars include Influenza Hemagglutinin 307-319, Tetanus Toxin 825-850, and GAD65 557-567. An example of an immunogenic peptide that contains an EpiBar is shown below.
- Z score indicates the potential of a 9-mer frame to bind to a given HLA allele the strength of the score is indicated by the blue shading as shown below I Cluster Regions Outlined " " ⁇ g ⁇ ⁇ Z scores in top 5% ⁇ Z scores in top 10%' remaining scores masked"
- Example of an EpiBar EpiMatrix analysis of a promiscuous influenza epitope.
- influenza HA peptide an epitope known to be promiscuously immunogenic. It scores extremely high for all eight alleles in EpiMatrix. Its cluster score is 18. Cluster scores higher than 10 are considered to be significant.
- the 20 band-like EpiBar pattern is characteristic of promiscuous epitopes. Results are shown for PRYVKQNTL (SEQ ID NO:59), RYVKQNTLK (SEQ ID NO:60), YVKQNTLKL (SEQ ID NO:61 ), VKQNTLKLA (SEQ ID NO:62) and KQNTLKLAT (SEQ ID NO:63).
- Immunose means the protein complex formed by the simultaneous engagement of a given T cell Epitope to both a cell surface MHC complex and TCR.
- regulatory T cell means a subset of naturally occurring T cells characterized by the presence of certain cell surface markers 30 including but not limited to CD4, CD25, and FoxP3.
- regulatory T cells secrete immune suppressive cytokines and chemokines including but not limited to IL-10, TGF- ⁇ and TNF- ⁇ .
- polypeptide refers to a polymer of amino acids, and not to a specific length; thus, peptides, oligopeptides and proteins are included within the definition of a polypeptide.
- a polypeptide is said to be “isolated” or “purified” when it is substantially free of cellular material when it is isolated from 5 recombinant and non-recombinant cells, or free of chemical precursors or other Chemicals when it is chemically synthesized.
- a polypeptide can be joined to another polypeptide with which it is not normally associated in a cell and still be “isolated” or “purified.”
- a polypeptide when recombinantly produced, it can also be substantially free of culture medium, for example, culture medium
- 10 represents less than about 20%, less than about 10%, or less than about 5% of the volume of the polypeptide preparation.
- a variant polypeptide can differ in amino acid sequence by one or more substitutions, deletions, insertions, inversions, fusions, and truncations or a combination of any of these.
- the invention also includes polypeptide fragments of the polypeptides of the invention.
- the invention also encompasses fragments of the variants of the polypeptides described herein.
- the invention also provides chimeric or fusion polypeptides. These comprise a polypeptide of the invention operatively linked to a heterologous protein or polypeptide having an amino acid sequence not
- the isolated polypeptide can be purified from cells that naturally express it, purified from cells that have been altered to express it (recombinant), or synthesized using known protein synthesis methods.
- the isolated polypeptide can be purified from cells that naturally express it, purified from cells that have been altered to express it (recombinant), or synthesized using known protein synthesis methods.
- the isolated polypeptide can be purified from cells that naturally express it, purified from cells that have been altered to express it (recombinant), or synthesized using known protein synthesis methods.
- the isolated polypeptide can be purified from cells that naturally express it, purified from cells that have been altered to express it (recombinant), or synthesized using known protein synthesis methods.
- polypeptide is produced by recombinant DNA techniques. For example, a nucleic acid molecule encoding the polypeptide is cloned into an expression vector, the expression vector introduced into a host cell and the polypeptide expressed in the host cell. The polypeptide can then be isolated from the cells by an appropriate purification scheme using standard protein purification techniques.
- polypeptides can include, for example, modified forms of naturally occurring amino acids such as D- stereoisomers, non-naturally occurring amino acids; amino acid analogs; and mimetics.
- compositions in one aspect, provides a novel class of T cell epitopes
- Tregitopes' which comprise a peptide or polypeptide chain with one or more defined characteristics listed below. That is, the Tregitopes of the invention include, but are not limited to, possessing one or more of the following characteristics: (1 ) Tregitopes of the invention are derived from common human proteins.
- Tregitopes of the invention are highly conserved among known variants of their source proteins (e.g., present in more than 50% of known variants).
- Tregitopes of the invention comprise at least one putative T cell epitope as identified by EpiMatrix analysis.
- EpiMatrix is a proprietary computer algorithm developed by EpiVax, which is used to screen protein sequences for the presence
- Input sequences are parsed into overlapping 9-mer frames where each frame overlaps the last by 8 amino acids.
- Each of the resulting frames is then scored for predicted binding affinity with respect to a panel of eight common Class Il HLA alleles (DRB1 * 0101 , DRB1 * 0301 , DRB1 * 0401 , DRB1 * 0701 , DRB1 * 0801 , DRB1 * 1101 , DRB1 * 1301 , and DRB1 * 1501 ).
- Raw scores are
- the Tregitopes of the invention contain several putative T cell epitopes forming a pattern known as a T cell epitope cluster.
- Putative T-cell epitopes are not randomly distributed throughout protein sequences but instead tend to "cluster" in specific regions.
- peptides containing 5 clusters of putative T cell epitopes are more likely to test positive in validating in vitro and in vivo assays.
- the results of the initial EpiMatrix analysis are further screened for the presence of putative T cell epitope "clusters" using a second proprietary algorithm known as Clustimer.
- the Clustimer algorithm identifies sub- regions contained within any given amino acid sequence that contains a statistically
- T-cell epitopes 10 unusually high number of putative T cell epitopes.
- Typical T-cell epitope “clusters” range from about 9 to roughly 30 amino acids in length and, considering their affinity to multiple alleles and across multiple 9-mer frames, can contain anywhere from about 4 to about 40 putative T cell epitopes.
- For each epitope cluster identified an aggregate EpiMatrix score is calculated by summing the scores of the
- EpiBar is a single 9-mer frame that is predicted to be reactive to at least four different HLA alleles. Sequences that contain EpiBars include Influenza Hemagglutinin 307-319 (Cluster score of 18), Tetanus Toxin 825-850 (Cluster score of 16), and GAD65 557-567 (Cluster score of 19).
- the peptides of the invention can comprise oen or more EpiBars.
- Tregitopes of the invention bind to at least one and preferably two or more common HLA class Il molecules with at least a moderate affinity (e.g., ⁇ 200 ⁇ M IC 50 in HLA binding assays based on soluble HLA molecules).
- Tregitopes of the invention are capable of being presented at the cell surface by APCs in the context of at least one and, in a preferred embodiment, two or more
- the Tregitope-HLA complex can be recognized by pre-existing populations of regulatory T cells having TCRs that are specific for the Tregitope-HLA complex and circulating in normal control subjects.
- the recognition of the Tregitope-HLA complex can cause the matching regulatory T cell to be
- Stimulating regulatory T cells with Tregitope(s) of the invention results in increased secretion of one or more of the following cytokines and chemokines: IL-10, TGF-/?, TNF- ⁇ and MCP1. This increased secretion of regulatory cytokines and chemokines is a hallmark of regulatory T cells.
- Regulatory T cells activated by the Tregitope(s) of the invention express a CD4+CD25+FOXP3 phenotype.
- Tregitope(s) directly suppress T-effector immune responses ex vivo as measured by decreased antigen-specific Th1- or Th2-associated cytokine levels, principally INF- ⁇ , IL-4, and IL-5, and by decreased
- Tregitope(s) directly suppress T effector immune responses in vivo as measured by decreased antigen-specific TM- or Th2- associated cytokine levels (as measured by Elisa assay), decreased antigen- specific T effector cell levels (as measured by EliSpot assay) and decreased
- Tregitopes of the invention are useful for regulating immune response to monoclonal antibodies, protein therapeutics, self antigens promoting autoimmune response, allergens, transplanted tissues and in other applications where tolerance is the desired outcome.
- Select embodiments of the Tregitopes of the invention are
- the Tregitope of the invention is a T cell epitope isolated as decribed in Table 2.
- the Tregitopes of Table 2 (SEQ ID NOs: 4 through 58) can bind MHC class Il molecules, engage TCR in context of MHC class Il molecules and activate natural regulatory T cells.
- polypeptides of the invention can be purified to homogeneity or partially purified. It is understood, however, that preparations in which the polypeptide is not purified to homogeneity are useful. The critical feature is that the preparation allows for the desired function of the polypeptide, even in the presence of considerable amounts of other components. Thus, the invention encompasses
- g cellular material includes preparations of the polypeptide having less than about 30% (by dry weight) other proteins (e.g., contaminating protein), less than about 20% other proteins, less than about 10% other proteins, or less than about 5% other proteins.
- other proteins e.g., contaminating protein
- a polypeptide when recombinant ⁇ produced, it can also be substantially free of culture medium, for example, culture medium represents less than about 20%, less than about 10%, or less than about 5% of the volume of the polypeptide preparation.
- culture medium represents less than about 20%, less than about 10%, or less than about 5% of the volume of the polypeptide preparation.
- chemical precursors or other chemicals that are involved in its synthesis.
- the language “substantially free of chemical precursors or other chemicals” can include, for example, preparations of the polypeptide having less than about 30% (by dry weight) chemical precursors or other chemicals, less than about 20% chemical precursors or other chemicals, less than about 10% chemical precursors or other
- two polypeptides are substantially homologous or identical when the amino acid sequences are at least about 45-55%, typically at least about 70-75%, more typically at least about 80- 85%, and more typically greater than about 90% or more homologous or identical.
- sequences are aligned for optimal comparison purposes ⁇ e.g., gaps can be introduced in the sequence of one polypeptide or nucleic acid molecule for optimal alignment with the other polypeptide or nucleic acid molecule).
- gaps can be introduced in the sequence of one polypeptide or nucleic acid molecule for optimal alignment with the other polypeptide or nucleic acid molecule.
- amino acid or nucleic acid “homology” is equivalent to amino acid or nucleic acid “identity”. The percent homology between
- the two sequences is a function of the number of identical positions shared by the sequences (e.g., percent homology equals the number of identical positions/total number of positions * 100).
- the invention also encompasses polypeptides having a lower degree of identity but having sufficient similarity so as to perform one or more of the same
- 35 functions performed by a polypeptide encoded by a nucleic acid molecule of the
- g invention Similarity is determined by conserved amino acid substitution. Such substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of like characteristics. Conservative substitutions are likely to be phenotypically silent. Typically seen as conservative substitutions are the 5 replacements, one for another, among the aliphatic amino acids Ala, VaI, Leu and lie; interchange of the hydroxyl residues Ser and Thr, exchange of the acidic residues Asp and GIu, substitution between the amide residues Asn and GIn, exchange of the basic residues Lys and Arg and replacements among the aromatic residues Phe and Tyr. Guidance concerning which amino acid changes are likely 10 to be phenotypically silent are found, for example, in Bowie, J. et a/., Science, 247:1306-1310, 1990.
- a variant polypeptide can differ in amino acid sequence by one or more substitutions, deletions, insertions, inversions, fusions, and truncations or a combination of any of these.
- Variant polypeptides can be fully functional or can 15 lack function in one or more activities.
- Fully functional variants typically contain only conservative variation or variation in non-critical residues or in non-critical regions.
- Functional variants can also contain substitution of similar amino acids that result in no change or an insignificant change in function. Alternatively, such substitutions can positively or negatively affect function to some degree.
