WO2008021560A2 - Dpp-iv resistant gip hybrid polypeptides with selectable properties - Google Patents
Dpp-iv resistant gip hybrid polypeptides with selectable properties Download PDFInfo
- Publication number
- WO2008021560A2 WO2008021560A2 PCT/US2007/018415 US2007018415W WO2008021560A2 WO 2008021560 A2 WO2008021560 A2 WO 2008021560A2 US 2007018415 W US2007018415 W US 2007018415W WO 2008021560 A2 WO2008021560 A2 WO 2008021560A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gip
- compound
- analog
- exendin
- amylin
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/02—Non-specific cardiovascular stimulants, e.g. drugs for syncope, antihypotensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to peptide chemistry and pharmaceuticals, and more particularly to novel gastric inhibitory peptide ("GIP”) analog and GIP -containing hybrid polypeptides with selectable properties. It further relates to the use of these and other GIP compounds either alone or in adjunct with other compounds such as glucagon-like peptide 1 (“GLPl”), exendin-4, or amylin polypeptides, to treat metabolic disorders and conditions.
- GIP gastric inhibitory peptide
- Incretin peptides are hormones and peptide mimetics that cause an increase in the amount of insulin released when glucose levels are normal or particularly when they are elevated. These incretin peptides have other actions beyond the initial incretin action defined by insulin secretion. For instance, they may also have actions to reduce glucagon production and delay gastric emptying. In addition, they may have actions to improve insulin sensitivity, and they may increase islet cell neogenesis - the formation of new islets.
- incretin effect developed from the observation that insulin responses to oral glucose exceeded those measured after intravenous administration of equivalent amounts of glucose. It was concluded that gut-derived factors, or incretins, influenced postprandial insulin release. Nutrient entry into the stomach and proximal gastrointestinal tract causes release of incretin hormones, which then stimulate insulin secretion. This insulinotropism, or ability to stimulate insulin secretion, can be quantified by comparing insulin or C-peptide responses to oral vs. intravenous glucose loads. In this way, it has been shown that the incretin effect is responsible for about 50% to 70% of the insulin response to oral glucose in healthy individuals.
- GIP and GLP-I both belong to the glucagon peptide superfamily and thus share amino acid sequence homology.
- GIP and GLP-I are secreted by specialized cells in the gastrointestinal tract and have receptors located on islet cells as well as other tissues. As incretins, both are secreted from the intestine in response to ingestion of nutrients, which results in enhanced insulin secretion.
- DPP-IV ubiquitous enzyme dipeptidyl peptidase IV
- Native human GIP is a single 42-amino acid peptide synthesized in and secreted by specialized enteroendocrine K-cells. These cells are concentrated primarily in the duodenum and proximal jejunum, although they also can be found throughout the intestine.
- the main stimulant for GIP secretion is ingestion of carbohydrate- and lipid-rich meals. Following ingestion, circulating plasma GIP levels increase 10- to 20- fold. The half-life of intact GIP is estimated to be approximately 7.3 minutes in healthy subjects and 5.2 minutes in diabetic subjects.
- GIP receptor antagonists GIP peptide antagonists
- GIP receptor knockout mice GIP receptor knockout mice
- Blocking GIP binding to its receptor results in attenuated glucose-dependent insulin secretion following oral glucose load in rats and mice.
- administration of GIP antagonists or GIP antisera markedly reduces the postprandial insulin release in rats.
- GJP receptor knockout mice demonstrate normal fasting glucose levels but mild glucose intolerance following oral glucose loads. Interestingly, they also exhibit resistance to diet-induced obesity following months of high-fat feeding. Additionally, in the leptuv ⁇ ieficient ob/ob mouse, the GIP receptor knockout genotype appears to decrease the extent of obesity that develops.
- GIP infusion has consistently demonstrated stimulation of insulin secretion in isolated rat islets, isolated perfused rat pancreas, dogs, and humans.
- stepwise euglycemic mild hyperglycemic (54 mg/dL above basal), and moderate hyperglycemic (143 mg/dL above basal) clamps, it has been demonstrated that GIP infusion results in insulin secretion only in the presence of elevated glucose concentrations.
- GIP is not glucagonotropic in normal humans during either euglycemic or hyperglycemic conditions.
- the effect of endogenously released GIP appears to be an important mechanism of postprandial insulin secretion and does not appear to play a role in the fasting state.
- GIP has many non-incretin effects as well. Unlike other insulin secretagogues, GIP stimulates beta- cell proliferation and cell survival in INS-I islet cell-line studies. Furthermore, animal studies have suggested a role for GIP in lipid metabolism by stimulating lipoprotein lipase activity, inducing fatty acid incorporation into adipose tissue and stimulating fatty acid synthesis. However, in humans, there is no clear evidence for an effect of GIP on lipid metabolism. GIP also appears to stimulate glucagon secretion from the isolated perfused rat pancreas, although human studies have not demonstrated any significant influence on glucagon secretion. Furthermore, unlike GLP-I, GIP appears to act by accelerating emptying of the stomach rather than by inhibiting gastrointestinal motility.
- the GIP-receptor a member of the G-protein-coupled receptor family has a high specificity for GIP and does not bind other peptides of the glucagon family. For this reason, GLP-I /GIP chimeric peptides show nearly no affinity for the GIP-receptor. From such studies it has been concluded that the GIP(I -30) sequence of the GIP(I -42) is sufficient for recognizing the receptor. GIP(6-30)-amide contains the high affinity binding region of GIP(I -42) but exhibits antagonist activity.
- metabolic diseases and disorders including those which can be alleviated by control of plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions, and conditions and disorders including, but not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.
- the methods comprise administering a therapeutically or prophylactically effective amount of a GIP or GIP analog, fragment or derivative thereof, or a GIP hybrid or derivatives thereof as described herein, alone (monotherapy) or in combination with another agent or therapy (adjunct therapy), for example a glucose lowering agent (e.g., antidiabetic) or agents or methods that inhibit or reduce gastric emptying (examples of such agents are presented herein), to a subject in need thereof.
- a glucose lowering agent e.g., antidiabetic
- agents or methods that inhibit or reduce gastric emptying examples of such agents are presented herein
- GIP bioactivity as part of a GIP hybrid having one or more other hormonal bio-activities, e.g., pramlintide, exendin, BNP
- compounds with one or more selectable functions will have the additional benefit of a property of a GIP bio-activity such as lowering plasma glucose, increasing insulin secretion, without the side effects associated with other incretin molecules.
- a GIP-sCT hybrid compound of the invention can have a selectable property of a salmon calcitonin, such as decreasing bone loss and bone resorption or reducing cartilage turnover (chondroprotection), and a property of a GIP, such as plasma glucose lowering (concomitant with an anti-catabolic aspect as described herein) and/or inhibiting bone resorption and maintaining or increasing bone density.
- a GIP hybrid with such selectable properties can enhance treatment of osteoporosis or conditions of high cartilage turnover, particularly in those who can also benefit from glycemic control, such as subjects with diabetes or under going critical care.
- novel GIP analogs having one or more enhanced properties.
- the GIP analogs have increased resistance to DPP-IV or to other proteases, such as those found in human plasma and/or on kidney brush border membranes, which increases in vivo half-life.
- the GJP analogs have at least one substitution, modification, insertion or deletion in amino acids 4-30. These changes can provide enhanced properties such as increased GIP receptor binding, increased receptor selectivity, and/or increased resistance to degradation by chemical and/or proteolytic means.
- the GIP analog further has least 50% sequence identity to native GIP(l-30), native GP(1-14), native GIP(19-30) or native GIP(l-42) over the entire length of each molecule, and at least one biological property of a GIP.
- novel GIP analog polypeptides include unnatural amino acids, such as a D amino acid.
- a GIP analog or hybrid is modified to have reduced renal clearance, such as by fatty acyl derivatization.
- novel GIP-containing hybrid polypeptides with selectable properties.
- the hybrid polypeptides exhibit at least one hormonal activity.
- the GEP-hybrid polypeptides comprise at least two biologically active ("bio-active") peptide hormone modules covalently linked together, wherein at least one of the bio-active peptide hormone modules comprises a GIP polypeptide.
- the other bio-active peptide hormone module can be: (a) a native component peptide hormone, (b) an analog or derivative of a native component peptide hormone that retains hormonal activity, (c) a fragment of a native component peptide hormone that retains hormonal activity, (d) a fragment of analogs or derivatives of a native component peptide hormone that retains hormonal activity, (e) a structural motif of a native component peptide hormone that imparts a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic to the hybrid polypeptide; or (f) a structural motif of analogs or derivatives of a native component peptide hormone that imparts a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
- a GIP -hybrid polypeptide comprises at least two bio-active peptide hormone modules covalently linked together, wherein at least one of the bio-active peptide hormone modules is comprised of a G-P polypeptide, and the second exhibits at least one hormonal activity of a component peptide hormone.
- the bio-active peptide hormone modules are independently selected from: component peptide hormones, fragments of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones, analogs and derivatives of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones, and fragments of analogs and derivatives of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones.
- the GIP-hybrid polypeptides comprise a novel GIP analog polypeptide of the invention covalently linked to at least one additional bio-active peptide hormone module.
- the bio-active peptide hormone module is a peptidic enhancer.
- the GIP hybrid polypeptide of the invention will exhibit at least 50% sequence identity to a native GIP(I -30), native GIP(I-H) 5 native GIP(19-30) or native GIP(l-42) over the entire length of the GIP portion.
- the GIP portion can comprise a novel GIP analog further comprising a peptidic enhancer, such as a trp-cage motif.
- a GIP hybrid can comprise a GIP portion that is a GIP analog, fragment or derivative thereof with a peptidic enhancer, such as a trp-cage motif, and having enhanced properties, that is linked covalently to an additional bio-active peptide hormone module, such as another hormone or growth factor or fragment thereof.
- a peptidic enhancer such as a trp-cage motif
- Component peptide hormones for use in a GIP-hybrid polypeptide include: amylin, adrenomedullin (ADM), calcitonin (CT), calcitonin gene related peptide (CGRP), intermedin, cholecystokinin ("CCK”), leptin, peptide YY (PYY), glucagon-like peptide-1 (GLP-I), glucagon-like peptide 2 (GLP-2), oxyntomodulin (OXM), natriuretic peptides (e.g.
- ANP, BNP, CNP or urodilatin urocortin family peptide, e.g., Ucn-2 and Ucn-3
- neuromedin family peptide e.g. neuromedin U25 or splice variants, exendin-3 and exendin-4.
- the GIP portion is combined with a gastrin /CCK receptor ligand; an amylin receptor ligand; a calcitonin receptor ligand; a CGRP receptor ligand, a PYY receptor ligand, an EGF receptor ligand; a Glucagon-like peptide 1 receptor ligand; a Glucagon-like peptide 2 receptor ligand; a gastric inhibitory polypeptide (GIP) receptor ligand; a keratinocyte growth factor (KGF) receptor 1 ligand; a dipeptidyl peptidase IV inhibitor; a REG protein receptor ligand; a Growth Hormone receptor ligand; a Prolactin (PRL) receptor ligand; an Insulin-like Growth Factor (IGF) receptor ligand; PTH-related protein (PTHrP) receptor ligand; hepatocyte growth factor (HGF) receptor ligand; a bone
- desirable GIP hybrid polypeptides include an N-terminal GIP or novel GIP analog fragment in combination with a C-terminal polypeptide or fragment thereof having a glucose lowering activity (e.g., antidiabetics, exendin) or the ability to inhibit or reduce gastric emptying.
- a glucose lowering activity e.g., antidiabetics, exendin
- Such desirable GIP hybrids include an N-terminal GIP fragment or novel GIP analog or derivative fragment in combination with a C-terminal exendin, GLPl, pramlintide, amylin, CCK, gastrin, PYY, secretin, GRP, neuromedins, urocortin, calcitonin, or salmon calcitonin, a natriuretic peptide (e.g., ANP, BNP, CNP, urodilatin) or analog (e.g. amylin-sCT-amylin chimera), derivative or fragment thereof.
- a natriuretic peptide e.g., ANP, BNP, CNP, urodilatin
- analog e.g. amylin-sCT-amylin chimera
- desirable GIP hybrids include a C-terminal GIP or novel GIP analog fragment in combination with an N-terminal polypeptide or fragment thereof having a glucose lowering activity (e.g., antidiabetics, exendin) or the ability to inhibit or reduce gastric emptying.