- Non- 20 functional variants typically contain one or more non-conservative amino acid substitutions, deletions, insertions, inversions, or truncation or a substitution, insertion, inversion, or deletion in a critical residue or critical region.
- variant polypeptides are included in Table 2.
- the invention also includes polypeptide fragments of the polypeptides of the 25 invention.
- the invention also encompasses fragments of the variants of the polypeptides described herein.
- a fragment comprises at least about five contiguous amino acids.
- Useful fragments include those that retain one or more of the biological activities of the polypeptide as well as fragments that can be used as an immunogen to generate polypeptide-specific antibodies.
- Biologically 30 active fragments are, for example, about 6, 9, 12, 15, 16, 20 or 30 or more amino acids in length. Fragments can be discrete (not fused to other amino acids or polypeptides) or can be within a larger polypeptide. Several fragments can be comprised within a single larger polypeptide. In one embodiment a fragment designed for expression in a host can have heterologous pre- and pro-polypeptide
- BOST_299675.1 20 regions fused to the amino terminus of the polypeptide fragment and an additional region fused to the carboxyl terminus of the fragment.
- the invention also provides chimeric or fusion polypeptides. These comprise a polypeptide of the invention operatively linked to a heterologous protein 5 or polypeptide having an amino acid sequence not substantially homologous to the polypeptide. "Operatively linked" indicates that the polypeptide and the heterologous protein are fused in-frame.
- the heterologous protein can be fused to the N-terminus or C-terminus of the polypeptide.
- the fusion polypeptide does not affect function of the polypeptide per se. For example, the
- fusion polypeptide can be a GST-fusion polypeptide in which the polypeptide sequences are fused to the C-terminus of the GST sequences.
- Other types of fusion polypeptides include, but are not limited to, enzymatic fusion polypeptides, for example beta-galactosidase fusions, yeast two-hybrid GAL fusions, poly-His fusions and Ig fusions.
- affinity tag fusions can facilitate the purification of recombinant polypeptide.
- expression and/or secretion of a polypeptide can be increased by using a heterologous signal sequence. Therefore, in another embodiment, the fusion polypeptide contains a heterologous signal sequence at its N-terminus.
- a chimeric or fusion polypeptide can be produced by standard recombinant
- DNA techniques For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- 25 PCR amplification of nucleic acid fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive nucleic acid fragments which can subsequently be annealed and re-amplified to generate a chimeric nucleic acid sequence (Ausubel et al., Current Protocols in Molecular Biology, 1992). Moreover, many expression vectors are commercially
- a nucleic acid molecule encoding a polypeptide of the invention can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the polypeptide.
- the isolated polypeptide can be purified from cells that naturally express it, purified from cells that have been altered to express it (recombinant), or
- polypeptide is produced by recombinant DNA techniques. For example, a nucleic acid molecule encoding the polypeptide is cloned into an expression vector, the expression vector introduced into a host cell and the polypeptide expressed in the host cell. The polypeptide can then be isolated from the cells by an appropriate 5 purification scheme using standard protein purification techniques.
- the invention also provides for nucleic acids that encode in whole or in part the polypeptides of the invention.
- the nucleic acid molecules of the invention can be inserted into vectors and used, for example, as expression vectors or gene therapy vectors.
- Gene therapy vectors can be delivered to a subject by, e.g.,
- the pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete
- 15 gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
- the pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration. Tregitopes of the invention can include allelic or sequence variants
- mutants or analogs thereof, or can include chemical modifications (e.g., pegylation, gycosylation).
- a mutant can provide for enhanced binding to MHC molecules.
- a mutant can lead to enhanced binding to TCRs.
- a mutant can lead to a decrease in binding to MHC molecules and/or TCRs. Also contemplated is a mutant that binds but does
- Tregitope compositions that are chimeric protein compositions.
- the Tregitope composition comprises a first and a second polypeptide chain linked together, wherein the first chain comprises sequence numbers 4 through 58 or any combination thereof, and said second chain
- the biologically active molecule is selected from the group consisting of: an immunogenic molecule; a T cell epitope; viral protein; bacterial protein.
- the Tregitope composition of the invention comprises a first and a second polypeptide chain linked together, wherein said first chain comprises a Fc region wherein the amino acids
- BOST_299675.1 22 acids in region 289-309 has been altered so as not to bind to MHC class Il molecules, and said second chain comprises a immunogenic molecule.
- the invention provides methods to produce a regulatory T cell line recognizing at least a portion of SEQ ID NOS:4-58.
- one or 5 more peptides selected from the group consisting of SEQ ID NOS:4-58 are combined in admixture with an appropriate excipient.
- Such compositions are useful in methods of preventing or treating inflammation in a subject in need thereof, wherein local delivery of the admixture with an appropriate excipient results in decreased inflammation in the subject.
- one or more peptides selected from the group consisting of SEQ ID NOS:4-58 are combined in admixture with a antigen or allergen.
- Such compositions are useful in methods of inducing tolerance to the antigen or allergen in a subject in need thereof, wherein local delivery of the admixture with a antigen or allergen results in increased tolerance to the antigen or
- the invention provides a nucleic acid encoding comprising one or more of the Tregitope polypeptides selected from the group consisting of SEQ ID NOS:4-58. In one embodiment, the invention provides a
- the invention provides a cell comprising a vector of the invention.
- the cell can be a mammalian cell, bacterial cell, insect cell, or yeast cell.
- Tregitope specific T cells can be conducted by techniques known to one of skill in the art. For example, isolated PBMCs are stimulated with Tregitopes at 10 ⁇ g/ml RPMI media containing 20% HSA. IL-2 is added (10 U/ml final concentration) every other day starting on day 5. T cells are stained with tetramer pools on day 11 or 12. For each pool, 2-3 * 10 5 cells are incubated with
- BOST_299675.1 23 are positive for a particular tetramer are single-cell sorted into 96-well U-bottom plates by using a Becton Dickinson FACSVantage (San Jose, CA) on the same or following day. Sorted cells are expanded with 1.5-3 * 10 5 unmatched, irradiated (5000 rad) PBMC per well as feeders with 2.5 mg/ml PHA and 10 U/ml IL-2 added 5 24 h later. Specificity of cloned T cells is confirmed by staining with tetramers
- the invention provides methods of using Tregitopes for the purpose of designing small molecules.
- Tregitope- specific T cells are stimulated three times with pools of small molecule mixtures at a concentration of 1 ⁇ g/ml and autologous dendritic cells (DC) at 2-week intervals, followed by stimulation with heterologous DC and antigens.
- DC dendritic cells
- T cell medium is made by supplementing 500 ml of RPMI medium 1640 with 50 ml of FCS (HyClone), penicillin, and streptomycin (GIBCO); 20 mM Hepes (GIBCO); and 4 ml
- T cell clones are
- the invention provides methods of using Tregitopes for the purpose of cloning T cell receptors.
- Total RNA is extracted with an RNeasy Mini Kit (Qiagene) from the Tregitope specific T cell lines generated as described above.
- RNeasy Mini Kit Qiagene
- One microgram of total RNA is used to clone the TCR cDNAs by a rapid amplification of cDNA end (RACE) method (GeneRacer Kit, Invitrogen).
- RACE rapid amplification of cDNA end
- the RNA is dephosphorylated, decapped, and ligated with an RNA oligonucleotide according to the instruction manual of 5' RACE GeneRacer Kit.
- Superscript Il RT and GeneRacer Oligo-dT are used for reverse transcription of the RNA Oligo-ligated mRNA to single-strand cDNAs.
- 5' RACE is performed by using GeneRacer 5' (GeneRacer Kit) as 5' primer and gene-specific
- TCRCB1 R 5 1 - CGG GTT AAC TAG TTC AGA AAT CCT TTC TCT TGA CCA TGG C -3'; SEQ ID NO:65
- TCRCBR2 5'-CTA GCC TCT GGA ATC CTT TCT CTT G-3"; SEQ ID NO:66
- PCR polymerase chain reaction
- Plasmid DNAs are prepared from 96 individual clones from each construct for TCR ⁇ , ⁇ 1 , and ⁇ 2 chains. Full-length insert of all the plasmids is sequenced to determine the v ⁇ /v ⁇ usage (Zhao, Y. et al., J. Immunother., 29:398-406, 2006).
- the invention provides methods of treating a subject with a medical condition comprising administering a therapeutically effective amount of a Tregitope in a pharmaceutically acceptable carrier or excipient.
- a Tregitope in a pharmaceutically acceptable carrier or excipient.
- the Tregitopes of the present invention can be incorporated into pharmaceutical compositions suitable for
- compositions generally comprise at least one Tregitope and a pharmaceutically-acceptable carrier in a form suitable for administration to a subject.
- Pharmaceutically-acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of
- Tregitope compositions see, e.g.. Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, PA 18th ed., 1990).
- the pharmaceutical compositions are generally formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug
- compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a subject without the production of undesirable
- “Pharmaceutically-acceptable excipient” means, for example, an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be
- Such carriers or diluents include, but are not limited 5 to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin.
- Liposomes and non-aqueous vehicles such as fixed oils can also be used.
- the use of such media and compounds for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or compound is incompatible with the Tregitope, use thereof in the compositions is
- Supplementary active compounds can also be incorporated into the compositions.
- a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
- the Tregitope compositions of the present invention can be administered by parenteral, topical, intravenous, oral,
- agents are injected directly into a particular tissue where deposits have accumulated, e.g., intracranial injection. Intramuscular injection or intravenous infusion are preferred for administration of the Tregitope.
- Tregitopes of the invention are injected directly into the cranium.
- the Tregitopes of the invention are administered as a sustained release composition or device, such as a MedipadTM device.
- Tregitope of the invention can also be administered in conjunction with other agents that increase passage of the agents of the invention across the blood-brain barrier.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents
- antibacterial compounds such as benzyl alcohol or methyl parabens
- antioxidants such as ascorbic acid or sodium bisulfite
- chelating compounds such as ethylenediaminetetraacetic acid (EDTA); buffers such as
- BOST_299675.1 26 as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- excipients can include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, water, ethanol, DMSO 1 glycol, propylene, dried skim milk, and the like.
- the composition 5 can also contain pH buffering reagents, and wetting or emulsifying agents.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the carrier can be a solvent or dispersion medium containing, e.g., water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, e.g., by the use of a coating such as lecithin,
- microorganisms by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal compounds, e.g., parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic compounds, e.g., sugars, polyalcohols such as manitol, sorbitol,
- Prolonged absorption of the injectable compositions can be brought about by including in the composition a compound that delays absorption, e.g., aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the Tregitope in the required amount in an appropriate solvent with one or a combination of
- dispersions are prepared by incorporating the binding agent into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions methods of preparation are vacuum drying and freeze-
- the agents of this invention can be administered in the form of a depot injection or implant preparation that can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient.
- compositions generally include an inert diluent or an edible carrier.
- binding agent can be incorporated with excipients and used in the form of tablets, troches, or capsules.
- Oral compositions can also be prepared using a fluid carrier for use as a mouthwash,
- composition wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
- Pharmaceutically compatible binding compounds, and/or adjuvant materials can be included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum
- tragacanth or gelatin 15 tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening compound such as sucrose or saccharin; or a flavoring compound such as peppermint, methyl salicylate or orange flavoring.
- an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel or corn starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- a sweetening compound such as sucrose or saccharin
- a flavoring compound such as peppermint, methyl salicylate or orange flavoring.
- the Tregitope(s) are delivered in the form of an aerosol spray from pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the transmucosal or transdermal administration.
- 25 barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, e.g., for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the Tregitope is formulated into ointments, salves, gels, or creams
- the Tregitope can also be prepared as pharmaceutical compositions in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- suppositories e.g., with conventional suppository bases such as cocoa butter and other glycerides
- retention enemas for rectal delivery.
- the Tregitope is prepared with carriers that protect the Tregitope against rapid elimination from the body, such as a controlled-release formulation, including implants and microencapsulated delivery systems.
- a controlled-release formulation including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as, for example, 5 ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
- the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens)
- Tregitopes or chimeric proteins can be implanted within or linked to a biopolymer solid support that allows for the slow release of the Tregitopes or chimeric proteins to the desired site.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of binding agent calculated to produce the desired therapeutic effect in association with the
- the present invention is directed to, for example methods of treating one or more medical conditions comprising administering a Tregitope or chimeric protein of the invention, thereby treating the medical condition.
- the medical condition can be, for example, primary immunodeficiencies; immune-mediated thrombocytopenia,
- Kawasaki disease hematopoietic stem cell transplantation in patients older than 20 years, chronic B-cell lymphocytic leukemia and pediatric HIV type 1 infections.
- Specific examples include: (Hematology) aplastic anemia, pure red cell aplasia, Diamond-Blackfan anemia, autoimmune hemolytic anemia, hemolytic disease of the newborn, acquired factor VIII inhibitors, acquired von Willebrand disease,
- infectious diseases conditions in which acquiring an infectious disease could be deleterious include low birth weight (e.g., ⁇ 1500 g), solid organ transplantation, surgery, trauma, burns, and 5 HIV infection;
- Neuroology epilepsy and pediatric intractable Guillain-Barre syndrome, chronic inflammatory demyelinating polyneuropathy, myasthenia gravis, Lambert-Eaton myasthenic syndrome, multifocal motor neuropathy, multiple sclerosis;
- Obstetrics recurrent pregnancy loss;
- Pulmonology chronic chest symptoms, rheumatology, rheumatoid arthritis (adult and juvenile), systemic
- otitis media paraneoplastic cerebellar degeneration, paraproteinemic neuropathy, parvovirus infection (general), polyneuropathy, organomegaly, endocrinopathy, M- protein, and skin changes (POEMS) syndrome, progressive lumbosacral plexopathy, lyme radiculoneuritis, Rasmussen syndrome, Reiter syndrome, acute renal failure, thrombocytopenia (nonimmune), streptococcal toxic shock syndrome,
- the present invention is directed to, for example, methods of treating allergy, autoimmune disease, transplant-related disorders such as graft versus host disease, enzyme or protein deficiency disorders, hemostatic disorders, cancers, infertility, or infections (viral, bacterial, or parasitic).
- transplant-related disorders such as graft versus host disease, enzyme or protein deficiency disorders, hemostatic disorders, cancers, infertility, or infections (viral, bacterial, or parasitic).
- Tregitopes or chimeric proteins of the invention can be used with in conjunction with other proteins or compounds used for treating a subject with a medical condition in order to reduce adverse events or enhance the efficacy of the co-administered compound.
- Allergen-specific regulatory T cells play an important role in controlling the development of allergy and asthma. Both naturally occurring CD4/CD25 regulatory T cells and secondary T Regs (antigen-specific regulatory T cells), both expressing the transcription factor FOXp3, have been 5 shown to inhibit the inappropriate immune responses involved in allergic diseases. A number of recent studies indicate that regulatory T cells play an important role in controlling the overdevelopment of T-helper type 2 biased immune responses in susceptible individuals, not only in animal models, but in humans as well. Recent studies indicate that T regulatory cells also suppress T cell costimulation by the
- TGF- ⁇ and IL-10 secretion of TGF- ⁇ and IL-10, suggesting an important role of T regulatory cells in the regulation of allergic disorders. Impaired expansion of natural or adaptive regulatory T cells leads to the development of allergy, and treatment to induce allergen-specific regulatory T cells would provide curative therapies for allergy and asthma.
- Tregitopes of the invention are useful to induce tolerance during the transplantation process, by promoting the
- T Re g S promote donor bone marrow engraftment and decrease the incidence and severity
- T cells contributes to the development of graft versus host disease.
- the mechanisms of immunoregulation, in particular the allorecognition properties of T Regs . their effects on and interaction with other immune cells, and their sites of suppressive activity, are not well understood.
- Tregitopes can be used as a tolerizing agents for immunogenic compounds (protein therapeutics). This discovery has implications for the design of protein therapeutics. Thus, administration of a monoclonal antibody, autologous cytokine, or foreign protein in conjunction with Tregitopes suppresses adverse T effector immune responses. In vivo, T Regs act
- T Regs prevent or slow down the progression of autoimmune diseases. This protective mechanism appears, however, insufficient in autoimmune individuals, likely because of a shortage of T Regs cells and/or the
- T Reg -resistant pathogenic T cells 20 development and accumulation of T Reg -resistant pathogenic T cells over the long disease course. Thus, restoration of self-tolerance in these patients may require purging of pathogenic T cells along with infusion of T Re gs with increased ability to control ongoing tissue injury.
- Organ-specific autoimmune conditions, such as thyroiditis and insulin-dependent diabetes mellitus have been attributed to a
- Type 1 diabetes is an organ-specific autoimmune disease resulting from destruction of insulin-producing pancreatic beta-cells.
- islet cell antigen-specific T cells are either deleted in thymic development or are converted to T regulatory cells that actively suppress
- BOST_299675.1 32 the activation of natural T regulatory cells and the conversion of existing antigen specific effector T cell to a regulatory phenotype. In this way deleterious autoimmune response is redirected leading to the induction of antigen-specific adaptive tolerance. Modulation of auto-immune responses to autologous epitopes 5 by induction of antigen-specific tolerance can prevent ongoing beta-cell destruction. Accordingly, a Tregitope of the invention is useful in methods for the prevention or treatment of diabetes.
- HBV infection Treatment to Hepatitus B (HBV) infection.
- Chronic HBV is usually either acquired (by maternal fetal transmission) or can be a rare outcome of acute HBV
- T Reg cells specific for HBcAg declined during exacerbations accompanied by an increase in HBcAg peptide-specific cytotoxic T cells.
- FOXp3-expressing T Reg cell clones were identified.
- Tregitope of the invention is useful in methods for the prevention or treatment of viral infection, e.g., HBV infection.
- TReg epitope that plays a role in Systemic Lupus Erythematosis (SLE) or Sjogren's syndrome has been defined. This peptide
- PBMCs In contrast to normal T cells and T cells from non-lupus autoimmune patients, PBMCs
- T regulatory epitopes have also been defined in Sjogren's syndrome. Accordingly, a Tregitope of the invention co-administered in
- BOST_299675.1 33 combination with the epitope from above is useful in methods for the prevention or treatment of SLE.
- Graves' disease is an autoimmune disorder that is characterized by antibodies to self-thyroid stimulating hormone 5 receptor (TSHR) leading to leading to hyperthyroidism, or an abnormally strong release of hormones from the thyroid gland.
- TSHR self-thyroid stimulating hormone 5 receptor
- Several genetic factors can influence susceptibility to Graves' disease. Females are much more likely to contract the disease than males; White and Asian populations are at higher risk than black populations and HLA DRB1-0301 is closely associated with the disease.
- Tregitope(s) of the invention co-administration with Tregitope(s) of the invention with TSHR or other Graves' disease antigens or portions thereof is useful in methods for the prevention or treatment of Graves' disease.
- Autoimmune Thyroiditis is a condition that occurs when antibodies arise to self thyroid peroxidase and/or
- Tregitope of the invention with thyroid peroxidase and/or thyroglobulin TSHR or portions thereof are useful in methods for the prevention or treatment of autoimmune thyroiditis.
- a monoclonal antibody targeting the dendritic cell surface receptor DEC-205 has shown promise as a vaccine vector capable of targeting vaccine antigens to dendritic cells.
- anti-DEC-205 induces antigen-specific tolerance rather than immunity. Therefore, regulatory T-cell epitopes contained in anti-DEC-205 promote a tolerogenic reaction that is only overcome through the co-administration of non-specific immuno-stimulators. This point has been verified experimentally, namely, that the Tregitopes contained in the anti-DEC-205 vector cause antigen-
- kits comprising at least one Tregitope composition of the invention, which can be conveniently used, e.g., in clinical settings to treat subjects exhibiting 5 symptoms or family history of a medical condition described herein.
- the kit further comprises instructions for use of the at least one Tregitope composition of the invention to treat subjects exhibiting symptoms or family history of a medical condition described herein.
- the invention provides ex vivo methods for the expansion of regulatory T-cells.
- the invention provides a method of expanding regulatory T-cells in a biological sample, the method comprising: (a) providing a biological sample from a subject; (b) isolating regulatory T-cells from the biological sample; and contacting the isolated regulatory T-cells with an effective
- the method further comprises the step of administration of the expanded regulatory T-cell composition to a subject.
- the method further comprises the step of administration of the expanded regulatory T-cell composition to a subject.
- the expanded regulatory T-cell composition is the same individual from which the original biological sample was obtained, e.g., by autologous transplantation of the expanded regulatory T-cell composition (Ruitenberg, J. et ai, BMC Immunol., 7:11 , 2006). In Vitro Uses of Tregitope Compositions
- the invention provides the use of the Tregitope compositions of the invention as reagents in the study of regulatory T-cell function in in vitro experimental models.
- the invention provides in vitro methods for stimulation of regulatory T-cells in a biological sample, the method comprising: (a) providing a biological sample from a subject; (b) isolating regulatory
- the invention provides in vitro methods for the
- Tregitopes were (1 ) identified using the T cell epitope mapping algorithm
- EpiMatrix (2) confirmed to bind to soluble HLA, (3) proven to engage natural regulatory T cells, (4) proven to suppress the immune response to co-delivered antigens ex vivo (in human PBMC) and (3) proven to suppress the immune response to co-delivered antigens in vivo (in mice). The methods for these
- T cells specifically recognize epitopes presented by antigen presenting cells (APCs) in the context of MHC (Major Histocompatibility Complex) Class Il molecules. These T-helper epitopes can be represented as linear sequences
- the EpiMatrix system is a tool for predicting class I and class Il epitopes.
- the algorithm uses matrices for prediction of 9- and 10-mer peptides binding to
- Each matrix is based on position-specific coefficients related to amino acid binding affinities that are elucidated by a method similar to, but not identical to, the pocket profile method (Sturniolo, T. et a/., Nat. Biotechnol., 17:555- 561 , 1999).
- the EpiMatrix system has been used to prospectively predict a large number of epitopes that have been confirmed in vitro and in vivo. The entire amino acids
- 30 acid of any given sequence is first parsed into overlapping 9-mer frames where each frame overlaps the last by eight amino acids. Each frame is then scored for predicted affinity to each of eight common Class Il HLA haplotypes (DRB1 * 0101 , DRB1 * 0301 , DRB1 * 0401 , DRB1 * 0701 , DRB1 * 0801 , DRB1 * 1101 , DRB1 * 1301 , and DRB1 M501 ). Due to their prevalence and their difference from each other, these
- EpiMatrix peptide scoring It was determined that any peptide scoring 5 above 1.64 on the EpiMatrix "Z" scale (approximately the top 5% of any given peptide set) has a significant chance of binding to the MHC molecule for which it was predicted. Peptides scoring above 2.32 on the scale (the top 1 %) are extremely likely to bind; most published T cell epitopes fall within this range of scores. Previous studies have also demonstrated that EpiMatrix accurately predicts
- T cell epitope Clusters Following epitope mapping, the result set produced by the EpiMatrix algorithm is screened for the presence of T cell epitope clusters and EpiBars. Potential T cell epitopes are not randomly distributed throughout protein sequences but instead tend to "cluster.”