- glucose lowering activity e.g., antidiabetics, exendin
- the chimeric polypeptides can include a C- te ⁇ ninal GIP, a novel GIP analog, or fragment thereof, in combination with a N-terminal exendin, GLPl, pramlintide, amylin, CCK, gastrin, PYY, secretin, GRP, neuromedins, urocortin, calcitonin, or salmon calcitonin, a natriuretic peptide or analog, derivative or fragment thereof.
- the peptidic enhancer is a tail or terminal extension derived from a second hormone, such as exendin, human GLP-I, or frog GLP-I, or is empirically determined.
- the peptidic enhancer is a heterologous C-terminal tail or terminal extension to the GIP portion.
- the GIP portion can be native GIP, an active fragment thereof, or their analogs or derivatives.
- the GIP portion of the hybrid comprises at least one modification, substitution, deletion or addition that provides one or more enhanced properties, e.g.
- the tail comprises a Trp-cage motif sequence.
- the GIP analog polypeptide portion includes unnatural amino acids, such as a D amino acid, e.g. that inhibits to reduces the rate of proteolysis by DPP-W.
- the present invention also provides for the treatment and prevention of metabolic diseases and disorders, particularly those which can be alleviated by control of plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions.
- metabolic diseases and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes, diabetes complications (e.g.
- neuropathic pain treating with GIP hybrids comprising an amylin family hormone module for example
- retinopathy nephropathy
- conditions of insufficient pancreatic beta cell mass based on, e.g., islet neogenesis actions of exendin-4 and GLP-I.
- the method comprises administering a therapeutically or prophylactically effective amount of a GIP or an analog or derivative thereof, including a novel GIP analog of the invention, or a GIP- hybrid of the invention, including one having a peptidic enhancer, to a subject in need thereof.
- the polypeptides of the invention can be provided as monotherapy.
- the GIP compound can be administered in adjunct therapy with a glucose lowering agents (e.g., antidiabetics) or agents or methods that inhibit or reduce gastric emptying. Examples of such agents are presented herein.
- an adjunct therapy method for reducing blood glucose levels of a subject comprising administering to the subject a therapeutically effective amount of an exendin or an exendin agonist, such as wherein said exendin agonist is a peptide, in adjunct therapy with a GIP or novel GIP analog of the invention, or an effective amount of a GIP-exendin hybrid.
- Compounds of the invention can also be useful for potentiating, inducing, enhancing or restoring glucose responsivity in pancreatic islets or cells. These actions may also be used to treat or prevent conditions associated with metabolic disorders such as those described above and in U.S. Patent Application No. US20040228846, incorporated herein by reference in its entirety.
- the method comprises administering a therapeutically or prophylactically effective amount of a GDP or an analog or derivative thereof, including a novel GIP analog of the invention, or a GIP-hybrid of the invention, including those having a peptidic enhancer, to a subject in need thereof.
- the subject is an obese or overweight subject.
- any subject including those with a body mass index of less than 30, who needs or wishes to reduce body weight is included in the scope of "obese.”
- Subjects who are insulin resistant, glucose intolerant, or have any form of diabetes mellitus (e.g., type 1, 2 or gestational diabetes) can benefit from this method.
- Compounds of the invention can also be useful in treating or preventing other conditions associated with obesity including stroke, cancer (e.g.,. endometrial, breast, prostate, and colon cancer), gallbladder disease, sleep apnea, reduced fertility, and osteoarthritis, (see Lyznicki et al, Am. Fam. Phys.
- the method comprises administering a therapeutically or prophylactically effective amount of a GP compound, alone or in combination with a glucose lowering agent (e.g., antidiabetic) or agent or method that inhibits or reduces gastric emptying.
- a glucose lowering agent e.g., antidiabetic
- GIP compounds can be used in methods of reducing food intake, reducing appetite, inducing satiety, reducing nutrient availability, reducing caloric efficiency, causing weight loss, affecting body composition, altering body energy content or energy expenditure, and improving lipid profile (including reducing LDL cholesterol and triglyceride levels and/or changing HDL cholesterol levels) wherein the methods comprise administering to a subject an effective amount of a GIP compound, particularly a GIP hybrid compound, of the invention.
- the methods of the invention are used to treat or prevent conditions or disorders which can be alleviated by reducing nutrient availability in a subject in need thereof, comprising administering to said subject a therapeutically or prophylactically effective amount of a GIP compound of the invention.
- Conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes, diabetes complications (neuropathy (based on, e.g., neurotrophic actions of exendin-4), neuropathic pain (based on, e.g., amylin action), retinopathy, nephropathy, conditions of insufficient pancreatic beta cell mass (based on, e.g., islet neogenesis actions of exendin-4 and GLP-I).
- diabetes complications neuropathy (based on, e.g., neurotrophic actions of exendin-4), neuropathic pain (based on, e.g., amylin action), retinopathy, nephropathy, conditions of insufficient pancreatic beta cell mass (based on, e.g., islet neogenesis actions of exendin-4 and GLP-I).
- the method comprises administering a therapeutically or prophylactically effective amount of a GP compound, alone or in combination with a glucose lowering agent (e.g., antidiabetic) or agent or method that inhibits or reduces gastric emptying.
- a glucose lowering agent e.g., antidiabetic
- compounds of the invention may be used to treat or prevent hypotension and conditions associated therewith.
- GBP analogs and hybrids are useful for decreasing or inhibiting bone resorption and maintaining or increasing bone density.
- GIP hybrids are useful to treat these conditions as well as decreasing plasma calcium, and/or inducing an analgesic effect, particularly to treat bone disorders such as osteopenia and osteoporosis, and treating painful neuropathy.
- such hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- a GIP-sCT or GIP-amylm/sCT hybrid compound of the invention can have a selectable property of a salmon calcitonin or amylin/sCT/Amylin chimera, such as decreasing bone loss and bone resorption or reducing cartilage turnover (chondroprotection), and a property of a GIP, such as plasma glucose lowering (concomitant with an anabolic aspect as described herein) and/or inhibiting bone resorption and maintaining or increasing bone density.
- a GIP hybrid with such selectable properties can enhance treatment of osteoporosis or conditions of high cartilage turnover, particularly in those who can also benefit from glycemic control, such as subjects with diabetes or under going critical care.
- GIP compounds particularly GIP analogs, extended half-life GIP hybrids (e.g. DPP-IV cleavage resistant (such as a D-Ala2, N-Acetyl or N-pyroglutamyl analogs) optionally further comprising a peptidic enhancer such as a heterologous C-terminal tail, and GIP hybrids comprising other hormone modules known to provide beneficial cardiovascular effects, are useful to treat cardiovascular disease and related conditions.
- GIP compounds increase cardiac contractility (dp/dt), decrease blood pressure (for example by acute vasodilatation), decrease systolic pressure, decrease diastolic pressure, and can provide a direct beneficial action on cardiac cells.
- GIP compounds also improve cardiac function via metabolic actions, e.g. glucose lowering, insulin secretion, beta cell proliferation.
- the GIP compounds are surprisingly even more beneficial.
- Compounds of the invention can also be useful in the treatment or prevention of any number of gastrointestinal disorders that are associated with excess gastric secretion, excess intestinal electrolytes and water secretion as well as decreased absorption, e.g., infectious (e.g., viral or bacterial) diarrhea, inflammatory diarrhea, short bowel syndrome, or the diarrhea which typically occurs following surgical procedure, e.g., ileostomy (see e.g., Harrison's principles of Internal Medicine, McGraw Hill Inc., New York, 12th ed.).
- infectious diarrhea examples include, without limitation, acute viral diarrhea, acute bacterial diarrhea (e.g., salmonella, Campylobacter, and Clostridium) or diarrhea due to protozoal infections, or travelers' diarrhea (e.g., Norwalk virus or rotavirus).
- inflammatory diarrhea examples include, without limitation, malabsorption syndrome, tropical spue, chronic pancreatitis, Crohn's disease, diarrhea, and irritable bowel syndrome.
- GIP and GP compounds of the invention can be used to treat or prevent an emergency or life-threatening situation involving a gastrointestinal disorder, e.g., after surgery or due to cholera.
- the compounds can be used to treat intestinal dysfunction in patients with Acquired Immune Deficiency Syndrome (ADDS), especially during cachexia.
- ADDS Acquired Immune Deficiency Syndrome
- the compounds may also be useful for inhibiting small intestinal fluid and electrolyte secretion, and augmenting nutrient transport, as well as increasing cell proliferation in the gastrointestinal tract, regulating lipolysis in, e.g., adipose tissue and regulating blood flow in a mammal.
- GIP compounds of the invention may also be useful for treating or preventing the above conditions by their gastrointestinal protective activity (e.g., inhibition of gastric secretion). Accordingly, a GIP compound of the invention may be used to treat gastrointestinal or mucosal damage.
- Exemplary types of damage include, but are not limited to, inflammatory bowel disease, bowel atrophy, conditions characterized by loss of bowel mucosa or bowel mucosal function, and other conditions of the gastrointestinal tract, including those which may be brought about by exposure to cytotoxic agents, radiation, toxicity, infection and/or injury.
- these compounds of the invention may be combined with analgesics, anti-inflammatory agents, growth hormone, heparin, or any other therapies that may be used to treat inflammatory bowel disease or other conditions listed above.
- GIP compounds can be useful for treating or preventing gastritis, pancreatitis, Barrett's esophagus, Gastroesophageal Reflux Disease (GERD) and conditions associated therewith.
- Such conditions can include, but are not limited to, heartburn, heartburn accompanied by regurgitation of gastric/intestinal contents into the mouth or the lungs, difficulty in swallowing, coughing, intermittent wheezing and vocal cord inflammation (conditions associated with GERD), esophageal erosion, esophageal ulcer, esophageal stricture, Barrett's metaplasia (rep'acement of normal esophageal epithelium with abnormal epithelium), and pulmonary aspiration.
- GERD Gastroesophageal Reflux Disease
- GIP compounds can have anti-secretory properties, such as inhibition of gastric acids, inhibition of bile acids, and inhibition of pancreatic enzymes. Moreover, GIP compounds can also have gastroprotective effects. Accordingly, GIP compounds of the invention may be particularly useful in the treatment or prevention of gastritis, pancreatitis, Barrett's esophagus, and/or GERD and related or associated conditions.
- the present invention also relates to pharmaceutical compositions comprising a therapeutically or prophylactically effective amount of at least one novel GIP analog or GIP hybrid polypeptide of the invention, or a pharmaceutically acceptable salt thereof, together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers useful in the delivery of the GIP compound.
- Figures IA and IB present views of the exendin-4 Trp-cage.
- Figure IA shows an NMR-derived ensemble structure of exendin-4 in 30% aqueous trifluoroethanol. The Trp-cage can be seen folding back towards the central region of exendin.
- Figure IB shows a CPK view of the "Trp-cage" motif (residues 21-38) of a representative structure from the solution-state NMR structure ensemble of exendin-4.
- Figure 2 presents sequences and receptor binding and glucose lowering (oral glucose tolerance test (OGTT) in non-diabetic NIH/Swiss mice) activities of reference sequences and novel GIP analog sequences of the invention.
- OGTT oral glucose tolerance test
- Figures 3A and 3B present suppression of glucose excursion following an OGTT, and basal glucose lowering activity of GIP and Compound G in NIH/Swiss mice.
- Figures 5A to 5D present examples of GIP phybrids comprising GP and amylin/calcitonin-like analog peptides.
- the compounds would have both GBP activity (e.g., glucose lowering) and reduction of gastric emptying.
- Figure 6 depicts the structures of various chemical groups mentioned herein.
- Figure 7 depicts the structures of various chemical Fmoc derivatives mentioned herein.
- FIGS 8 A and 8B depict glucose lowering effect of novel GBP analogs.
- the figures demonstrate that a D-alanine substitution at position 2 in the analogs herein improves glucose lowering ability. Points represent mean ⁇ sem.
- FIGS 1OA and 1OB depict glucose lowering effect of various analogs.
- Ac modification and a Pro3 substitution did not significantly enhance glucose lowering ability.
- Points represent mean ⁇ sem.
- Figure 11 demonstrates superior protease resistance of an exemplary GIP hybrid, 0601GIP3794 versus a native GIP.
- Figures 12.15 to 12.65 depict further exemplary analogs and reference peptides of the invention. It is intended that the various modifications and variants shown are to be used in the present invention, and may be combined as discussed herein.
- exendin tail or exendin trp-cage motif includes any of the exendin tail variants depicted, which are useful as shield sequences (peptidic enhancers).