- 15 cell epitope “clusters” range from 9 to roughly 30 amino acids in length and, considering their affinity to multiple alleles and across multiple frames, contain anywhere from 4 to 40 binding motifs.
- putative T cell epitope clusters are identified. Briefly, the EpiMatrix scores of each 9-mer peptide analyzed are aggregated and checked against a
- T cell epitope clusters contain significant numbers of putative T cell epitopes and EpiBars indicating a high potential for MHC binding and T cell reactivity.
- Tregitopes can be produced by direct chemical
- Tregitopes of the invention were prepared by 9-fluoronylmethoxycarbonyl (Fmoc) synthesis at New England peptide and on an automated Rainen Symphony/Protein Technologies synthesizer (Synpep, Dublin,
- Non-biotinylated test peptide is suspended in a 96-well polypropylene plate in final concentrations ranging from 5 0.1 ⁇ M - 400 ⁇ M in triplicate wells.
- the 96-well plates are incubated at 37 0 C in 6% CO 2 for 45 minutes. Following the incubation, biotinylated Flu HA peptide 307-319 (or
- an IC 50 of 250 ⁇ M or more is indicative of weak binding and an IC 50 of 400 ⁇ M or more is indicative of a non-binding interaction.
- PBMC peripheral blood mononuclear cells
- T cell activation is indicated by increases in CD4+CD25+ expression, which, when accompanied by an increase in FOXp3 expression, is indicative that the activated cells are regulatory.
- Isolated PBMCs were cultured for 8 days at 37 0 C 5% CO 2 in presence of either an immunogenic antigen alone or that antigen in the presence of Tregitope peptide.
- Test antigens were added at 10 ⁇ g/ml and include 1 ) classic antigens such as, for example, tetanus toxin peptide TT 830 ⁇ 4 .
- allergens also included allergens: birch tree pollen antigen Betvi , House dust mite lysate and the purified house dust mite antigen, Der P2.
- Recombinant IL-2 (10 IU/ml) and IL-7 (20 ng/ml) were added to PBMC cultures on day 2. After 8 days of stimulation, cells were harvested and washed several times with PBS and assayed according to the human cytokine release assays described below.
- IFN- ⁇ ELISpot assays are performed using Human
- IFN- ⁇ ELISpot kits purchased from Mabtech. Target peptides are added at 10 ⁇ g/ml to triplicate wells containing 250,000 human peripheral blood mononuclear cells in RPMH 640 with 10% human serum and incubated for eighteen to twenty-two hours at 37°C under a 5% CO 2 atmosphere. Triplicate wells are plated with PHA at
- BOST 299675.1 39 response is considered positive if the number of spots in the peptide test wells is statistically different (p ⁇ 0.05) from that of the control wells by the Mann-Whitney U test.
- responses are considered positive if the number of spots is at least four times background and greater than 50 spots per one million cells over 5 background (1 response over background per 20,000 splenocytes). Results are recorded as the average number of spots over background and adjusted to spots per one million cells seeded. Suppression rates of 10% or greater, when determined to be statistically significant, are considered statistically significant.
- Target peptides are added at 10 ⁇ g/ml to triplicate wells containing 250,000 human peripheral blood mononuclear cells in RPM11640 with 10% human serum and incubated for eighteen to twenty-two hours at 37 0 C under a 5% CO 2 atmosphere.
- Triplicate wells are plated with PHA at 10 ⁇ g/mL. Six wells with no peptide are used for background determination.
- 15 response is considered positive if the number of spots in the peptide test wells is statistically different (p ⁇ 0.05) from that of the control wells by the Mann-Whitney U test. In general, responses are considered positive if the number of spots is at least four times background and greater than 50 spots per one million cells over background (1 response over background per 20,000 splenocytes). Results are
- IL-4 ELISpot assays are performed using Human IL-4 ELISpot kits purchased from Mabtech. Target peptides are added at 10 ⁇ g/ml
- a response is considered positive if the number of spots in the peptide test wells is statistically different (p ⁇ 0.01 ) from that of the control wells. In general, responses are considered positive if the number of spots is at least four times background and greater than 50 spots per one million cells over background (1 response over background per 20,000
- BOST_299675.1 40 background and adjusted to spots per one million cells seeded. Suppression rates of 10% or greater, when determined to be statistically significant, are considered significant.
- Human IFN- ⁇ ELISA Human IFN- ⁇ ELISA. Target peptides are added at 10 ⁇ g/ml to cultures 5 containing human peripheral blood mononuclear cells in RPM11640 with 10% human serum and incubated for eighteen to twenty-two hours at 37 0 C under a 5% CO 2 atmosphere. Cultures stimulated with PHA at 10 ⁇ g/mL or with no peptide are used as controls. Human IFN- ⁇ quantitative sandwich ELISAs were performed using R&D Systems Quantikine ELISA kits. A polyclonal antibody specific for IFN- ⁇
- Kit-provided standards and cell supernatant samples including PHA and no-peptide controls (100 ⁇ l) are pipetted into the wells and any IFN- ⁇ present is bound by the immobilized antibody over 2 hours at room temperature. After washing away unbound substances, an enzyme- linked polyclonal antibody specific for IFN- ⁇ is added to the wells for a two hour
- PBMC cultures are evaluated for cytokines and chemokine levels using the SearchLight multiplex ELISA technology.
- Human cytokines that are measured include IL-1 ⁇ , IL-2, IL-4, IL-5, IL-6, IL-10, IL-12p40, IL-12p70, TNF ⁇ and TGF ⁇ .
- Human chemokines that are measured include MCP-1 , MIP-1 ⁇ and MIP-1 ⁇ .
- SearchLight Proteomic Arrays are a quantitative multiplexed sandwich ELISA
- Human Treg cell populations are depleted or positively isolated from PBMC using the invitrogen dynabeads system 5 (for human CD4 and CD25) according to manufacturer's instructions (InVitrogen, Carlsbad, California). (5) Methods for the suppression of response to co-administered antigens in vivo.
- mice 10 murine model.
- Groups of mice are immunized with an antigen alone, a cocktail of antigen and tregitope, or with an antigen fused to tregitope.
- a negative control group solvent alone
- One week following the final injection the mice are sacrificed in accordance with all institutional and federal guidelines and spleens harvested. Freshly isolated mouse splenocytes are used to assay the
- Murine IFN- ⁇ ELISpot IFN- ⁇ ELISpot assays are performed using murine
- Murine IL-4 ELISpot Assays are performed using murine IL-4 ELISpot kits purchased from Mabtech. Target peptides are added at 10 ⁇ g/ml to triplicate wells containing 300,000 murine splenocytes (in RPM11640 with 10%
- Murine IFN- ⁇ ELISA Murine IFN- ⁇ ELISA.
- Target peptides are added at 10 ⁇ g/ml to cultures containing human peripheral blood mononuclear cells in RPM11640 with 10% human serum and incubated for eighteen to twenty-two hours at 37 0 C under a 5% CO 2 atmosphere. Cultures stimulated with PHA at 10 ⁇ g/mL or with no peptide are
- Mouse IFN- ⁇ quantitative sandwich ELISAs were performed using R&D Systems Quantikine ELISA kits.
- a polyclonal antibody specific for IFN- ⁇ is pre-coated onto a 96-well microtiter plate.
- Kit-provided standards and cell supernatant samples including PHA and no-peptide controls (100 ⁇ l) are pipetted into the wells and any IFN- ⁇ present is bound by the immobilized antibody over two
- an enzyme- linked polyclonal antibody specific for IFN- ⁇ is added to the wells for a two hour incubation at room temperature. Following a wash to remove any unbound antibody-enzyme reagent, a substrate solution is added to the wells for 30 minutes and color developed in proportion to the amount of bound IFN- ⁇ . The color
- Splenocytes are plated in 96-well tissue culture plates at 2 x 10 6 cells/well in RPMI 1640 supplemented with 10% FCS, 100 U/mL penicillin, 100 ⁇ g/mL streptomycin sulfate.
- An unstimulated and positive control (ConA) are included in each assay. Cells are incubated overnight at 37 C C at 5% CO 2 .
- Murine Treg cell populations are depleted or positively isolated from PBMC using the InVitrogen dynabeads system (for murine CD4 and CD25) according to manufacturer's instructions (InVitrogen,
- Quantification of antibodies against co administered antigen Quantification of IgG antibody to antigens was determined by antibody-capture ELISA. Antigen (10 ⁇ g/mL) is dissolved in carbonate buffer and placed into a 96- well microtiter plate overnight at 4°C. The plates were then washed with
- PBST phosphate-buffered saline containing 0.05% Tween 20
- FBS fetal bovine serum
- PBS fetal bovine serum
- Serial dilutions of sera in 0.5% FBS/PBS are added to the plates and incubated at room temperature for two hours.
- the microtiter plates are then washed with PBST and 100 ⁇ L goat anti-mouse IgG (gamma-chain specific) conjugated to horseradish
- BLAST Alignment Search Tool
- NCBI website ncbi.nlm.nih.gov/blast.
- the BLAST program compares protein sequences to sequence databases and calculates the statistical significance of matches in order to find regions of local similarity between sequences.
- the IgG-derived Tregitopes were found to be conserved across non-human species such as mouse, rat, cat, camel, cow and
- Table 3 illustrates a BLAST report of Tregitope-289 (SEQ NO: 4).
- BOST 299675.1 47 Identification of regulatory epitopes in common circulating human proteins.
- EpiVax identified a set of common and circulating proteins that might also contain Tregitopes.
- the analyzed protein set included isolates of human: Actin, Albumin, Collagen, Fibrinogen, Haptoglobin, Keratin, Myosin, Osteocalcin, Prostaglandin, Superoxide Dismutase, Titin and Transferrin.
- Common isolates of each protein were analyzed via EpiMatrix and ClustiMer as described above and a set of high scoring and highly conserved putative T cell epitope clusters was selected for further analysis. See Table 2, SEQ ID NOS:38-58.
- Soluble MHC binding assays were performed on the synthetic IgG Tregitopes according to the methods described above.
- IC 50 values ( ⁇ M) were derived by a six point inhibition curve of a strong binding control peptide.
- Tregitopes identified by in silico analysis bound to human MHC molecules See Table 4 below.
- Tregitope-167 high high high high
- Tregitope-289 medium high high
- Tregitope-134 None high I llf i FTbw ;f ⁇
- Tregitope peptide sequence was synthesized with and without a C-terminal amide cap.
- the uncapped peptide was evaluated for affinity to DRB1 * 0101 and DRB1 * 1501 in HLA binding assays and shown to bind to both alleles with higher affinity than did the capped peptide.
- PBMC PBMC from a DRB1 * 0101 subject
- Tregitope peptides (capped and uncapped) to suppress responses to co- incubated CEF, a MHC class I immunogenic peptide pool, was then investigated.