- shield sequences peptidic enhancers.
- frog GLPl C-terminal extensions as shown in the figures, which are yet another example of a shield sequence that can be used in place of an exendin tail.
- Figures 13A and 13B demonstrate food intake inhibition and lowering of blood glucose by GIP hybrids.
- Figure 14 Effect of GIP hybrids in food intake assay.
- Figure 15. Effect of GIP hybrid in food intake assay.
- Figures 16A and 16B demonstrate effect of Compound 10 (Fig. 16A) and sCT (Fig. 16B) in food intake assay.
- Figure 17 demonstrates effect of GP hybrids on lowering of blood glucose.
- Figures 18A and 18B depict cAMP production in whole cardiomyocytes from receptor activation in response to varying doses of test compound, human GIP(142) free acid form ( Figure 18A) and GIP hybrid compound G ( Figure 18B).
- Figures 19A to 19E depict the response of mean arterial pressure (Figure 19A), heart rate (Figure 19B), and rate of change in blood pressure (dP/dt, Figure 19C), systolic pressure (Figure 19D) and diastolic pressure (Figure 19E) as determined by telemetry in conscious rats to administration of GIP compounds.
- Mean arterial pressure is presented as % of predose values measured over the 30 minutes prior to drug administration.
- Figure 19C reflects the inotropic response to GIP compounds.
- the rate of change of blood pressure (dP/dt) is indicative of cardiac contractility.
- Figures 2OA, 2OB and 2OC depict the lack an acute effect of GDP (1-42) and a GIP DPP-IV-resistant- analog/exendin-tail hybrid on food intake in contrast to exendin-4.
- the pancreatic hormone amylin produced a significant effect as expected.
- Figure 21 depicts the lack of effect on weight loss in diet-induced obesity mice, in contrast to the effect of exendin-4.
- Figure 22 provides an alignment of mammalian and non-mammalian GIP. Positions Yl, E3, D9, Sl 1, Dl 5, F22, V23, L26, L27 and K32 are conserved across all species.
- Figure 23 A and B depict beneficial activity of a GIP-amylin/sCT/amylin hybrid in slowing of gastric emptying and reducing intracellular calcium levels.
- Figure 24 depicts further linkers useful in the invention.
- Figure 25 depicts the reduction of body weight by GIP-amylin family hybrids of the invention.
- Figure 26 depicts the improvement of body composition by a lean-sparing, fat reducing activity of by GIP-amylin family hybrids of the invention.
- Figure 27 presents an exemplary pH versus solubility profile and a pH versus stability profile of a GIP analog.
- GIP Gastric inhibitory polypeptide
- GLP-I glucagon-like peptide 1
- GLP-I gut peptide hormones that exert potent glucoregulatory action through their glucose-dependant stimulation of insulin secretion. Consequently, these incretin hormones have attracted great interest as potential anti-diabetic agents with reduced risk for hypoglycemia.
- GLP-I, GLP-I analogs and mimetics have been shown to be efficacious in controlling glucose levels in type 2 diabetic patients, the insulinotropic effect of GIP is reportedly significantly reduced in diabetic subjects, compared to normal individuals (16-18).
- GIP signal transduction is impaired in type 2 diabetes.
- Reduced GIP receptor expression in pancreatic beta cells has been proposed to contribute to overall reduced incretin effects in diabetic subjects (19).
- administration of elevated pharmacological doses of GIP or analogues could have therapeutic utility.
- GIP lacks the gastrointestinal effects of GLP-I (20) that has limited the latter peptide's therapeutic window, thus permitting the possibility of higher dosing regimens (21).
- DPP-TV dipeptidyl peptidase IV
- NEP neutral endopeptidase 24.11
- novel GIP analogs and GIP-containing hybrid polypeptides, or derivatives thereof which have enhanced or novel properties, including enhanced DPP-IV resistance, dual hormonal activity, and improved plasma half-life.
- methods for treating or preventing metabolic diseases and disorders including those which can be alleviated by control of plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions, and conditions and disorders including, but not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin- resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.
- the methods comprise administering a therapeutically or prophylactically effective amount of a GIP or GIP analog, fragment or derivative thereof or a novel GIP analog or GIP hybrid or derivatives thereof as described herein, alone (monotherapy) or in combination with "nother agent or therapy (adjunct therapy), for example a glucose lowering agent (e.g., antidiabetic) or agents or methods that inhibit or reduce gastric emptying (examples of such agents are presented herein), to a subject in need thereof.
- a glucose lowering agent e.g., antidiabetic
- agents or methods that inhibit or reduce gastric emptying examples of such agents are presented herein
- the present invention relates to novel, GIP- containing selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control of plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions.
- metabolic diseases and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.
- the invention involves the modular assembly of physiologically, metabolically, and/or pharmacokinetically active peptidic modules that may be selectable based on "bio-activities", e.g., therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties.
- bio-activities e.g., therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties.
- bio-active peptide hormone modules may be peptide hormones, peptide fragments with hormonal activity, or structural motifs of peptide hormones that impart chemical, metabolic, and/or other pharmacokinetic stability.
- the peptide hormones can include native peptide hormones, as well as peptide hormone analogs and derivatives, as known in the art and described herein.
- the combination of certain physicochemical characteristics of two or more peptide hormones into a single modality can facilitate intervention at several points in a dysfunctional metabolic circuit.
- rationally-designed hybrid polypeptides are provided that integrate selectable bio-activities into a single polypeptide agent.
- the selectable hybrid polypeptides of the invention may involve the use of chemically stable linkers to covalently attach the bio-active modules.
- the selectable hybrid polypeptides of the invention may involve the use of cleavable linkers, which themselves may be or form part of a bio-active module.
- design of the hybrid polypeptides of the present invention may generally involve: (1) the identification, selection and pairing of bio-active peptide hormone modules for desired efficacy and therapeutic use, and (2) the covalent linking of the bio-active modules (e.g. native peptide hormones, peptide hormone analogs or derivatives with hormonal activity, peptide hormone fragments with hormonal activity, stabilizing motifs, etc.) either directly or via a linker without loss of bio- activity of the component modules.
- bio-active modules e.g. native peptide hormones, peptide hormone analogs or derivatives with hormonal activity, peptide hormone fragments with hormonal activity, stabilizing motifs, etc.
- module selection criteria may include, but not be limited to: (a) desired in vivo efficacy for de ⁇ red therapeutic or prophylactic indication, such as an additive or a synergistic effect; (b) optional synergism or dual action of the linked modules for multiple therapeutic or prophylactic indications; and/or (c) a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic.
- GIP GIP, GIP Analogs and Novel GIP Analogs.
- Reference sequences include human GIP, truncated GIP, human GLP-I, exendin-4, an exemplary Tip-cage, and exemplary "shield" sequences (e.g. a short and a long "exendin tail”):
- the GIP peptide analogs and derivatives have at least one hormonal activity of a native GIP peptide.
- the GIP peptide analogs are agonists of a receptor that a native GIP peptide is capable of specifically binding.
- GIP peptide analogs and derivatives include those described in the references herein, which are hereby incorporated by reference. While the present application describes GIP polypeptide compounds as GIP analogs, novel GIP analogs, and novel GIP hybrids for use in the methods and therapies described herein, it is further intended that any suitable GIP agonist can be administered in place of a GIP compound, such agonists include agonist antibodies and antibody fragments and derivatives, and small molecule GIP receptor agonists. Accordingly, when a GIP compound or polypeptide is indicated for use in a particular therapeutic method, in another embodiment it is intended that a GIP agonist be used, particularly an agonist antibody or fragment or derivative thereof. [0070] In serum, GIP is degraded by dipeptidyl peptidase IV (DPP-IV). The resulting short biological half- life (about 2 minutes in vivo) limits the therapeutic use of GIP.
- DPP-IV dipeptidyl peptidase IV
- German Patent Application 19921537 discloses a method for extending the survival of insulin producing beta-cells by stimulation of their proliferation and prevention of their programmed cell death. The specific goal is to increase the endogenous insulin content and insulin response to elevated blood glucose levels.
- An important component of this invention is the activation of protein kinase B/Akt in insulin producing beta-cells in response to the administration of effectors such as GLP-I, GIP, Exendin-4 or GLP-I receptor agonists or GIP-receptor agonists.
- European Patent Application 0479210 discloses GBP analogs of the formula GIP(1-13)-X-GIP(15- 3O)-Y, wherein X is an amino acid residue other than Met, and Y is selected from homoserine (inclusive homoserine-lactone) (referred to as "Hse"), homoserine amide (Hse-NH2), H-Gly-Lys-Lys-Asn-Asp-Trp- Lys-His-Asn-Ile-Thr-Gln-Hse (SEQ ID NO: 8) or H-Gly-Lys-Lys-Asn-Asp-T ⁇ -Lys-His-Asn- ⁇ e-Thr-Gln- Hse-NH2 (SEQ DDNO: 9).
- WO98/24464 discloses an antagonist of glucose-dependent insulinotropic polypeptide (GIP) consisting essentially of a 24 amino acid polypeptide corresponding to positions 7-30 of the sequence of GIP, a method of treating non-insulin dependent diabetes mellitus and a method of improving glucose tolerance in a non-insulin dependent diabetes mellitus patient.
- GIP glucose-dependent insulinotropic polypeptide
- WO 00/58360 and EPl 171465 disclose peptides, which stimulate the release of insulin.
- This disclosure provides a process of N terminally-modifying GIP and the use of the peptide analogues for treatment of diabetes/The specific peptide analog, which is disclosed in this invention, comprises at least 15 amino acid residues from the N terminal end of GIP (1-42).
- Tyrl-glucitol GIP (1-42) is disclosed.
- WO 00/20592 discloses GIP or anti-idiotypic antibodies of GIP or fragments thereof as GIP-analogs for maintaining or increasing bone density or bone formation.
- Kuhn-Wache et al. (2000) discloses analogs of GIP with increased dipeptidyl peptidase IV resistance (Kuhn-Wache et al, in Langner & Ansorge, Cellular peptidases in Immune Functions and Diseases 2. Kluwer Academic/Plenum Publishers, 187-195.)
- DPP-IV dipeptidyl peptidase IV
- Amino acid alterations include modifications of the first 3 or 4 residues of GIP and/or the bond between residues 2 and 3, which is cleaved by DPP-IV.
- Modifications and substitutions include N-terminal modifications, L-amino acids, D- amino acids, proteinogenic and non-proteinogenic amino acids.
- Proteinogenic amino acids are defined as natural protein-derived alpha-amino acids.
- Non-proteinogenic amino acids are defined as all other amino acids, which are not building blocks of common natural proteins.
- novel GIP analogs having one or more modifications as described herein and that exhibit at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity to a native GIP(I -30), native GIP(I -26), native GIP(I -14), native GIP(I-Sg), native GIP(19-30), native GIP(19-26), native GIP(19-39), native GIP(19-42) or native GIP(I -42) over the entire length of the GIP portion.
- GIP compounds comprising at least 11, 12, 13, 14 or-15 amino acid residues from the N-terminal end of a GIP, e.g., GEP(I -42) ? having a least one amino acid substitution or modification at position 1-3 and being biologically active. This includes modification by fatty acid addition at an epsilon amino group of at least one lysine residue, either present in or introduced into the molecule.
- Particular modifications include Tyrl-glucitol of a GIP, for example Tyrl-Glucitol GIP(I -42) or Tyrl-glucitol GEP(I -30).
- GIP analogs of interest include those comprising a substitution or modification selected from the group comprising D-amino acid substitutions in 1, 2 and/or 3 positions and/or N-terminal glycation, alkylation, acetylation or acylation, or other N-terminal modifications described herein.
- analogs wherein the amino acid in the 2 or 3 position is substituted by lysine, serine, 4-amino butyric amino acid, Aib, D-alanine, Sarcosine or proline.
- substitutions in the 1, 2, or 3 position, and more particularly in the 2 position of GIP are dAla, VaI, dnorVal, dSer, Abu, dAbu, homo-Ser, d-homoSer, dPro, cyclopropyl Ala, d-cyclopropyl Ala, cycloHexyl Ala, d-cyclohexyl Ala, A(NMe), Aib, and cyclpropGly.
- a GIP analog or hybrid has a serine at position 2 in order to reduce DPP-IV cleavage, while retaining receptor binding and activation.
- a Ser2 analog of each of the GBP analogs and hybrids disclosed herein is specifically contemplated.
- the analog of 0601GIP3794 having a serine substitution for the dAla at position 2 is specifically contemplated.