- the cells were stimulated on day 1 and cultured for 6 days. On day 7 the cells were collected and half were stained for CD4, CD25 and CD127 and analyzed by 5 flow cytometry. The remaining cells were added to an IFN- ⁇ ELISpot plate and re- stimulated with CEF.
- the co-cultures with the C-terminal amide-capped Tregitope led to an increase in CD4+CD25+CD127low Tregs compared to the uncapped Tregitope-289 (FIG. 2, left panel). Consistent with previous studies that have shown that CD4+CD25+CD127low Tregs are highly suppressive, the capped
- Tregiotpe-289 but not the uncapped Tregitope-289, was able to suppress CEF- specific IFN- ⁇ secretion (FIG. 2, right panel).
- Tregitope-289 amidated peptide is 1 dalton smaller by mass spectrometry analysis. Amidation of the C-
- Tregitope-289 15 terminus of Tregitope-289 is herein demonstrated to alter its binding and functional characteristics. Because the capped version of Tregitope-289 peptide demonstrated better functionality, the capped (amidated) peptide was used in all subsequent assays. In further support, results displayed here for Tregitope-289 refer to the capped version. Both capped and uncapped versions of the Tregitopes
- Example 4 Characterization of a Tregitope composition by suppression of co- 5 administered antigen in vitro.
- Tregitope-167 and Tregitope-134 down-regulate effector responses and upregulate regulatory responses to coadministered antigens in vitro.
- PBMCs were cultured for 8 days with either a) pool of immunogenic peptides alone, b) a pool of immunogenic peptides with hTregitope-167, or c) a pool
- Tregitope during the initial stimulation led to an increase in secretion of the regulatory cytokines and chemokines, IL-10 and MCP-1 and a decrease in the secretion of helper T cell cytokines and chemokines, IL-5, IL-6, IFN- ⁇ and MIP-1 ⁇ . demonstrating the ability of Tregitopes to engage and activate regulatory T cells (FIG. 4).
- Tregitope-289 downregulates effector responses and upregulates regulatory responses to co-administered antigen in vitro.
- PBMCs were cultured for 8 days with either a) pool of immunogenic peptides alone, b) a pool of immunogenic peptides with Tregitope-289, or b) a pool of immunogenic peptides withTregitope-289.
- 25 peptide pool were derived from C3d, an immunogenic autologous protein (Knopf, P. et a/., Immunol. Cell Biol., 2008 Jan 8; doi: 10.1038/sj.icb.7100147). Cells were harvested and washed with PBS. As described, Cells (2 * 10 5 cells/well) were plated into 96-well plate and re-stimulated in triplicate wells with each condition: C3d pool alone, C3d pool + Tregitope, PHA control, or no peptide (negative control)
- PBMCs were cultured for 8 days with TSHR peptide pools (pool) with or without a pool of Tregitope peptides (Tregitope-134, Tregitope-167, Tregitope-289). Cells were harvested and washed with PBS.
- Tregitope suppresses immune response to CEF, a pool of Immunodominant peptide epitopes derived from common pathogens.
- PBMCs were cultured for 8 days with or without individual Tregitope peptides: Tregitope-289, Tregitope 294, Tregitope-029, Tregitope-074, Tregitope-009.
- Cells were harvested and washed with PBS. As described above, 2.5 * 10 5 cells were
- Tregitope suppresses immune response to peptide epitopes derived from Botulinum neurotoxin, a protein used to treat dystonia (movement disorders).
- PBMCs from a subject with evidence of inhibitors were cultured for 8 days with or without a pool of Tregitope peptides (Tregitope-167, Tregitope-134, Tregitope-289). Cells were harvested and washed with PBS.
- Tregitopes suppress the cytokine secretion of effector T cells in response to an immunogenic therapeutic protein (FIG. 8 and Table 5).
- BoNT BoNT- BoNT- BoNT- BoNT- BoNT- BoNT PHA restimulation with: -L1 L2 L3 L4 L5 -Pool control
- Tregitope-289 and Tregitope-134 down-regulate proliferation in response to co-administered immunodominant antigens in vitro.
- CEF is a commercially available pool of immunodominant peptide epitopes
- PBMCs peripheral blood mononuclear cells
- CEF + Tregitope-134 CEF + Tregitope-289.
- Cells were harvested and washed with PBS.
- 2 x 10 6 cells were pre-labeled with CFSE dye (Invitrogen) by standard protocol and re-stimulated for 65 hours with CEF pool, or no peptide (negative control), or PHA mitogen control; supernatants were collected and hlFN- ⁇ ELISAs
- Tregitope-289 downregulates proliferation in response to co- 5 administered antigen in vitro.
- PBMCs from a subject previously immunized with vaccinia were cultured for 8 days with either an immunogenic vaccinia peptide alone or an immunogenic vaccinia peptide with Tregitope-289 as described above.
- Cells were harvested and washed with PBS. 2 * 10 6 cells were pre-labeled with CFSE dye (Invitrogen) by
- Tregitope 10 standard protocol and re-stimulated with the vaccinia peptide, vaccinia peptide and Tregitope-289, or no peptide (negative control) for 65 hours.
- the co-incubation of Tregitope during incubation led to a significant decrease in proliferation of the effector T cells further demonstrating the ability of regulatory T cells activated by Tregitope to reduce the proliferation of effector T cells (FIG. 10).
- Tregitope suppression is mediated by cells with a regulatory phenotype
- FIG. 1 1 documents the requirement for CD4+/CD25hi T cells in the initial co- incubation. In the presence of CD4+CD25hi cells, co-stimulation with CD4+CD25hi cells
- Tregitope-289 and HDM caused suppression of gamma interferon release following restimulation with HDM alone; in the absence of CD4+CD25N cells (sorted prior to the incubation, co-stimulation with Tregitope-289 and HDM was associated with a lower amount of suppression (16%: 16.5 to 12.4 pg/ml) as compared with a higher amount of suppression (65%: 33.5 to 11.8 pg/ml) following restimulation with HDM
- FIG. 11 show that the cellular subset containing Tregs is necessary for the induction of tolerance to an antigen.
- Tregitope co-incubation causes expansion of cells with a regulatory phenotype (CD4+ CD25Hi T cells) and upregulation of regulatory cytokine IL-10 in 5 response to an allergen.
- Tregitope nTreg activation could lead to generation of allergen-specific aTReg, PBMC (from dust mite allergic individuals) first incubated for 8 days with Dust Mite (DM) antigen alone, dust mite antigen + Tregitope-289, or dust mite antigen + Tregitope-167 were analyzed.
- DM Dust Mite
- CD4+CD25Hi cells may be HDM-specific adaptive Treg.
- One of skill in the art can confirm that the expanded CD4+CD25hi population is secreting IL-10 in this in vitro assay.
- Tregitope co-incubation also led to a significant decrease in expression of CCR4, CD30, CRTH2, and CCR6, which have been shown to be associated with Th2 responses.
- Tregitope co-stimulation contributed to the development of a mixed population of Bet v 1 1141-1155-specific CD4+ T cells.
- 42% of these epitope-specific cells were neither IL5 nor IFN- ⁇ positive, and 44% demonstrated a shift to a Th-1-like
- Tregitope-167 binds avidly to HLA 1501 (87% inhibition of binding at 50 ⁇ M).
- Example 5 Characterization of a Tregitope composition by suppression of coadministered antigens in vivo.
- Tregitopes suppress response to a therapeutic protein of bacterial origin, which is referred to as "ANTIGEN-XX" (FIG. 14).
- ANTIGEN-XX has caused significant immunogenicity in humans in unpublished studies. Whether the Tregitopes of the invention could suppress the effector
- HLA DR4 Transgenic mice (4-6 wk female) were injected weekly 3* subcutaneously (scruff of the neck) with either 1 ) 50 ⁇ g ANTIGEN-XX alone, 2) 50 ⁇ g ANTIGEN-XX+25 ⁇ g murine Tregitope-167 and 25 ⁇ g murine Tregitope 106 or 3) PBS sham control. Splenocytes were harvested and plated in murine IL-4 elispot plates as described above.
- ANTIGEN-XX 10 ⁇ g/mL was dissolved in carbonate buffer (10 mM Na 2 CO 3 and 35 mM NaHCO 3 [pH 9]) and placed into a 96- well microtiter plate overnight at 4°C. The plates were then washed with phosphate-buffered saline containing 0.05% Tween 20 (PBST) and blocked for 3
- carbonate buffer 10 mM Na 2 CO 3 and 35 mM NaHCO 3 [pH 9]
- FBS fetal bovine serum
- PBS fetal bovine serum
- Serial dilutions of sera in 0.5% FBS/PBS were added to the plates and incubated at room temperature for 2 hours.
- the microtiter plates were then washed with PBST and 100 ⁇ L goat anti-mouse IgG (gamma-chain specific) conjugated to horseradish peroxidase (Southern Biotechnology Associates) diluted 1 :10000 in 0.5% FBS/PBS
- Microtiter plates are washed in PBST and then developed with 3,3',5,5'-tetramethylbenzidine (TMB; Moss). Absorbances were read at a wavelength of 450 nm measured on a Wallac Victor3. Correction for optical imperfections in the plate is made by subtraction of intensities at 540 nm from the 450 nm values. Response to positive control PHA was robust following both
- Tregitope co-administration causes suppression of effector responses to co-administered allergen in vivo.
- HLA DR4 Transgenic mice (4-6 wk female) were injected weekly 3* subcutaneously (scruff of the neck) with
- mice either 1 ) 50 ⁇ g HDML alone, 2) 50 ⁇ g HDML + 50 ⁇ g murine homologue of Tregitope-289 or 3) PBS sham control.
- mice were first presensitized to HDML through 3 weekly injections of 50 ⁇ g and then treated with coinjections of HDML (50 ⁇ g) and Tregitope-289). One week following the final injections, mice were sacrificed.
- Splenocytes were harvested and plated in murine IL-4 ELISpot plates as described above; to the plated cells were added (in triplicate): PBS (no stimulus control), HDM Lysate, purified HDM antigen DerP2, and PHA.
- HDM DerP2 is a component of HDM Lysate.
- Serum was obtained by cardiac puncture. Quantification of IgG antibody to
- HDM antigen was determined by antibody-capture ELISA as described above.
- HDM antigen DerP2 (10 ⁇ g/mL) was placed into a 96-well microtiter plate overnight at 4°C. The plates were then washed with phosphate-buffered saline containing 0.05% Tween 20 (PBST) and blocked for three hours at room temperature with 5% fetal bovine serum (FBS; Gibco) in PBS. Serial dilutions of sera in 0.5% FBS/PBS
- microtiter plates were then washed with PBST and 100 ⁇ L goat anti-mouse IgG (gamma-chain specific) conjugated to horseradish peroxidase (Southern Biotechnology Associates) diluted 1 :10000 in 0.5% FBS/PBS is added to each well.
- Microtiter plates are washed in PBST and then developed with 3, 3', 5,5'-
- TMB tetramethylbenzidine
- Tregitope co-administration causes suppression of effector responses to co-administered therapeutic in vivo.
- HLA DRBT0401 was injected into mice three times weekly with preparations of 50 ⁇ g immunogenic protein therapeutic ("IPT") alone or in combination with either 50 ⁇ g Tregitope-289 (murine homologue) or IPT in combination with the murine Fc.