- Further exemplary GIP analog compounds have a modification at the N-terminus, retaining their GIP Receptor binding, in which the N-terminus modification includes H, isocap, isoBuOCO, octylglycine, Y(NMe) and succinoyl.
- Further exemplary GIP compounds include those with fatty acid modifications or combinations of modifications as described herein, while retaining their GIP Receptor binding and receptor activation activity,
- an N-terminus modification can be combined with a substitution or modification at positions 1, 2 or 3 (which imparts resistance to DPP-IV as described herein) or with a fatty acyl derivative modification (which can reduce renal clearance).
- a substitution or modification at positions 1, 2 or 3 is combined with a fatty acyl derivative.
- an N-terminus octylglycine is combined with a d-amino acid at 1, 2, or, particularly a D-AIa at position 2.
- a fatty acyl substitution is a octylglycine for lysine at position 16 or methionine at position 14.
- the methionine at position 14 is deleted, and which, for example, can be further combined with a octylglycine for lysine at position 16 or 30.
- Another substitution is acylation of the lysine at position 16 or 30, for example with an octyl or palmitoyl group.
- fatty acyl substitution where an octylglycine is substituted for lysine at position 16 or 30 or for methionine at position 14.
- the methionine at position 14 is deleted or substituted, for example with a leucine or other small hydrophobic amino acid, and/or the tryptophan at position 25 is deleted or substituted, for example with a phenylalanine.
- analogs having at least one or two amino acid deletions in amino acids 1-30 of GIP those having one or two deletions in amino acids 4 to 30, and those having one or more deletions in amino acids 4-15, and those having one amino acid deletion in amino acids 1-30, 4-30 or 4-15 of a GIP.
- a modification can be combined with at least one other change as described herein, such as a change that imparts DPP-IV resistance, reduces or eliminates oxidation, reduces renal clearance, improves receptor binding, or improves receptor activation.
- substitutions are those derived from GIP of other (non-human) species, for example the methionine 14 replaced by leucine, the D at position 9 or 21 replaced by E, the histidine 18 replaced by alanine, arginine or lysine, the lysine at position 30 replaced by alanine, arginine or histidine, the alanine at position 13 replaced by leucine, and the alanine at position 28 replaced by serine.
- the GP analogs have one or more of the following modifications: dAla2 to Abu, Ala, GIy, or Ser; Metl4 to Leu; Hisl8 to Ala, Arg, or Lys; Asp21 to GIu; Lys30 to Arg or His; and/or an N-terminus as Gly(Oct).
- modifications described herein can be combined with at least one other change as described herein, such as a change that imparts DPP-IV resistance, reduces or eliminates oxidation, reduces renal clearance, improves receptor binding, or improves receptor activation.
- a change that imparts DPP-IV resistance reduces or eliminates oxidation, reduces renal clearance, improves receptor binding, or improves receptor activation.
- specific analogs that have one or more replacements or modifications as described herein, such as a GIP D-Ala2 or L-Ala2 analog that also has a Phe for Tip replacement at position 25.
- Bio-Active Peptide Hormone Modules As discussed herein the GIP hybrid polypeptides of the present invention (also referred to as “phybrids”), generally comprise at least two bio-active peptide hormone modules covalently linked together, with a GIP peptide as one of the modules.
- the bio-active peptide hormone modules may be: (a) native component peptide hormones, (b) analogs or derivatives of native component peptide hormones that retain hormonal activity, (c) fragments of native component peptide hormones that retain hormonal activity, (d) fragments of analogs or derivatives of native component peptide hormones that retain hormonal activity, (e) structural motifs of native component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic to the hybrid polypeptide; or (f) structural motifs of analogs or derivatives of native component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
- peptidic enhancers The structural motifs of (e) and (f) will collectively be referred to herein as "peptidic enhancers".
- An example of a peptidic enhancer is a Tip cage sequence, particularly one derived from exendin-4, such as the Ex-4 short or long tails.
- bio-active peptide hormone modules include native peptide hormones selected from: arnylin, ADM, CT, CGRP, intermedin, CCK(l-33), CCK-8, leptin, PYY(l-36), PYY(3-36), an PYY-NPY chimera, GLP-I (1-37), GLP-I (7-37), GLP-I (7-36), GLP-2, OXM, exendin-3, exendin-4, catestatin family peptides, natriuretic peptide hormones, urocortin family peptides, e.g., Ucn-2 and Ucn-3, neuromedin family peptides, e.g. neuromedin U25 or splice variants, and ANP, BNP, CNP or urodilatin.
- native peptide hormones selected from: arnylin, ADM, CT, CGRP, intermedin, CCK(l-33), CCK-8
- bio-active peptide hormone modules include analogs and derivatives of a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(I -36), PYY(3-36), PYY-NPY chimera, GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, a catestatin family peptide, a natriuretic peptide hormone, a urocortin family peptide, e.g., Ucn-2 and Ucn-3, a neuromedin family peptide, e.g.
- the analog may comprise one or more insertions, deletions, or substitutions of the amino acid sequence of the component peptide hormone, and the derivative may comprise one or more chemical modifications of an amino acid residue of an analog or component peptide hormone, as described more fi ⁇ lly herein and known in the art.
- analogs and derivatives may be selected from any described above and/or known in the art.
- Particularly exemplary analogs and derivatives that exhibit at least one hormonal activity useful as bio-active peptide hormone modules of the invention include the following:
- such peptide compounds may preferably be amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- Still other exemplary bioactive peptide hormone modules include fragments of a component peptide hormone selected from: amylin, ADM, CT 5 CGRP, intermedin, CCK, leptin, PYY(I -36), PYY(3-36), GLP- 1(1-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, a natriuretic peptide, a urocortin family peptide, e.g., Ucn-2 and Ucn-3, a neuromedin family peptide, e.g. neuromedin U25 or splice variant, exendin-3, and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
- a component peptide hormone selected from: amylin, ADM, CT 5 CGRP, intermedin, CCK, leptin, PYY(I -36), PYY(3-36
- bioactive peptide hormone modules include fragments of analogs or derivatives of a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(I- 36), PYY(3-36), the specific PYY-NPY chimera sequences disclosed herein, GLP-l(l-37), GLP-l(7-37), GLP-I (7-36), GLP-2, human catestatin, OXM, ANP, BNP, CNP, urodilatin, Ucn-2 and Ucn-3, neuromedin U25 or splice variant, neuromedin S, exendin-3 and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
- a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(I- 36), PYY(3-36), the specific PY
- the analog may comprise one or more insertions, deletions, or substitutions of the amino acid sequence of the component peptide hormone
- the derivative may comprise one or more chemical modifications of an amino acid residue of an analog or component peptide hormone, as described more fully herein and known in the art.
- Certain exemplary fragments that exhibit at least one hormonal activity include the following. However, it should be understood that combinations of the above-described analogs and derivatives taken with fragments known in the art, including the exemplary fragments described herein, are contemplated.
- exemplary analog fragments may include 5 Ala, M Leu, 25 Phe-exendin-4(l-28), 14 Leu, 2S Phe-exendin-4(l-27), 5 Ala, I4 Leu, 25 Phe-exendin-4(l-28), M Leu, 25 Phe-exendin-4(l-27), or any other combinations of the disclosed fragments, analogs, and derivatives. Further embodiments include NN2211 and ZP-10.
- bio-active peptide modules include "peptidic enhancer", i.e., structural motifs of component peptide hormones (including analogs and derivatives thereof) that impart a desired chemical stability, conformational stability, metabolic stability, bioavailability, organ/tissue targeting, receptor interaction, protease inhibition, plasma protein binding, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
- peptidic enhancers include the following.
- the peptidic enhancer Ex-4 short tail which is an exemplary Trp-Cage sequence, or analog thereof, is added to the C-terminus of any GIP analog, and in further embodiments the peptidic enhancer is attached using a linker.
- the novel GIP hybrid include a GP portion exhibiting at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity to a native GEP(I -30), native GIP(l-26), native GIP(I -14), native GIP(I -39), native GP(19-30), native GIP(19-26), native GP(19-39), native GP(19-42) or native GIP(I -42) over the entire length of that GP portion.
- the GP portion of a GIP hybrid can comprise a trp-cage motif.
- Such desirable GP hybrids include an N-terminal GP or novel GP analog fragment in combination with a C-terminal polypeptide or fragment thereof having a glucose lowering activity (e.g., antidiabetics, exendin) or the ability to inhibit or reduce gastric emptying.
- Such desirable GP hybrids include an N-terminal GP fragment or novel GP analog fragment in combination with a C-terminal exendin, GLPl, pramlintide, amylin, CCK, gastrin, PYY, secretin, GRP, neuromedins, urocortin, calcitonin, or salmon calcitonin, or fragment thereof, hi other embodiments desirable GP hybrids include a C-terminal GP or novel GP analog fragment in combination with an N-terminal polypeptide or fragment thereof having a glucose lowering activity (e.g., antidiabetics, exendin) or the ability to inhibit or reduce gastric emptying.
- a glucose lowering activity e.g., antidiabetics, exendin
- the chimeric polypeptides can include a C-terminal GIP, a novel GP analog (in which case a Trp-cage forming sequence is present), or fragment thereof, in combination with a N-terminal exendin, GLPl, pramlintide, amylin, CCK, gastrin, PYY, secretin, GRP, neuromedins, urocortin, calcitonin, or salmon calcitonin, or fragment thereof.
- GIP C-terminal GIP
- novel GP analog in which case a Trp-cage forming sequence is present
- fragment thereof in combination with a N-terminal exendin, GLPl, pramlintide, amylin, CCK, gastrin, PYY, secretin, GRP, neuromedins, urocortin, calcitonin, or salmon calcitonin, or fragment thereof.
- the GP or novel GP analog is combined with a gastrin /CCK receptor ligand; an amylin receptor ligand; a calcitonin receptor ligand; an CGRP receptor ligand, a PYY receptor ligand, an EGF receptor ligand; a Glucagon-like peptide 1 receptor ligand; a Glucagon-like peptide 2 receptor ligand; a gastric inhibitory polypeptide (GP) receptor ligand; a keratinocyte growth factor (KGF) receptor 1 ligand; a dipeptidyl peptidase IV inhibitor; a REG protein receptor ligand; a Growth Hormone receptor ligand; a Prolactin (PRL) receptor ligand; an Insulin-like Growth Factor (IGF) receptor ligand; PTH-related protein (PTHrP) receptor ligand; hepatocyte growth factor (HGF) receptor ligand; a bone morph
- the polypeptides of the present invention will preferably retain, at least in part, a biological activity of native human GIP, e.g., the polypeptides of the present invention will generally be GIP agonists or antagonists. In one embodiment, the polypeptides of the present invention will exhibit biological activity in the treatment and prevention of metabolic conditions and disorders. Further, the novel GIP analog polypeptides of the invention may include internal linker compounds, may include chemical modifications at internal amino acid residues, or may be chemically modified at the N-terminal or C-terminal residue. In yet another embodiment, the polypeptides of the invention include only natural L amino acid residues and/or modified natural L amino acid residues. Alternatively, in another embodiment, the polypeptides of the invention do not include unnatural amino acid residues.
- the GIP portion comprises a GIP N-terminal region modified or substituted to provide DPP-IV resistance superior to that of native GIP .
- Native peptide hormones are known in the art, as are their analogs and derivatives. For reference, the sequences of several native peptide hormones are provided herein.
- these peptides are generally C-terminally amidated when expressed physiologically, but need not be for the purposes of the instant invention.
- the C-terminus of these peptides, as well as the GIP " hybrid polypeptides of the present invention may have a free -OH or -NH2 group.
- These peptides may also have other post-translational modifications.
- the hybrid polypeptides of the present invention may also be constructed with an N-terminal methionine residue.
- Exemplary peptide modules for use in the invention further include, N-terminally extendable peptide modules (and their analogs and fragments) including Apelin, which exists in 2 forms, Apelin 36 and 13, both active at the AJP receptor (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH (SEQ ID NO: 493) and pERPRLSHKGPMPF-OH (SEQ ID NO:494)); Prolactin Releasing peptide, which exists in 2 forms, PRP31 and PRP20, equally active at GPRlO (SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 (SEQ ID NO: 495) and TPDINPAWYASRGIRPVGRF-NH2 (SEQ ID NO: 496)); Gastrin, which exists as big gastrin and mini-gastrin, the bulk of activity however residing in resides in pentagastrin (QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-
- KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF-NH2 (SEQ ID NO: 500); DYMGWMDF-NH2) (SEQ ID NO: 55); Cortistatin, which exists as cortistatin 17 or 29 (QEGAPPQQSARRDRMPCRNFFWKTFSSCK-OH (SEQ ID NO: 501) and DRMPCRNFFWKTFSSCK- OH (SEQ ID NO: 502)); somatostatin, which exists as somatostatin 14 or 28 (SANSNPAMAPRERKAGCKNFFWKTFTSC-OH (SEQ ID NO: 503); AGCKNFFWKTFTSC-OH (SEQ ID NO: 504)); GRP for which a C-terminal 10 amino acid sequence possesses most of the activity (VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (SEQ ID NO: 505); GNHWAVGHLM-NH2 (SEQ ID NO: 506)); Neuromedin B for which a C-terminal 10 amino acid region
- Exemplary peptide modules for use in the invention further include, C-Terminally extendable peptide modules including, Endothelin I, ⁇ and HH: ETI
- WYKHVASPRYHTVGRAAGLLMGL-OH (SEQ ID NO: 532)); PACAP which exists in 2 forms, PACAP27 and 38 (HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 (SEQ ID NO: 533); HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 (SEQ ID NO: 534)); PHI and PHV (HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV-OH (SEQ ID NO: 535); HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 (SEQ ID NO: 536)); GRF, which exists in 2 forms GRF29 and GRF40 (YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-Nm (SEQ ID NO: 537); YADAIFTNSYRKVLGQLSARKLLQDIMS-OH (SEQ ID
- AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEI-OH (SEQ ID NO.-543)) gamma-MSH for which the shorter gamma-MSHl and the longer gamma-MSH3 have similar activities (YVMGHFRWDRFGRRNSSSSGSSGAGQ-OH (SEQ ID NO: 544); YVMGHFRWDRF-NH2 (SEQ ID NO: 545)); MSH for which alpha-MSH is an active portion of ACTH (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH (SEQ ID .
- YGGFMTSEKSQTPLVTXFKNAIIKNAYKKGE-OH SEQ H
- YGGFMTSEKSQTPLVTLFKNAIIKNAY-OH SEQ ID NO: 549
- YGGFMTSEKSQTPLVTL- OH SEQ ID NO: 373
- YGGFMTSEKSQTPLVT-OH SEQ ID NO: 550
- the melanocortins are peptides from the pro-opiomelanocortin gene, including alpha- melanocyte-stimulating hormone (alpha-MSH) and adrenocorticotrophic hormone (ACTH), and five melanocortin receptors are known, MCl -5R.
- MC4R appears to play a role in energy balance and obesity. See, for example, Anderson et al., Expert Opin. Then Patents 11:1583-1592 (2001), Speake et al., Expert Opin. Ther. Patents 12:1631-1638 (2002), Bednarek et al., Expert Opin. Ther. Patents 14:327-336 (2004).
- the hormones described herein can be used in adjunct therapy, co-administered with, a GIP analog of the invention.
- amylin family peptide hormones useful in the present invention with a GIP or a novel GIP analog include amylin family peptide hormones including amylin, adrenomedullin ("ADM”), calcitonin (“CT”), calcitonin gene related peptide (“CGRP”), intermedin (also known as "AFP-6") and related peptides.
- ADM amylin family peptide hormones
- CT calcitonin
- CGRP calcitonin gene related peptide
- AFP-6 intermedin
- Native amylin family peptide hormones are known in art, as are functional peptide analogs and derivatives.
- amylin family of peptide hormones, including amylin, calcitonin, calcitonin gene related peptide, adrenomedullin, and intermedin (also known as "AFP-6").
- Amylin is a 37-amino acid peptide hormone. It was isolated, purified and chemically characterized as the major component of amyloid deposits in the islets of pancreases of human Type 2 diabetics (Cooper et al., Proc. Natl. Acad. ScL, USA, 84:8628-8632 (1987)).
- the amylin molecule has two post-translational modifications: the C-terminus is amidated, and the cysteines in positions 2 and 7 are cross-linked to form an N-terminal loop.
- the sequence of the open reading frame of the human amylin gene shows the presence of the Lys-Arg dibasic amino acid proteolytic cleavage signal, prior to the N- terminal codon for Lys, and the GIy prior to the Lys-Arg proteolytic signal at the N-terminal position, a typical sequence for amidation by protein amidating enzyme, PAM (Cooper et al., Biochem. Biophys. Acta, 1014:247-258 (1989)).
- ADM adrenomedullin
- ADM is generated from a 185 amino acid preprohormone through consecutive enzymatic cleavage and amidation. This process culminates in the liberation of a 52 amino acid bioactive peptide.
- calcitonin or “CT” is meant the human peptide hormone and species variants thereof, including salmon calcitonin (“sCT”). More particularly, CT is a 32 amino acid peptide cleaved from a larger prohormone. It contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring.
- calcitonin gene related peptide or "CGRP” is meant the human peptide hormone and species variants thereof, in any physiological form.
- intermediate or "AFP-6” is meant the human peptide hormone and species variants thereof, in any physiological form.
- Amylin is believed to regulate gastric emptying, and suppress glucagon secretion and food intake, thus regulating the rate of glucose appearance in the circulation. It appears to complement the actions of insulin, which regulates the rate of glucose disappearance from the circulation and its uptake by peripheral tissues. These actions are supported by experimental findings in rodents and humans, which indicate that amylin complements the effects of insulin in postprandial glucose control by at least three independent mechanisms, all of which affect the rate of glucose appearance. First, amylin suppresses postprandial glucagon secretion. Compared to healthy adults, patients with type 1 diabetes have no circulating amylin and patients with type 2 diabetes have diminished postprandial amylin concentrations.
- Amylin may be beneficial in treating metabolic conditions such as diabetes and obesity. Amylin may also be used to treat pain, bone disorders, gastritis, to modulate lipids, in particular triglycerides, or to affect body composition such as the preferential loss of fat and sparing of lean tissue.
- CT hormone calcitonin
- CT(I -32) a major function of CT(I -32) is to combat acute hypercalcemia in emergency situations and/or protect the skeleton during periods of "calcium stress” such as growth, pregnancy, and lactation.
- calcium stress such as growth, pregnancy, and lactation.
- CT has an effect on plasma calcium levels and inhibits osteoclast function and is widely used for the treatment of osteoporosis.
- sCT appears to increase bone density and decrease fracture rates with minimal adverse effects.
- CT has also been successfully used over the past 25 years as a therapy for Paget' s disease of bone, which is a chronic skeletal disorder that may result in enlarged or deformed bones in one or more regions of the skeleton.
- CT is also widely used for its analgesic effect on bone pain experienced during osteoporosis, although the mechanism for this effect is not clearly understood.
- Calcitonin gene related peptide is a neuropeptide whose receptors are widely distributed in the body, including the nervous system and the cardiovascular system. This peptide seems to modulate sensory neurotransmission and is one of the most potent endogenous vasodilatory peptide discovered to date.
- Reported biological effects for CGRP include: modulation of substance P in inflammation, nicotinic receptor activity at the neuromuscular junction, stimulation of pancreatic enzyme secretion, a reduction of gastric acid secretion, peripheral vasodilation, cardiac acceleration, neuro-modulation, regulation of calcium metabolism, osteogenic stimulation, insulin secretion, an increase in body temperature and a decrease in food intake.
- CGRP calcitonin gene-related peptide, calcitonin and ADM: a peptide superfamily. Crit Rev Neurobiol. 1997; 11(2-3): 167-239).
- An important role of CGRP is to control blood flow to various organs by its potent vasodilatory actions, as evidenced by a decrease of mean arterial pressure following intravenous administration of ⁇ -CGRP.
- the vasodilatory actions are also supported by recent analysis of homozygous knockout CGRP mice, which demonstrated elevated peripheral vascular resistance and high blood pressure caused by increased peripheral sympathetic activity (Kurihara H, et al., Targeted disruption of ADM and ⁇ CGRP genes reveals their distinct biological roles. Hypertens Res. 2003 Feb; 26 Suppl:S105-8).
- CGRP appears to elicit vasodilatory effects, hypotensive effects and an increase in heart rate among other actions.
- Adrenomedullin is almost ubiquitously expressed with many more tissues containing the peptide than not.
- a published review of ADM, (Hinson, J.P. et al., Endocrine Reviews (2000) 21(2): 138- 167) details its effects on the cardiovascular system, cellular growth, the central nervous system and the endocrine system, with a range of biological actions including vasodilation, cell growth, regulation of hormone secretion, and natriuresis.
- Studies in rat, cat, sheep, and man confirm that intravenous infusion of ADM results in potent and sustained hypotension, and is comparable to that of CGRP.
- hypotensive effect of ADM on mean arterial pressure in the anesthetized rat is not inhibited by the CGRP antagonist CGRP8-37 suggesting that this effect is not mediated via CGRP receptors.
- Acute or chronic administration of human ADM in rats, anesthetized, conscious or hypertensive results in a significant decrease in total peripheral resistance accompanied by a fall in blood pressure, with a concomitant rise in heart rate, cardiac output and stroke volume.
- ADM has also been proposed as an important factor in embryogenesis and differentiation and as an apoptosis survival factor for rat endothelial cells. This is supported by recent mouse ADM knockout studies, in which mice homozygous for loss of the ADM gene demonstrated defective vascular formation during embryogenesis and thus died mid-gestation. It was reported that ADM +/- heterozygous mice had high blood pressure along with susceptibility to tissue injury (Kurihara H, et al., Hypertens Res. 2003 Feb; 26 Suppl:S105-8).
- ADM affects such endocrine organs as the pituitary, the adrenal gland, reproductive organs and the pancreas.
- the peptide appears to have a role in inhibiting ACTH release from the pituitary.
- the adrenal gland it appears to affect the secretory activity of the adrenal cortex in both rat and human and it increases adrenal blood flow, acting as a vasodilator in the adrenal vascular bed in intact rats.
- ADM has been shown to be present throughout the female reproductive tract and plasma levels are elevated in normal pregnancy. Studies in a rat model of preeclampsia show that ADM can reverse hypertension and decrease pup mortality when given to rats during late gestation.
- ADM may play an important regulatory role in the utero-placental cardiovascular system. In the pancreas, ADM most likely plays an inhibitory role since it attenuated and delayed insulin response to an oral glucose challenge, resulting in initial elevated glucose levels. ADM can also affect renal function. A bolus administered peripherally can significantly lower mean arterial pressure and raise renal blood flow, glomerular filtration rate and urine flow. In some cases, there is also an increase in Na+ excretion.
- ADM also has other peripheral effects on bone and on the lung.
- studies have supported a role beyond the cardiovascular system and fluid homeostasis and have demonstrated that ADM acts on fetal and adult rodent osteoblasts to increase cell growth comparable to those of known osteoblast growth factors such as transforming growth factor-alpha. This is important clinically as one of the major challenges in osteoporosis research is to develop a therapy that increases bone mass via osteoblastic stimulation.
- ADM not only causes pulmonary vasodilation, but also inhibits bronchoconstriction induced by histamine or acetylcholine.
- ADM treatment has also been shown to be beneficial in arterial and pulmonary hypertension, septic shock and ischemia/reperfusion injury (Beltowski J., Pol J Pharmacol. 2004;56:5-27).
- Other indications for ADM treatment include: peripheral vascular disease, subarachnoid hemorrhage, hypertension, preeclamptic toxemia of pregnancy and preterm labor, and osteoporosis.
- AFP-6 i.e., intermedin
- a specific receptor for AFP-6 has not been reported; however, binding studies indicate that AFP-6 binds to all the known receptors of the Amylin Family.
- AFP-6 has been shown to increase cAMP production in SK-N- MC and L6 cells expressing endogenous CGRP receptors and competes with labeled CGRP for binding to its receptors in these cells.
- AFP-6 administration led to blood pressure reduction in both normal and spontaneously hypertensive rats, most likely via interactions with the CRLR/RAMP receptors.
- the RAMP family comprises three members (RAMPl, -2, and -3), which share less then 30% sequence identity, but have a common topological organization.
- Co-expression of CRLR and RAMPl leads to the formation of a receptor for CGRP.
- Co-expression of CRLR and RAMP2 leads to the formation of a receptor for ADM.
- Co-expression of CRLR and RAMP3 leads to the formation of a receptor for ADM and CGRP.
- Co-expression of hCTR2 and RAMPl leads to the formation of a receptor for amylin and CGRP.