- IPT immunogenic protein therapeutic
- Tregitope-289 murine homologue
- Tregitope-289 murine homologue
- Clotting Factor VIII is immunogenic in people with severe hemophilia A. Chimeric constructs comprised of the coding sequence of Factor VIII and Tregitope are produced (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2 ed., Cold Spring Harbor Laboratory Press, (1989)). Briefly, the Factor VIII coding region fused at the carboxyterminal to
- Tregitope is generated by annealing overlapping oligos and sub-cloned into an expression plasmid.
- the plasmids are transfected into DG44 CHO cells and stable transfectants selected.
- the chimeric protein is purified over a immunoaffinity column and evaluated for tolergenicity. Table 6 illustrates one embodiment of such a chimeric protein.
- Tregitopes can be present in highly immunogenic proteins to promote adaptive tolerance.
- Chimeric constructs comprised of the coding
- Tregitope-289 located in the Fc domain of IgG molecules acts to deliver suppressive signals.
- the modification of Fc so that 5 Tregitope-289 no longer binds to MHC molecules and regulatory T cells allows for efficient targeting of vaccine candidates while avoiding suppressive effects. Modifications to decrease binding of Tregitopes to MHC molecules are useful. Table 8 illustrates such a modification. Chimeric constructs comprised of various proteins or epitope pseudo-proteins of interest and a Tregitope modified mlgG Fc
- the protein or epitope pseudo-protein of interest is generated by annealing overlapping oligos and sub- cloned into a Tregitope modified Fc fusion expression plasmid.
- the plasmids are transfected into DG44 CHO cells and stable transfectants selected.
- Table 8 illustrates one embodiment of a chimeric protein where the pseudo-protein of interest is a string of immunogenic T cell epitopes derived from the Epstein Barr Virus (EBV) fused to a modified Fc protein in which the Tregitope has been modified to no longer bind MHC class Il molecules and can not
- EBV-Tregitope modified Fc SEQUENCE (Kb SIGNAL SEQUENCE) in Table 8 is designated as underlined text.
- the Tregitope is designated as bold text.
- the Tregitope modified amino acids are designated as shaded test.
- the human Fc region is designated as italicized text.
- Table 8 EBV-Tregitope modified Fc SEQUENCE wtggallvlysfalmliiiiliififrrdllcplgalcilllmitlllialwnlhgqalflgivlfifgc llvlgiwiyllemlwrlgatiwqllafflaffldlilliialylqqnwwtllvdllwlllflailiwmyy hgqrhsdehhhddslphgpgpgpggprhrdgvrrpqkrpscigckgpgpgiaeglrallarshvertgpgpg agvfvyggsktslynlrrgtalaigpgpgtslynlrrgtalaipqcrltplsrlgpgpgresivcyfmvf lqthifaevlg
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Oncology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Pulmonology (AREA)
- Neurology (AREA)
- Endocrinology (AREA)
- Microbiology (AREA)
- Rheumatology (AREA)
- Biotechnology (AREA)
- Reproductive Health (AREA)
- Mycology (AREA)
- Neurosurgery (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AT08713321T ATE525392T1 (de) | 2007-01-30 | 2008-01-29 | Regulatorische t-zellen-epitopen sowie zusammensetzungen damit und anwendungen davon |
| MX2015014429A MX347197B (es) | 2007-01-30 | 2008-01-29 | Epitopes de celulas t reguladoras, composiciones y usos para los mismos. |
| EP08713321.1A EP2125883B2 (en) | 2007-01-30 | 2008-01-29 | Regulatory t cell epitopes, compositions and uses thereof |
| KR1020147024226A KR101722305B1 (ko) | 2007-01-30 | 2008-01-29 | 조절 t 세포 에피토프, 그의 조성물 및 용도 |
| MX2009008230A MX2009008230A (es) | 2007-01-30 | 2008-01-29 | Epitopes de celulas t reguladoras, composiciones y usos para los mismos. |
| KR1020177008095A KR20170037677A (ko) | 2007-01-30 | 2008-01-29 | 조절 t 세포 에피토프, 그의 조성물 및 용도 |
| JP2009548278A JP4866467B2 (ja) | 2007-01-30 | 2008-01-29 | 調節性t細胞エピトープ、組成物およびその使用 |
| CN200880011016.5A CN101687912B (zh) | 2007-01-30 | 2008-01-29 | 调节性t细胞表位、组合物及其用途 |
| AU2008211227A AU2008211227B2 (en) | 2007-01-30 | 2008-01-29 | Regulatory T cell epitopes, compositions and uses thereof |
| CA2677073A CA2677073C (en) | 2007-01-30 | 2008-01-29 | Regulatory t cell epitopes, compositions and uses thereof |
| EP11177634.0A EP2423222B2 (en) | 2007-01-30 | 2008-01-29 | Regulatory t cell epitopes, compositions and uses thereof |
| EP15153373.4A EP2896630B1 (en) | 2007-01-30 | 2008-01-29 | Regulatory t cell epitopes, compositions and uses thereof |
| IL200129A IL200129A (en) | 2007-01-30 | 2009-07-28 | Epitopic preparations of T cells that suppress the immune system |
| IL245478A IL245478B (en) | 2007-01-30 | 2016-05-04 | Regulatory t-cell epitopes, their preparations and uses |
| IL267186A IL267186B (en) | 2007-01-30 | 2019-06-10 | Regulatory t-cell epitopes, their preparations and uses |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US89834707P | 2007-01-30 | 2007-01-30 | |
| US60/898,347 | 2007-01-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008094538A2 true WO2008094538A2 (en) | 2008-08-07 |
| WO2008094538A3 WO2008094538A3 (en) | 2009-02-26 |
Family
ID=39674696
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2008/001148 Ceased WO2008094538A2 (en) | 2007-01-30 | 2008-01-29 | Regulatory t cell epitopes, compositions and uses thereof |
Country Status (11)
| Country | Link |
|---|---|
| US (18) | US7884184B2 (https=) |
| EP (13) | EP2423220B1 (https=) |
| JP (10) | JP4866467B2 (https=) |
| KR (3) | KR20100014871A (https=) |
| CN (4) | CN101687912B (https=) |
| AT (1) | ATE525392T1 (https=) |
| AU (1) | AU2008211227B2 (https=) |
| CA (6) | CA2963138C (https=) |
| IL (3) | IL200129A (https=) |
| MX (3) | MX347197B (https=) |
| WO (1) | WO2008094538A2 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2423222B1 (en) | 2007-01-30 | 2015-04-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| EP2162462B1 (en) * | 2007-07-03 | 2017-10-25 | Pharis Biotec GmbH | A cxc chemokine receptor 4 (cxcr4) antagonistic polypeptide |
| WO2018084731A1 (en) * | 2016-11-02 | 2018-05-11 | Przedsiębiorstwo Farmaceutyczne Okoniewscy „Vetos-Farma” Sp. Z O.O. | Immunosuppressive peptides and uses thereof |
| WO2021191426A1 (en) | 2020-03-27 | 2021-09-30 | Biotest Ag | Protein comprising at least one regulatory t cell activating epitope |
| WO2023284985A1 (en) | 2021-07-16 | 2023-01-19 | Dbv Technologies | Immunotherapeutic method for increasing cashew tolerance in a subject |
Families Citing this family (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012019168A2 (en) | 2010-08-06 | 2012-02-09 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| RU2013120302A (ru) | 2010-10-01 | 2014-11-20 | Модерна Терапьютикс, Инк. | Сконструированные нуклеиновые кислоты и способы их применения |
| JP6130307B2 (ja) | 2011-03-17 | 2017-05-17 | ザ ユニバーシティ オブ バーミンガム | 再指向性免疫療法 |
| EP2691101A2 (en) | 2011-03-31 | 2014-02-05 | Moderna Therapeutics, Inc. | Delivery and formulation of engineered nucleic acids |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| RU2648950C2 (ru) | 2011-10-03 | 2018-04-02 | Модерна Терапьютикс, Инк. | Модифицированные нуклеозиды, нуклеотиды и нуклеиновые кислоты и их применение |
| ES2618402T3 (es) * | 2011-12-13 | 2017-06-21 | Centre National De La Recherche Scientifique | Péptidos modificados y su uso para tratar enfermedades autoinmunitarias |
| CN104114572A (zh) | 2011-12-16 | 2014-10-22 | 现代治疗公司 | 经修饰的核苷、核苷酸和核酸组合物 |
| GB201203442D0 (en) | 2012-02-28 | 2012-04-11 | Univ Birmingham | Immunotherapeutic molecules and uses |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| AU2013243948A1 (en) | 2012-04-02 | 2014-10-30 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with human disease |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
| WO2014081507A1 (en) | 2012-11-26 | 2014-05-30 | Moderna Therapeutics, Inc. | Terminally modified rna |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US10023626B2 (en) | 2013-09-30 | 2018-07-17 | Modernatx, Inc. | Polynucleotides encoding immune modulating polypeptides |
| JP2016538829A (ja) | 2013-10-03 | 2016-12-15 | モデルナ セラピューティクス インコーポレイテッドModerna Therapeutics,Inc. | 低密度リポタンパク質受容体をコードするポリヌクレオチド |
| US20160310584A1 (en) * | 2013-12-06 | 2016-10-27 | The Broad Institute Inc. | Formulations for neoplasia vaccines |
| SG10201912038TA (en) | 2014-04-23 | 2020-02-27 | Modernatx Inc | Nucleic acid vaccines |
| WO2016054114A1 (en) | 2014-09-29 | 2016-04-07 | The Regents Of The University Of California | Compositions for expanding regulatory t cells (treg), and treating autoimmune and inflammatory diseases and conditions |
| US10213482B2 (en) | 2014-12-12 | 2019-02-26 | Immupharma France Sa | Methods of treating chronic inflammatory diseases |
| US10441649B2 (en) | 2015-02-02 | 2019-10-15 | The University Of Birmingham | Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes |
| WO2016179099A1 (en) | 2015-05-04 | 2016-11-10 | Epivax, Inc. | Modified h7 hemagluttinin glycoprotein of the influenza a/shanghai/2/2013 h7 sequence |
| JP2018517405A (ja) * | 2015-05-04 | 2018-07-05 | エピバックス インコーポレーテッド | インフルエンザa/上海/2/2013 h7配列の改変h7赤血球凝集素糖タンパク質 |
| ES2873846T5 (en) | 2015-11-19 | 2025-06-23 | Revitope Ltd | Functional antibody fragment complementation for a two-components system for redirected killing of unwanted cells |
| CA3077084A1 (en) * | 2017-10-05 | 2019-04-11 | Epivax, Inc. | Regulatory t cell epitopes |