- Co-expression of hCTR2 and RAMP3 leads to the formation of a receptor for amylin.
- a GIP hybrid comprising an amylin family hormone module can provide the functions and uses associated with the amylin family module, e.g. amylin, amylin/sCT/amylin, ADM, CGRP, as discussed, in addition to a GIP function.
- amylin family module e.g. amylin, amylin/sCT/amylin, ADM, CGRP, as discussed, in addition to a GIP function.
- the amylin analogs and derivatives have at least one hormonal activity of native amylin.
- the amylin analogs are agonists of a receptor which native amylin is capable of specifically binding.
- Exemplary amylin analogs and derivatives include those described in US 2003/0026812 Al , which is hereby incorporated by reference. [00130] Exemplary amylin analogs include:
- amylin analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- any ADM analog or derivative known in the art may be used in conjunction with the present invention.
- the ADM analogs and derivatives have at least one hormonal activity of native ADM.
- the ADM analogs are agonists of a receptor which native ADM is capable of specifically binding.
- Any CT analog or derivative known in the art may be used in conjunction with the present invention.
- the CT analogs and derivatives have at least one hormonal activity of native CT.
- the CT analogs are agonists of a receptor which native CT is capable of specifically binding.
- Exemplary CT analogs and derivatives include those described in U.S. Patent Nos.
- CT analogs include:
- CT analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- any CGRP analog or derivative known in the art may be used in conjunction with the present invention.
- the CGRP analogs and derivatives have at least one hormonal activity of native CGRP.
- the CGRP analogs are agonists of a receptor which native CGRP is capable of specifically binding.
- Exemplary CGRP analogs and derivatives include those described in U.S. Patent Nos. 4,697,002; and 4,687,839, which are hereby incorporated by reference.
- Exemplary CGRP analogs include:
- any AFP-6 analog or derivative known in the art may be used in conjunction with the present invention.
- the AFP-6 analogs and derivatives have at least one hormonal activity of native AFP-6.
- the AFP-6 analogs are agonists of a receptor which native AFP-6 is capable of specifically binding.
- Exemplary AFP-6 analogs and derivatives include those described in WO 2003/022304, which is hereby incorporated by reference.
- Exemplary AFP-6 analogs include:
- AFP-6 analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- CCKs including hCCK (cholecystokinin) and species variants, and various analogs thereof are known in the art.
- CCK has a 33-amino acid sequence first identified in humans, and includes a 8-amino acid in vivo C-terminal fragment ("CCK-8") that has been reportedly demonstrated in pig, rat, chicken, chinchilla, dog and humans.
- Other species variants include a 39-amino acid sequence found in pig, dog and guinea pig, and a 58-amino acid found in cat, dog and humans, and a 47- amino acid sequences homologous to both CCK and gastrin.
- CCK-8 The C-terminal tyrosine-sulfated octapeptide sequence (CCK-8) is relatively conserved across species, and may be the minimum sequence for biological activity in the periphery of rodents.
- CCK-33 will generally refer to human CCK(l-33)
- CCK-8 CCK(26-33)
- pentagastrin or CCK-5 will refer to the C-terminal peptide CCK(29-33)
- CCK-4 will refer to the C-terminal tetrapeptide CCK(30-33).
- CCK was reportedly identified in 1928 from preparations of intestinal extracts by its ability to stimulate gallbladder contraction. Other biological actions of CCK have since been reported, including stimulation of pancreatic secretion, delayed gastric emptying, stimulation of intestinal motility and stimulation of insulin secretion. See Lieverse et al., Ann. N. Y. Acad. Sci. 713: 268-272 (1994). The actions of CCK, also reportedly include effects on cardiovascular function, respiratory function, neurotoxicity and seizures, cancer cell proliferation, analgesia, sleep, sexual and reproductive behaviors, memory, anxiety and dopamine-mediated behaviors. Crawley and Corwin, Peptides 15: 731-755 (1994).
- CCK cerebral spastic syndrome
- Other reported effects of CCK include stimulation of pancreatic growth, stimulation of gallbladder contraction, inhibition of gastric acid secretion, pancreatic polypeptide release and a contractile component of peristalsis. Additional reported effects of CCK include vasodilation. Walsh, "Gastrointestinal Hormones,” In Physiology of the Gastrointestinal Tract (3d ed. 1994; Raven Press, New York).
- CCK was characterized in 1966 as a 33-amino acid peptide. Crawley and Corwin, supra. Species- specific molecular variants of the amino acid sequence of CCK have been identified. The 33-amino acid sequence and a truncated peptide, its 8-amino acid C-terminal sequence (CCK-8) have been reportedly identified in pig, rat, chicken, chinchilla, dog and humans. A 39-amino acid sequence was reportedly found in pig, dog and guinea pig. A 58-amino acid sequence was reported to have been found in cat, dog and humans. Frog and turtle reportedly show 47-amino acid sequences homologous to both CCK and gastrin. Very fresh human intestine has been reported to contain small amounts of an even larger molecule, termed CCK-83. In the rat, a principal intermediate form has been reportedly identified, and is termed CCK-22.
- Cloning and sequence analysis of a cDNA encoding preprocholecystokinin from rat thyroid carcinoma, porcine brain, and porcine intestine reportedly revealed 345 nucleotides coding for a precursor to CCK, which is 115 amino acids and contains all of the CCK sequences previously reported to have been isolated. Crawley and Corwin, supra.
- CCK is said to be distributed throughout the central nervous system and in endocrine cells and enteric nerves of the upper small intestine.
- CCK agonists include CCK itself (also referred to as CCK-33), CCK-8 (CCK(26-33)), non-sulfated CCK-8, pentagastrin (CCK-5 or CCK(29-33)), and the tetrapeptide, CCK-4 (CCK(30-33)).
- CCK-8 reportedly displaced binding with a 1000-5000 greater potency than unsulfated CCK-8 or CCK-4, and CCK-8 has been reported to be approximately 1000- fold more potent than unsulfated CCK-8 or CCK-4 in stimulating pancreatic amylase secretion.
- CCK receptor binding was said to be displaced by unsulfated CCK-8 and by CCK-4 at concentrations that were equimolar, 10-fold or 100-fold greater than sulfated CCK-8.
- Receptors for CCK have been reportedly identified in a variety of tissues, and two primary subtypes have been described: type A receptors and type B receptors. Type A receptors have been reported in peripheral tissues including pancreas, gallbladder, pyloric sphincter and afferent vagal fibers, and in discrete areas of the brain.
- the type A receptor subtype (CCKA) has been reported to be selective for the sulfated octapeptide.
- Type B receptor subtype (CCKB) has been identified throughout the brain and in the stomach, and reportedly does not require sulfation or all eight amino acids. See Reidelberger, J. Nutr. 124 (8 Suppl.) 1327S-1333S (1994); Crawley and Corwin, supra.
- Certain exemplary CCK and CCK analogs with CCK activity include:
- CCK peptides are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- Component peptide hormones useful in the present invention also include leptin family peptide hormones.
- Native leptin family peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known leptin family peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- a GDP hybrid comprising a leptin family hormone module can provide the functions and uses associated with the leptin family module, e.g. leptin, leptin fragment, as discussed, in addition to a GIP function.
- leptin analog or derivative known in the art may be used in conjunction with the present invention.
- the leptin analogs and derivatives have at least one hormonal activity of native leptin.
- the leptin analogs are agonists of a receptor which native leptin is capable of specifically binding.
- Preferred leptin analogs and derivatives include those described in, e.g., WO 2004/039832, WO 98/55139, WO 98/12224, and WO 97/02004, all of which are hereby incorporated by reference.
- leptin peptides include MVPIQK (SEQ ID NO: 551), VQDDTK (SEQ ID NO: 552), TLIK (SEQ ID NO: 553), TIVTR (SEQ ID NO: 554), INDISHTQSVSSK (SEQ ID NO: 555), VTGLDFIPGLHPILTLSK (SEQ ID NO: 556), NVIQISNDLENLR (SEQ ID NO: 557), DLLHVLAFSK (SEQ ID NO: 558), SCHLPWASGLETLDSLGGVLEASGYSTEWALSR (SEQ ID NO: 559) and LQGSLQDMLWQLDLSPGC (SEQ ID NO: 560) as disclosed in WO97046585.
- a leptin peptide may have an amino acid sequence Xaan-Ser-Cys-Xaal-Leu-Pro- Xaa2-Xaa3-Xaan (SEQ ID NO: 561), wherein Xaan may be zero residues in length, or may be a contiguous stretch of peptide residues derived from full length human or mouse leptin sequences, a stretch of between 1 and 7 at either the C-terminus or N-terminus, or wherein the leptin peptide is a total of 15 amino acids or less in length.
- Xaal, Xaa2 or Xaa3 may be any amino acid substitution.
- Xaal, Xaa2 or Xaa3 may be any conservative amino acid substitution of the respective residues in full length mouse or human leptin.
- Xaal may be selected from the group consisting of His or Ser, and Xaa2 or Xaa3 is any amino acid substitution.
- Xaa2 may be selected from the group consisting of Trp or GIn, and Xaal or Xaa3 is any amino acid substitution.
- Xaa3 may be selected fi ⁇ m the group consisting of Ala or Thr, and Xaal or Xaa2 is any amino acid substitution.
- Xaal is selected from the group consisting of His or Ser
- Xaa2 is selected from the group consisting of Trp or GIn
- Xaa3 is selected from the group consisting ofAla or Thr. See WO04039832.
- leptin peptide comprises the C-terminal amino acid residues 116-122 of native full length human or mouse leptin (corresponding to positions 95-101 of their mature forms) and D-isoforms, fragments, derivatives, analogs and homologs thereof, which possess the ability to modulate body mass homeostasis in test animals upon i.p. (intraperitoneal) administration.
- mice D-substituted peptides of sequence SCSLPQT include [D- Ser-1]-, [D-Cys-2]-, [D-Ser-3]-, [D-Leu-4]-, [D-Pro-5]-, [D-Gln-6J-,[D- Thr-7]-SCSLPQT and all [D] SCSLPQT.
- Specific human D-substituted peptides of SCHLPWA include [D- Ser-1]-, [D-Cys-2]-, [D-His-3]-, [D-Leu-4]-, [D- Pro-5]-, [D-Trp-6]-, [D-Ala-7]-SCHLPWA and all [D]- SCHLPWA.
- the SCHLPWA and SCSLPQT peptides may contain D-substituted amino acids for any two, three, four, five or six positions.
- leptin related peptides comprising N-termi ⁇ al amino acids 21-35, 31-45, 41-55 and 51-65 of native leptin and fragments, derivatives, analogs and homologs thereof.
- Additional leptin peptides of the invention comprise amino acids sequences 61-75, 71-85, 81-95, 91- 105, 106-120, 116-130, 126-140, 136-150, 146-160, and 156-167 of mouse and/or human full length leptin. See WO04039832.
- the leptin is of the sequence Ser Cys His Leu Pro Xaa Ala Ser GIy Leu GIu Thr Leu Asp Ser Leu GIy GIy VaI Leu GIu Ala Ser GIy Tyr Ser Thr GIu VaI VaI Ala Leu Ser Arg Leu Xaa GIy Ser Leu Xaa Asp Xaa Leu Xaa Xaa Leu Asp Leu Ser Pro GIy Cys (SEQ ID NO: 564) wherein: Xaa at position 6 is Trp or GIn; Xaa at position 36 is GIn or GIu; Xaa at position 40 is GIn or GIu; Xaa at position 42 is De, Leu, Met or methionine sulfoxide; Xaa at position 44 is Trp or GIn; and Xaa at position 45 is GIn or GIu.
- leptin of the above are where Xaa at position 6 is Trp; Xaa at position 36 is GIn; Xaa at position 40 is GIn; Xaa at position 42 is Met; Xaa at position 44 is Trp; and Xaa at position 45 is Gb. See U.S. Patent 5521283.
- leptins are native sequences, including
- Murine leptin VaI Pro lie GIn Lys VaI GIn Asp Asp Thr Lys Thr Leu lie Lys Thr lie VaI Thr Arg lie Asn
- He GIn lie Ser Asn Asp Leu GIu Asn Leu Arg Asp Leu Leu His VaI Leu Ala Phe Ser Lys Ser Cys His Leu
- Bovine leptin VaI Pro lie Cys Lys VaI GIn Asp Asp Thr Lys Thr Leu lie Lys Thr lie VaI Thr Arg De Asn Asp He Ser His Thr Xaa Ser VaI Ser Ser Lys GIn Arg VaI Thr GIy Leu Asp Phe He Pro GIy Leu His Pro Leu Leu Ser Leu Ser Lys Met Asp GIn Thr Leu Ala lie Tyr GIn GIn He Leu Thr Ser Leu Pro Ser Arg Asn VaI VaI GIn He Ser Asn Asp Leu GIu Asn Leu Arg Asp Leu Leu His Leu Leu Ala Ala Ser Lys Ser Cys Pro Leu Pro GIn VaI Arg Ala Leu GIu Ser Leu GIu Ser Leu GIy VaI VaI Leu GIu Ala Ser Leu Tyr Ser Thr GIu VaI VaI Ala Leu Ser Arg Leu GIn Asp Met Leu Arg
- leptin peptide components are of the sequence:
- Xaa at position 22 is Asn, Asp or GIu; Xaa at position 27 is Thr or Ala; Xaa at position 28 is GIn, GIu, or absent; Xaa at position 54 s Met or Ala; Xaa at position 68 s Met or Leu; Xaa at position 72 Asn, Asp or GIu; Xaa at position 77 is Ser or Ala; Xaa at position 118 is GIy or Leu; said protein having at least one substitution selected from the group consisting of: His at position 97 is replaced with Ser or Pro; Trp at position 100 is replaced with GIn, Ala or Leu; Ala at position 101 is replaced
- leptin are of the sequence: VaI Pro lie GIn Lys VaI GIn Asp Asp Thr Lys Thr Leu lie Lys Thr lie VaI Thr Arg lie Asn Asp lie Ser His Xaa GIn Ser VaI Ser Ser Lys GIn Lys VaI Thr GIy Leu Asp Phe lie Pro GIy Leu His Pro lie Leu Thr Leu Ser Lys Met Asp GIn Thr Leu Ala VaI Tyr GIn GIn De Leu Thr Ser Met Pro Ser Arg Asn VaI lie GIn lie Xaa Asn Asp Leu GIu Asn Leu Arg Asp Leu Leu His VaI Leu Ala Phe Ser Lys Ser Cys His Leu Pro Trp Ala Ser GIy Leu GIu Thr Leu Asp Ser Leu GIy GIy VaI Leu GIu Ala Ser Xaa Tyr Ser Thr GIu VaI VaI Ala Leu Ser Arg Leu GIn
- Xaa at position 27 is Thr; Xaa at position 77 is Ser; Xaa at position 118 is GIy; and the amino acid residues at positions 97, 100, 101, 105, 106, 107, 108, and 111 are as in the following table:
- the leptin is of the sequence: He Pro GIy Leu His Pro De Leu Thr Leu Ser Lys Xaa Asp Xaa Thr Leu Ala VaI Tyr Xaa Xaa He Leu Thr Ser Xaa Pro Ser Arg Xaa VaI He Xaa He Ser Xaa Asp Leu GIu Xaa Leu Arg Asp Leu Leu His VaI Leu Ala Phe Ser Lys Ser Cys His Leu Pro Xaa Ala Ser GIy Leu GIu Thr Leu Asp Ser Leu GIy GIy VaI Leu GIu Ala Ser GIy Tyr Ser Thr GIu VaI VaI Ala Leu Ser Arg Leu Xaa GIy Ser Leu Xaa Asp Xaa Leu Xaa Xaa Leu Asp Leu Ser Pro GIy Cys (SEQ H) NO.573), wherein: X
- the leptin of the above formula has Xaa at position 13 is Met; Xaa at position 15 is GIn; Xaa at position 21 is GIn; Xaa at position 22 is GIn; Xaa at position 27 is Met; Xaa at position 31 is Asn; Xaa at position 34 is GIn; Xaa at position 37 is Asn; Xaa at position 41 is Asn; Xaa at position 59 is Trp; Xaa at position 89 is GIn; Xaa at position 93 is GIn; Xaa at position 95 is Met; Xaa at position 97 is Trp; and Xaa at position 98 is GIn. See U.S. Patent 5532336.
- Exemplary leptin analogs include those where the amino acid at position 43 is substituted with Asp or GIu; position 48 is substituted Ala; position 49 is substituted with GIu, or absent; position 75 is substituted with Ala; position 89 is substituted with Leu; position 93 is substituted with Asp or GIu; position 98 is substituted with Ala; position 117 is substituted with Ser, position 139 is substituted with Leu, position 167 is substituted with Ser, and any combination thereof.
- Certain exemplary leptin and leptin analogs with leptin activity include:
- PPF Pancreatic Polypeptide Family
- PPF Pancreatic Polypeptide Family
- Native PPF peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known PYY family peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- PPF pancreatic polypeptide family
- Pancreatic polypeptide (“PP") was discovered as a contaminant of insulin extracts and was named by its organ of origin rather than functional importance (Kimmel et al., Endocrinology 83: 1323-30 (1968)). PP is a 36-amino acid peptide containing distinctive structural motifs. A related peptide was subsequently discovered in extracts of intestine and named Peptide YY ("PYY”) because of the N- and C-terminal tyrosines (Tatemoto, Proc. Natl. Acad. Sci. USA 79: 2514-8 (1982)). A third related peptide was later found in extracts of brain and named Neuropeptide Y ("NPY”) (Tatemoto, Proc. Natl. Acad. Sci. USA 79: 5485-9 (1982); Tatemoto et al., Nature 296: 659-60 (1982)).
- NPY Neuropeptide Y
- PYY(3-36) An alternate molecular form of PYY is PYY(3-36) (Eberlein et al., Peptides 10: 797-803 (1989); Grandt et al., Regul. Pept. 51: 151-9 (1994)).
- This fragment constitutes approximately 40% of total PYY-like immunoreactivity in human and canine intestinal extracts and about 36% of total plasma PYY immunoreactivity in a fasting state to slightly over 50% following a meal. It is apparently a dipeptidyl peptidase-W (DPP4) cleavage product of PYY.
- DPP4 dipeptidyl peptidase-W
- PYY(3-36) is reportedly a selective ligand at the Y2 and Y5 receptors, which appear pharmacologically unique in preferring N- terminally truncated (i.e., C-terminal fragments of) NPY analogs.
- Peripheral administration of PYY reportedly reduces gastric acid secretion, gastric motility, exocrine pancreatic secretion (Yoshinaga et al., Am. J. Physiol.
- PYY centrally administered PYY had some effects opposite to those described herein for peripherally injected PYY(3-36) in that gastric acid secretion was stimulated, not inhibited. Gastric motility was suppressed only in conjunction with TRH stimulation, but not when administered alone, and was indeed stimulatory at higher doses through presumed interaction with PP receptors. PYY has been shown to stimulate food and water intake after central administration (Morley et al., Brain Res. 341: 200-3 (1985); Corp et al., Am. J. Physiol. 259: R317-23 (1990)).
- any PPF analog or derivative known in the art may be used in conjunction with a GlP component in the present invention.
- the PPF analogs and derivatives have at least one hormonal activity of a native PPF polypeptide.
- the PPF analogs are agonists of a receptor which native PPF polypeptide is capable of specifically binding.
- Exemplary PPF analogs and derivatives include those described in WO 03/026591 and WO 03/057235, which are herein incorporated by reference in their entirety.
- preferred PPF analogs and derivatives that exhibit at least one PPF hormonal activity generally comprise at least two PYY motifs including a polyproline motif and C-terminal tail motif.
- PYY motifs including a polyproline motif and C-terminal tail motif.
- Such analogs are generally described in U.S. Provisional Application No. 60/543,406 filed February 11, 2004, published as US 2006/013547A1 on June 22, 2006, which are herein incorporated by reference.
- Other preferred PPF analogs are disclosed in PCT/US2005/004351, entitled “Pancreatic Polypeptide Family Motifs and Polypeptides Comprising the Same", published as WO2005/077094 on August 25, 2005, the contents of which are hereby incorporated by reference.
- Native porcine PYY has been characterized as including two C-terminal helical segments from residues 17 to 22 and 25 to 33 separated by a kink at residues 23, 24, and 25, a turn centered around residues 12-14, and the N-terminus folded near residues 30 and 31. Further, full-length porcine PYY has been characterized as including the PP fold, stabilized by hydrophobic interactions among residues in the N- and C- termini. See id.
- a "PYY motif is generally a structural component, primary, secondary, or tertiary, of a native PP family polypeptide that is critical to biological activity, i.e., biological activity is substantially decreased in the absence or disturbance of the motif.
- Preferred PYY motifs include the N-terminal polyproline type H motif of a native PP family polypeptide, the type II ⁇ -turn motif of native PP family polypeptide, the ⁇ - helical motif at the C-terminal end of native PP family polypeptide, and the C-terminal tail motif of native PP family polypeptide.
- amino acids corresponding to residues 5 and 8 of a native PP family polypeptide are generally conserved as a proline.
- the type II ⁇ -turn motif will generally include amino acids corresponding to residues 12-14 of a native PP family polypeptide.
- the ⁇ -helical motif can generally extend from amino acids corresponding to approximately residue 14 of a native PP family polypeptide to any point up to and including the C-terminal end, so long as the ⁇ -helical motif includes a sufficient number of amino acid residues such that an ⁇ -helical turn is formed in solution.
- the ⁇ -helical motif can also include amino acid substitutions, insertions and deletions to the native PP family sequence, so long as the ⁇ -helical turn is still formed in solution.
- the C-terminal tail motif generally includes amino acids corresponding to approximately the last 10 residues of a native PP family polypeptide, more preferably the last 7, 6, or 5 residues of a native PP family polypeptide, and more preferably amino acid residues 32-35.
- Preferred PYY analogs include those with internal deletions, insertions, and substitutions in areas of the PYY molecule not corresponding to the polyproline motif and/or the C-terminal tail motif. For instance, internal deletions at positions 4, 6, 7, 9, or 10 are envisioned.
- the component hormone is a PPF polypeptide containing at least two PPF motifs including at least the N-terminal polyproline PPF motif and the C-terminal tail PPF motif.
- motif refers to an amino acid sequence that is characteristic of a specific biochemical function or defines an independently folded domain. Additional PPF motifs can correspond to a motif of any of the PP family polypeptides, including PP, PYY and NPY, for example the type II beta-turn region motif of PYY, or the ⁇ -helical motif at the C-terminal end of PYY.
- the PPF family component module is a PPF chimeric polypeptide comprising a fragment of a PP, PYY or NPY polypeptide covalently linked to at least one additional fragment of a second PP, PYY or NPY polypeptide, wherein each PP, PYY or NPY fragment includes a PPF motif.
- the PPF chimeric can comprise a fragment of a PP family polypeptide linked to one, two, three, or four polypeptides segments, wherein at least one of the linked polypeptide segments is a fragment of a second PP family polypeptide.
- PPF polypeptides do not include an N- terminal PP fragment with a C-terminal NPY fragment.
- PPF chimeric polypeptide component module will exhibit at least 50% sequence identity to a native PYY(3-36) over the entire length of the PYY(3-36).
- such PPF chimeric polypeptide can exhibit at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to a native PYY(3-36) over the entire length of the PYY(3-36).
- Such PPF chimeric polypeptides can exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to a native PP.
- such PPF chimeric polypeptide can exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to a native NPY.
- the PPF chimeric polypeptides can include at least the N-terminal polyproline PPF motif and the C-terminal tail PPF motif.
- any of the PPF family peptides if not contained as a hybrid component, can be provided as a second agent, e.g. as a second anti- obesity agent, with a hybrid as described herein.
- the PPF chimeric polypeptide will generally retain, at least in part, a biological activity of native human PP, PYY, or NPY. In some embodiments, the PPF chimeric polypeptide exhibits a biological activity in the treatment and prevention of metabolic conditions and disorders.
- the polypeptide fragments of the PPF chimeras can be covalently linked together in any manner known in the art, including but not limited to direct amide bonds or chemical linker groups. Chemical linker groups may include peptide mimetics which induce or stabilize polypeptide conformation.
- PPF chimeric polypeptides include PYY-PP, PYY-NPY, PP-PYY 5 PP-NPY, NPY-PP 5 or NPY-PYY chimeras.
- the PPF chimera can be at least 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, or 34 amino acids in length.
- the PYY analog polypeptides include only natural L amino acid residues and/or modified natural L amino acid residues. In some embodiments, the PYY analog polypeptides do not include unnatural amino acid residues.