| EP3622962A1 (en) * | 2018-09-14 | 2020-03-18 | advanceCOR GmbH | Short cyclic peptides for the treatment of graves' disease |
| EP3963335B1 (en) * | 2019-05-03 | 2024-08-21 | Epivax Therapeutics, Inc. | Neoantigens in cancer |
| US11911414B2 (en) | 2020-03-27 | 2024-02-27 | Epivax Inc. | Regulatory T cell epitopes |
| CN111856020B (zh) * | 2020-06-19 | 2022-09-27 | 南方医科大学南方医院 | 乙型肝炎病毒(hbv)特异性t细胞检测方法及其应用 |
| WO2022036193A2 (en) * | 2020-08-13 | 2022-02-17 | Epivax, Inc. | Regulatory t cell epitopes |
| WO2022067076A1 (en) * | 2020-09-25 | 2022-03-31 | Epivax, Inc. | Retro-inverso regulatory t cell epitopes |
| IL324608A (en) | 2023-05-19 | 2026-01-01 | Numab Therapeutics AG | Antibody variable domains and antibodies having decreased immunogenicity |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US5328470A (en) | 1989-03-31 | 1994-07-12 | The Regents Of The University Of Michigan | Treatment of diseases by site-specific instillation of cells or site-specific transformation of cells and kits therefor |
Family Cites Families (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2556219B1 (fr) | 1983-12-07 | 1987-06-26 | Merieux Inst | Nouveau medicament immunomodulateur, a base de fragments fc d'igg humaines |
| GB8725529D0 (en) | 1987-10-30 | 1987-12-02 | Delta Biotechnology Ltd | Polypeptides |
| US6162432A (en) | 1991-10-07 | 2000-12-19 | Biogen, Inc. | Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction |
| FR2686899B1 (fr) | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant. |
| US5817308A (en) * | 1994-02-14 | 1998-10-06 | University Of Rochester | Tolerogenic fusion proteins of immunoglobulins and methods for inducing and maintaining tolerance |
| DE4425115A1 (de) | 1994-07-15 | 1996-01-18 | Boehringer Mannheim Gmbh | Verfahren zur Modifizierung der Stabilität von Antikörpern |
| US5705154A (en) * | 1995-03-08 | 1998-01-06 | Schering Corporation | Humanized monoclonal antibodies against human interleukin-4 |
| EP0888125B1 (en) | 1996-03-20 | 2004-05-26 | Immunomedics, Inc. | GLYCOSYLATED IgG ANTIBODIES |
| US6090381A (en) * | 1997-02-11 | 2000-07-18 | Immunomedics, Inc. | Stimulation of an immune response with antibodies labeled with the . .alpha-galactosyl epitope |
| EP0981548A4 (en) * | 1997-04-30 | 2005-11-23 | Enzon Inc | GLYCOSYLATABLE SINGLE CHAIN ANTIGEN-BINDING PROTEINS, MANUFACTURE AND USE THEREOF |
| US6953675B2 (en) | 1997-11-06 | 2005-10-11 | Immunomedics, Inc. | Landscaped antibodies and antibody fragments for clinical use |
| GB9809951D0 (en) | 1998-05-08 | 1998-07-08 | Univ Cambridge Tech | Binding molecules |
| DE60040147D1 (de) | 1999-05-28 | 2008-10-16 | Targeted Genetics Corp | Methoden und zusammensetzungen zur reduktion des tumor-nekrosis-faktor-spiegels (tnf) bei tnf-assoziierten erkrankungen |
| US6445840B1 (en) | 1999-05-28 | 2002-09-03 | Omm, Inc. | Micromachined optical switching devices |
| EP2206720A1 (en) | 2000-04-12 | 2010-07-14 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US20020119492A1 (en) | 2000-07-10 | 2002-08-29 | Chirino Arthur J. | Protein design automation for designing protein libraries with altered immunogenicity |
| EP1368377A2 (en) * | 2001-03-15 | 2003-12-10 | MERCK PATENT GmbH | Modified interferon beta with reduced immunogenicity |
| WO2002079415A2 (en) | 2001-03-30 | 2002-10-10 | Lexigen Pharmaceuticals Corp. | Reducing the immunogenicity of fusion proteins |
| CA2466592A1 (en) * | 2001-11-12 | 2003-05-22 | Koen Hellendoorn | Modified anti-tnf alpha antibody |
| ATE414534T1 (de) | 2001-12-05 | 2008-12-15 | Circassia Ltd | Immunotherapeutische methoden und systeme |
| AU2002364587A1 (en) | 2001-12-21 | 2003-07-30 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| EP2261250B1 (en) | 2001-12-21 | 2015-07-01 | Human Genome Sciences, Inc. | GCSF-Albumin fusion proteins |
| AU2003244515A1 (en) | 2002-02-07 | 2003-09-02 | Novozymes Delta Limited | Albumin-fused anti-angiogenesis peptides |
| US7317091B2 (en) * | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| CA2485698C (en) | 2002-05-24 | 2012-03-27 | Jin Seog Seo | Peptide amidation process |
| WO2005056606A2 (en) * | 2003-12-03 | 2005-06-23 | Xencor, Inc | Optimized antibodies that target the epidermal growth factor receptor |
| DE60333228D1 (de) * | 2002-12-02 | 2010-08-12 | Amgen Fremont Inc | Gegen den tumor nekrose faktor gerichtete antikörper und deren verwendungen |
| CN1511958A (zh) * | 2002-12-31 | 2004-07-14 | 王小宁 | 一种筛选人组织相容性抗原(hla)的t细胞表面抗原肽的体系,及其在制备mhc-抗原肽多聚体中的应用 |
| CA2513213C (en) | 2003-01-22 | 2013-07-30 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2005035575A2 (en) * | 2003-08-22 | 2005-04-21 | Medimmune, Inc. | Humanization of antibodies |
| WO2005063815A2 (en) | 2003-11-12 | 2005-07-14 | Biogen Idec Ma Inc. | Fcϝ receptor-binding polypeptide variants and methods related thereto |
| LT2857418T (lt) | 2004-02-06 | 2017-09-25 | University Of Massachusetts | Antikūnai prieš clostridium difficile toksinus ir jų panaudojimas |
| ES2567634T3 (es) | 2004-02-09 | 2016-04-25 | Human Genome Sciences, Inc. | Proteínas de fusión de albúmina |
| ES2424643T3 (es) * | 2004-03-19 | 2013-10-07 | Merck Patent Gmbh | Proteínas bouganina modificadas, citotoxinas y procedimientos y usos de las mismas |
| CN1961003B (zh) * | 2004-03-31 | 2013-03-27 | 健泰科生物技术公司 | 人源化抗TGF-β抗体 |
| KR20070057818A (ko) | 2004-08-03 | 2007-06-07 | 트랜스테크 파르마, 인크. | Rage 융합 단백질 및 이의 사용 방법 |
| JP5188804B2 (ja) | 2004-08-03 | 2013-04-24 | トランステック ファーマ,インコーポレイティド | Rage融合タンパク質及びその使用方法 |
| CU23504A1 (es) * | 2004-09-24 | 2010-04-13 | Ct Ingenieria Genetica Biotech | Péptidos y derivados tipo apl de la hsp60 y composiciones farmacéuticas |
| US7488804B2 (en) | 2005-02-02 | 2009-02-10 | The Regents Of The University Of California | Modified fusion molecules for treatment of allergic disease |
| ES2417133T3 (es) * | 2005-02-03 | 2013-08-06 | Antitope Limited | Anticuerpos y proteínas humanas |
| WO2007002223A2 (en) | 2005-06-20 | 2007-01-04 | Medarex, Inc. | Cd19 antibodies and their uses |
| MX2008001865A (es) | 2005-08-12 | 2008-04-15 | Human Genome Sciences Inc | Proteinas de fusion de albumina. |
| CN100349921C (zh) * | 2005-11-17 | 2007-11-21 | 中国人民解放军第四军医大学 | 破伤风毒素t细胞表位多肽与人b淋巴细胞刺激因子融合蛋白及其制备 |
| EP2253644B1 (en) * | 2005-12-20 | 2013-10-16 | Bristol-Myers Squibb Company | Compositions and methods for producing a composition |
| KR101516823B1 (ko) * | 2006-03-17 | 2015-05-07 | 바이오겐 아이덱 엠에이 인코포레이티드 | 안정화된 폴리펩티드 조성물 |
| GB0605735D0 (en) | 2006-03-22 | 2006-05-03 | Immunobiology Ltd | Composition and method for mediating an immune response |
| US8334365B2 (en) | 2006-06-07 | 2012-12-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| AT503861B1 (de) † | 2006-07-05 | 2008-06-15 | F Star Biotech Forsch & Entw | Verfahren zur manipulation von t-zell-rezeptoren |
| EP2520935A3 (en) | 2006-08-09 | 2013-02-13 | Homestead Clinical Corporation | Organ-specific proteins and methods of their use |
| AU2008211227B2 (en) | 2007-01-30 | 2014-04-17 | Epivax, Inc. | Regulatory T cell epitopes, compositions and uses thereof |
| AU2008261042A1 (en) | 2007-06-08 | 2008-12-11 | Dow Global Technologies Inc. | Expression of soluble antibody fragment by truncation of CH1 domain |
-
2008
- 2008-01-29 AU AU2008211227A patent/AU2008211227B2/en not_active Ceased
- 2008-01-29 EP EP20110177625 patent/EP2423220B1/en not_active Not-in-force
- 2008-01-29 AT AT08713321T patent/ATE525392T1/de not_active IP Right Cessation
- 2008-01-29 EP EP20120153174 patent/EP2450371B1/en not_active Not-in-force
- 2008-01-29 MX MX2015014429A patent/MX347197B/es unknown
- 2008-01-29 JP JP2009548278A patent/JP4866467B2/ja not_active Expired - Fee Related
- 2008-01-29 EP EP12153171A patent/EP2450369A1/en not_active Withdrawn
- 2008-01-29 CA CA2963138A patent/CA2963138C/en active Active
- 2008-01-29 EP EP12153166A patent/EP2450367A1/en not_active Withdrawn
- 2008-01-29 CN CN200880011016.5A patent/CN101687912B/zh not_active Expired - Fee Related
- 2008-01-29 KR KR1020097017996A patent/KR20100014871A/ko not_active Ceased
- 2008-01-29 WO PCT/US2008/001148 patent/WO2008094538A2/en not_active Ceased
- 2008-01-29 CA CA2677073A patent/CA2677073C/en active Active
- 2008-01-29 EP EP20110177630 patent/EP2423221B1/en not_active Not-in-force
- 2008-01-29 EP EP12153170A patent/EP2450368A1/en not_active Withdrawn
- 2008-01-29 KR KR1020177008095A patent/KR20170037677A/ko not_active Ceased
- 2008-01-29 CA CA3161849A patent/CA3161849A1/en active Pending
- 2008-01-29 CA CA2915168A patent/CA2915168C/en active Active
- 2008-01-29 KR KR1020147024226A patent/KR101722305B1/ko not_active Expired - Fee Related
- 2008-01-29 EP EP15153373.4A patent/EP2896630B1/en not_active Not-in-force
- 2008-01-29 US US12/021,832 patent/US7884184B2/en active Active
- 2008-01-29 EP EP20110177609 patent/EP2423219B1/en not_active Not-in-force
- 2008-01-29 CN CN202011190692.2A patent/CN112279911A/zh active Pending
- 2008-01-29 CN CN201310685046.7A patent/CN103755789B/zh not_active Expired - Fee Related
- 2008-01-29 EP EP12153164A patent/EP2450366A1/en not_active Withdrawn
- 2008-01-29 EP EP20120153177 patent/EP2450372B1/en not_active Not-in-force
- 2008-01-29 CN CN201610958012.4A patent/CN107011431B/zh not_active Expired - Fee Related
- 2008-01-29 CA CA3001783A patent/CA3001783C/en active Active
- 2008-01-29 CA CA3034396A patent/CA3034396C/en active Active
- 2008-01-29 EP EP08713321.1A patent/EP2125883B2/en not_active Not-in-force
- 2008-01-29 EP EP11177634.0A patent/EP2423222B2/en not_active Not-in-force
- 2008-01-29 EP EP12153173A patent/EP2450370A1/en not_active Withdrawn
- 2008-01-29 MX MX2009008230A patent/MX2009008230A/es active IP Right Grant
-
2009
- 2009-07-28 IL IL200129A patent/IL200129A/en active IP Right Grant
- 2009-07-30 MX MX2018015933A patent/MX2018015933A/es unknown
-
2010
- 2010-12-29 US US12/981,098 patent/US20110182921A1/en not_active Abandoned
-
2011
- 2011-11-11 JP JP2011247226A patent/JP5643739B2/ja not_active Expired - Fee Related
-
2014
- 2014-07-30 JP JP2014154372A patent/JP6121369B2/ja not_active Expired - Fee Related
-
2015
- 2015-09-17 US US14/857,693 patent/US10213496B2/en active Active
-
2016
- 2016-05-04 IL IL245478A patent/IL245478B/en active IP Right Grant
-
2017
- 2017-03-29 JP JP2017064298A patent/JP6472476B2/ja not_active Expired - Fee Related
-
2018
- 2018-06-22 US US16/015,828 patent/US11045530B2/en not_active Expired - Fee Related
- 2018-06-22 US US16/015,796 patent/US10925939B2/en not_active Expired - Fee Related
- 2018-06-22 US US16/015,814 patent/US11045528B2/en not_active Expired - Fee Related
- 2018-06-22 US US16/015,802 patent/US10925940B2/en not_active Expired - Fee Related
- 2018-06-22 US US16/015,822 patent/US11045529B2/en not_active Expired - Fee Related
- 2018-06-22 US US16/015,784 patent/US10751397B2/en active Active
- 2018-06-22 US US16/015,837 patent/US11045531B2/en not_active Expired - Fee Related
- 2018-10-16 US US16/161,674 patent/US10925941B2/en not_active Expired - Fee Related
- 2018-10-16 US US16/161,671 patent/US11045532B2/en not_active Expired - Fee Related
-
2019
- 2019-01-22 JP JP2019008352A patent/JP2019089793A/ja active Pending
- 2019-03-04 US US16/291,372 patent/US10925942B2/en not_active Expired - Fee Related
- 2019-03-04 US US16/291,658 patent/US10980867B2/en not_active Expired - Fee Related
- 2019-06-10 IL IL267186A patent/IL267186B/en active IP Right Grant
- 2019-08-02 US US16/530,104 patent/US20190351036A1/en not_active Abandoned
-
2021
- 2021-01-28 JP JP2021011596A patent/JP2021073255A/ja not_active Withdrawn
- 2021-04-21 US US17/236,463 patent/US11844826B2/en active Active
- 2021-04-21 US US17/236,534 patent/US12016909B2/en active Active
- 2021-04-22 JP JP2021072455A patent/JP2021107444A/ja active Pending
- 2021-04-22 JP JP2021072446A patent/JP2021107443A/ja active Pending
-
2022
- 2022-01-14 US US17/576,321 patent/US20220211827A1/en not_active Abandoned
- 2022-09-29 JP JP2022155804A patent/JP2022177270A/ja active Pending
-
2024
- 2024-03-06 JP JP2024033497A patent/JP2024059975A/ja active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US5328470A (en) | 1989-03-31 | 1994-07-12 | The Regents Of The University Of Michigan | Treatment of diseases by site-specific instillation of cells or site-specific transformation of cells and kits therefor |
Non-Patent Citations (60)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO. |
| AHLERS, J. ET AL., J. CLIN. INVEST., vol. 108, 2001, pages 1677 - 1685 |
| ALLEN, P. ET AL., INT. IMMUNOL., vol. 1, 1989, pages 141 - 50 |
| AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1992 |
| BAXEVANIS, C. ET AL., EUR. J. IMMUNOL., vol. 16, 1986, pages 1013 - 1016 |
| BISCHOF, F. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 98, 2 October 2001 (2001-10-02), pages 12168 - 73 |
| BOWIE, J. ET AL., SCIENCE, vol. 247, 1990, pages 1306 - 1310 |
| CHEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 3054 - 3057 |
| COBBOLD, S. ET AL., IMMUNOL REV., vol. 213, 2006, pages 239 - 55 |
| CURRIER, J. ET AL., J. IMMUNOL. METHODS, vol. 260, 2002, pages 157 - 72 |
| D'AMBROSIO, D. ET AL., J. IMMUNOL., vol. 161, 1998, pages 5111 - 5 |
| DE GROOT, A ET AL., AIDS RES. HUM. RETROVIRUSES, vol. 13, 1997, pages 539 - 541 |
| DE GROOT, A. ET AL., AIDS RES. HUM. RETROVIRUSES, vol. 13, 1997, pages 539 - 541 |
| DE GROOT, A. ET AL., IMMUNOL. CELL BIOL., vol. 80, 2002, pages 255 - 269 |
| DE GROOT, A. ET AL., VACCINE, vol. 19, 2001, pages 4385 - 95 |
| DE GROOT, A. ET AL., VACCINE, vol. 21, 2003, pages 4486 - 504 |
| DE GROOT, A.; BERZOFSKY, J., METHODS, vol. 34, 2004, pages 425 - 428 |
| DURINOVIC-BELLO, I. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 11683 - 11688 |
| EI-AMINE, M, INT. IMMUNOL.,, vol. 14, 2002, pages 761 - 766 |
| EI-AMINE, M. ET AL., J. IMMUNOL., vol. 165, 2000, pages 5631 - 5636 |
| FENG, I. ET AL., J BIOMED SCI., vol. 14, 2006, pages 43 - 57 |
| HJELM, F. ET AL., SCAND. J. IMMUNO/., vol. 64, 2006, pages 177 - 184 |
| HOCHWELLER, K. ET AL., CURR. MO/. MED., vol. 6, 2006, pages 631 - 43 |
| HUANG, X. ET AL., J. IMMUNOL., vol. 175, 2005, pages 4283 - 4291 |
| HUDGENS, M. ET AL., J. IMMUNOL. METHODS, vol. 288, 2004, pages 19 - 34 |
| JORDAN, S. ET AL., AM. J. TRANSPLANT., vol. 6, 2006, pages 459 - 66 |
| JOSHI, T. ET AL., MOL. IMMUNOL., vol. 43, 2006, pages 839 - 850 |
| KARLSSON M. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 96, 1999, pages 2244 - 2249 |
| KLEE, L.; ZAND, R., NEUROINFORMATICS, vol. 2, 2004, pages 59 - 70 |
| KNOPF, P. ET AL., IMMUNOL. CELL BIOL., 8 January 2008 (2008-01-08) |
| LEI, T. ET AL., CELL. IMMUNOL., vol. 235, 2005, pages 12 - 20 |
| MAILLERE, B. ET AL., MOL. IMMUNOL., vol. 32, 1995, pages 1377 - 85 |
| MONNEAUX, F. ET AL., J. IMMUNOL., vol. 175, 2005, pages 5839 - 5847 |
| MUDD, P. ET AL., SCAND. J. IMMUNOL., vol. 64, 2006, pages 211 - 8 |
| MWAU, M. ET AL., AIDS RES. HUM. RETROVIRUSES, vol. 18, 2002, pages 611 - 8 |
| NAGATA, K. ET AL., J. IMMUNOL., vol. 162, 1999, pages 1278 - 86 |
| NGUYEN, V. ET AL., BIOL. BLOOD MARROW TRANSPLANT, vol. 12, 2006, pages 995 - 1009 |
| NOVAK, E. ET AL., J. IMMUNOL., vol. 166, 2001, pages 6665 - 6670 |
| PEARSE, R, IMMUNITY, vol. 10, 1999, pages 753 - 760 |
| PHILLIPS, W. ET AL., INT. REV. IMMUNOL., vol. 24, 2005, pages 501 - 17 |
| RAVETCH, J. ET AL., SCIENCE, vol. 234, 1986, pages 718 - 725 |
| REIJONEN, H.; KWOK W., METHODS, vol. 29, 2003, pages 282 - 288 |
| REITAN, S.; HANNESTAD, K., PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 7588 - 7593 |
| RUITENBERG, J. ET AL., BMC IMMUNOL., vol. 7, 2006, pages 11 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCHAFER, J. ET AL., VACCINE, vol. 16, 1998, pages 1880 - 1884 |
| SHEVACH, E. ET AL., IMMUNOL. REV., vol. 212, 2006, pages 60 - 73 |
| SHEVACH, E., NAT. REV. LMMUNOL., vol. 2, 2002, pages 389 - 400 |
| SHIOJI, K. ET AL., CIRC. RES., vol. 89, 2001, pages 540 - 546 |
| SOUTHWOOD, S. ET AL., J. IMMUNOL., vol. 160, 1998, pages 3363 - 3373 |
| ST. CLAIR, E. ET AL., ANNU. REV. MED., vol. 58, 2006, pages 329 - 346 |
| STOCK, P ET AL., CURR. OPIN. ALLERGY CLIN. IMMUNOL., vol. 6, 2006, pages 12 - 16 |
| STURNIOLO, T. ET AL., NAT. BIOTECHNOL., vol. 17, 1999, pages 555 - 561 |
| SUMIDA, T. ET AL., ARTHRITIS RHEUM., vol. 40, 1997, pages 2271 - 2273 |
| TANG, Q.; BLUESTONE, J., LMMUNOL. REV., vol. 212, 2006, pages 217 - 37 |
| WING, K.; SAKAGUCHI, S., CURR. OPIN. ALLERGY CLIN. IMMUNOL., vol. 6, 2006, pages 482 - 488 |
| WOHLLEBEN, G.; ERB, K., CURR. PHARM. DES., vol. 12, 2006, pages 3281 - 92 |
| ZAMBIDIS, E.; SCOTT, D., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 5019 - 5024 |
| ZHAO, Y. ET AL., J. IMMUNOTHER., vol. 29, 2006, pages 398 - 406 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2423222B1 (en) | 2007-01-30 | 2015-04-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| EP2423222B2 (en) † | 2007-01-30 | 2020-07-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| EP2162462B1 (en) * | 2007-07-03 | 2017-10-25 | Pharis Biotec GmbH | A cxc chemokine receptor 4 (cxcr4) antagonistic polypeptide |
| WO2018084731A1 (en) * | 2016-11-02 | 2018-05-11 | Przedsiębiorstwo Farmaceutyczne Okoniewscy „Vetos-Farma” Sp. Z O.O. | Immunosuppressive peptides and uses thereof |
| WO2021191426A1 (en) | 2020-03-27 | 2021-09-30 | Biotest Ag | Protein comprising at least one regulatory t cell activating epitope |
| WO2023284985A1 (en) | 2021-07-16 | 2023-01-19 | Dbv Technologies | Immunotherapeutic method for increasing cashew tolerance in a subject |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11844826B2 (en) | Regulatory T cell epitopes, compositions and uses thereof | |
| AU2014201846B2 (en) | Regulatory t cell epitopes, compositions and uses thereof | |
| AU2017268600B2 (en) | Regulatory T cell epitopes, compositions and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200880011016.5 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08713321 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200129 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2009548278 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2009/008230 Country of ref document: MX Ref document number: 2677073 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008713321 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008211227 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020097017996 Country of ref document: KR |
|
| ENP | Entry into the national phase |
Ref document number: 2008211227 Country of ref document: AU Date of ref document: 20080129 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020147024226 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 245478 Country of ref document: IL |