- the PPF chimeric polypeptides include: hPP(l-7)-pNPY 5 hPP(l-17)-pNPY, hPP(19-23)-pNPY, hPP(19-23)-Pro 34 pNPY, hPP(19-23)-His 34 pNPY, rPP(19-23)-pNPY, rPP(19-23> Pro 34 pNPY, rPP(19-23)-His 34 pNPY, hPP(l-17)-ffis 34 pNPY, pNPY(l-7)-hPP, pNPY(l-7, 19-23)-hPP, cPP(l- 7)-pNPY(19-23)-hPP, cPP(l-7)-NPY(19-23)-His 34 hPP, hPP(l-17)-His 34 pNPY, hPP(19-23)-pNPY, hPP(19- 23)-Pro
- the PPF chimeric polypeptides can comprise fragments of PP family analog polypeptides.
- the PPF chimeric polypeptides may comprise PPF analog polypeptides described herein, as well as PP analog polypeptides, and NPY analog polypeptides.
- PYY analog polypeptide for use in the GIP hybrids of the invention, or administered as a second agent with a GEP hybrid are those having a potency in one of the assays described herein (including food intake, gastric emptying, pancreatic secretion, body composition or weight reduction assays) which is equal to or greater than the potency of NPY, PYY, or PYY(3-36) in that same assay.
- the PPY analog polypeptide for use in a GIP hybrid component may be useful in the treatment of metabolic diseases, such as, for example, obesity, insulin resistence syndrome (Syndrome X) or diabetes mellitus.
- the PYY analog polypeptide for use in a GIP hybrid may exhibit improved ease of manufacture, stability, and/or ease of formulation, as compared to PP, NPY, PYY, or PYY(3-36).
- the PPF chimeric polypeptide component portion retains at least about 25%, or from about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 98%, or about 99% percent of the biological activity of native human PYY with regard to the reduction of nutrient availability, the reduction of food intake, the effect of body weight gain, and/or the treatment and prevention of metabolic conditions and disorders.
- the PPF chimeric polypeptide for use in a GIP hybrid exhibits improved PYY agonist activity.
- the PPF chimeric polypeptides exhibits at least about 110%, about 125%, about 130%, about 140%, about 150%, about 200%, or more of the biological activity of native human PYY with regard to the reduction of nutrient availability the reduction of food intake, the effect of body weight gain, and/or the treatment and prevention of metabolic conditions and disorders.
- the PPF chimeric polypeptides comprise a fragment of PP linked to a fragment of PYY.
- the PPF chimeric polypeptides comprise an N-terminal fragment of PP or a PP analog polypeptide linked at its C-terminal end to a C-terminal fragment of PYY or a PYY analog polypeptide.
- the PPF chimeric polypeptides comprise an N-terminal fragment of PYY, PYY(3-36), or a PYY analog polypeptide linked at its C-terminal end to a C-terminal fragment of PP or a PP analog polypeptide.
- the PPF chimeric polypeptides comprise a fragment of PYY linked to a fragment of NPY.
- the PPF chimeric polypeptides comprise an N-terminal fragment of PYY, PYY(3-36), or a PYY analog polypeptide linked at its C-terminal end to a C-terminal fragment of NPY or a NPY analog polypeptide.
- the PPF chimeric polypeptides comprise an N- terminal fragment of NPY or a NPY analog polypeptide linked at its C-terminal end to a C-terminal fragment of PYY or a PYY analog polypeptide.
- the PPF chimeric polypeptides comprise a fragment of PP linked to a fragment of NPY.
- the PPF chimeric polypeptides comprise an N-terminal fragment of PP or a PP analog polypeptide linked at its C-terminal end to a C-terminal fragment of NPY or a NPY analog polypeptide.
- the PPF chimeric polypeptides comprise an N-terminal fragment of NPY or a NPY analog polypeptide linked at its C-terminal end to a C-terminal fragment of PP or a PP analog polypeptide.
- a fragment of PP, a PP analog polypeptide, PYY, PYY(3-36), a PYY analog polypeptide, NPY, or an NPY analog polypeptide is a fragment comprising anywhere from 4 to 20 amino acid residues of the PP, PP analog polypeptide, PYY, PYY(3-36), PYY analog polypeptide, NPY, or NPY analog polypeptide.
- the length of fragment is selected so as to obtain a final PPF chimeric polypeptide of at least 34 amino acids in length.
- the PPF chimeric polypeptides when used in a GIP hybrid may also comprise further modifications including, but are not limited to, substitution, deletion, and insertion to the amino acid sequence of such PPF chimeric polypeptides and any combination thereof.
- the PPF chimeric polypeptides include one or more modifications of a "non-essential" amino acid residue.
- a "non-essential" amino acid residue is a residue that can be altered, i.e., deleted or substituted, in the native human amino acid sequence without abolishing or substantially reducing the activity interest.
- PPF chimeric polypeptides are also useful in a GIP hybrid.
- Such derivatives include PPF chimeric polypeptides conjugated to one or more water soluble polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, oleoyl etc.), or by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala.
- PEG polyethylene glycol
- fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, oleoyl etc.)
- polyamino acids such as poly-his, poly-arg, poly-lys, and poly-ala.
- Modifications to the PPF chimeric polypeptides can also include small molecule substituents, such as short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
- the water soluble polymer molecules will have a molecular weight ranging from about 500 to about 20,000 Daltons.
- Such polymer-conjugations and small molecule substituent modifications may occur singularly at the N- or C-terminus or at the side chains of amino acid residues, which are not involved in formation of the hybrid, within the sequence of the PPF chimeric polypeptides.
- Substitution of one or more amino acids with lysine, aspartic acid, glutamic acid, or cysteine may provide additional sites for derivatization. See, e.g., U.S. Patent Nos. 5,824,784 and 5,824,778.
- the PPF chimeric polypeptides may be conjugated to one, two, or three polymer molecules.
- the water soluble polymer molecules are linked to an amino, carboxyl, or thiol group, and may be linked by N or C terminus, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine.
- the water soluble polymer molecules may be linked with diamine and dicarboxylic groups.
- the PPF chimeric polypeptides are conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid.
- PPF chimeric polypeptides also include PPF chimeric polypeptides with chemical alterations to one or more amino acid residues.
- chemical alterations include amidation, glycosylation, acylation, sulfation, phosphorylation, acetylation, and cyclization.
- the chemical alterations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the PPF chimeric polypeptides.
- the C-terminus of these peptides may have a free -OH or -NH 2 group.
- the N-terminal end may be capped with an isobutyloxycarbonyl group, an isopropyloxycarbonyl group, an n-butyloxycarbonyl group, an ethoxycarbonyl group, an isocaproyl group (isocap), an octanyl group, an octyl glycine group (G(Oct)), or an 8-aminooctanic acid group.
- cyclization can be through the formation of disulfide bridges. Alternatively, there may be multiple sites of chemical alteration along the PYY analog polypeptide.
- the PPF chimeric polypeptides include those having an amino acid sequence of SEQ ID NOs. 238-347 of US2006/013547A1.
- Exemplary PPF chimeric polypeptides include polypeptides of the Formula (VI):
- Xaai is Tyr or absent
- Xaa 2 is De, Pro, or absent
- Xaa 3 is He, BH-modif ⁇ ed Lys, Lys, VaI, or Pro;
- Xaa 4 is Lys, BH-modif ⁇ ed Lys, Ala, Ser, or Arg;
- Xaa 7 is Ala, GIy 5 or His;
- Xaa 9 is GIy or Ala
- Xaa 12 is Ala or Pro
- Xaai 3 is Ser or Pro
- Xaa 14 is Pro, Ala, or Ser
- Xaai ⁇ is Glu orAsp
- Xaa ⁇ is Leu or De
- Xaa i9 is Arg, Lys, BH-modified Lys, GIn, or N(Me)AIa;
- Xaa 2 i is Tyr, Ala, Phe, Lys or BH-modified Lys
- Xaa 22 is Ala or Ser
- Xaa 23 is Ser, Ala, or Asp
- Xaa 25 is Arg, Lys or BH-modified Lys
- Xaa 2 ⁇ is His, Ala, or Arg
- Xaa 28 is Leu or He
- Xaa 35 is Lys, BH-modif ⁇ ed Lys, or Arg;
- Xaa 36 is Tyr, Trp, orPhe.
- the PPF polypeptide of Formula VI can be a native PPF polypeptide, PYY(2-36), Val3hPYY(3-36), Lys25hPYY(3-36) 5 Lys25De28hPYY(3-36), Lys25De31hPYY(3-36),
- polypeptides of Formula VI may be in the free acid form, or may be C-terminally amidated.
- the PPF polypeptide may comprise an N-te ⁇ ninal fragment consisting essentially of the first 17 amino acid residues of native human PYY (Tyr Pro De Lys Pro GIu Ala Pro GIy GIu Asp Ala Ser Pro GIu GIu Leu Asn Arg Tyr Tyr Ala Ser Leu Arg His Tyr Leu Asn Leu VaI Thr Arg Gk Arg Tyr) (SEQ ID NO:46) linked to a C-terminal fragment consisting essentially of amino acid residues 18-36 of native human NPY (Tyr Pro Ser Lys Pro Asp Asn Pro GIy GIu Asp Ala Pro Ala GIu Asp Met Ala Arg Tyr Tyr Ser Ala Leu Arg His Tyr He Asn Leu De Thr Arg GIn Arg Tyr) (SEQ D> NO:577), wherein one or more amino acid residues at the N-terminus of the PYY fragment may be deleted or absent, and wherein one, two amino acid residues at the N-termin
- an N-teiminal fragment consisting essentially of the first 17 amino acids of the PPF polypeptide may exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to the first 17 amino acids of a native PYY.
- a C-terminal fragment of the PPF polypeptide consisting essentially of amino acid residues 18-36 may exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to amino acids 18-36 of a native NPY.
- amino acids in the N-terminal fragment of PYY e.g., prolines at position 5 and 8, glutamates at positions 6, 10 and 15, or aspartate at position 11
- amino acids in the C-terminal fragment of NPY e.g., tyrosines at positions 20 and 27, leucine at position 24, asparagine at position 29, threonine at position 32, arginine at position 33, or glutamine at position 34
- the PPF polypeptides include those having an amino acid sequence of SEQ ID Nos. 266, 267, 274, 282, 320, and 436 to 480 of US2006/013547A1.
- the PPF polypeptides further comprise an N-terminal cap.
- these PPF polypeptides include SEQ ID NOs: 282, 320, 437, 441, 444, 445-447, 452, 454-459, 461464, 466, 468-470 and 472-480 of US2006/013547A1.
- PPF polypeptides include polypeptides of the Formula (VH):
- Xaai is Tyr or absent
- Xaa 2 is He, Pro, or absent
- Xaai is Lys, BH-modified Lys, Ala, Ser, or Arg;
- Xaa « is GIu, GIn, Ala ⁇ Asn, Asp, or VaI;
- Xaa 9 is GIy or Ala
- Xaaio is GIu, Ala, Asp, Asn, GIn, GIy, Pro, or Aib;
- Xaa ⁇ is GIu, Ala, Asp, Asn, GIn, GIy, Pro, or Aib;
- Xaa ⁇ is Ser or Pro
- Xaai 4 is Pro, Ala, or Ser
- Xaais is GIu, Ala, Asp, Asn, GIn, GIy, Pro, or Aib;
- Xaai ⁇ is GIu or Asp
- Xaa ⁇ is Leu or lie
- Xaaig is Arg, Lys, BH-modified Lys, GUi, or N(Me)AIa;
- Xaa 2 i is Tyr, Ala, Phe, Lys, or BH-modified Lys
- Xaa 22 is Ala or Ser
- Xaa 23 is Ser, Ala, or Asp
- Xaa 25 is Arg, Lys or BH-modified Lys
- Xaa 26 is His, Ala, or Arg
- Xaa 27 is Tyr, or Phe
- Xaa 28 is Leu or He
- Xaa 29 is Asn, or GIn;
- Xaa 3 o is Leu or Met; and [00194]
- the polypeptides of Formula VII may be in the free acid form, or may be C-terminally amidated, depending on the linkage to the GIP or other peptide family component in a GIP hybrid.
- the PPF polypeptide may comprise an N-terminal fragment consisting essentially of the first 17 amino acid residues of native human PYY (SEQ ID NO: 2 of US2006/013547A1) linked to a C-terminal fragment consisting essentially of amino acid residues 18-36 of native human NPY (SEQ ID NO: 4 of US 2006/013547 Al), wherein one or more amino acid residues at the N-terminus of the PYY fragment may be deleted or absent, and wherein one, two, three, four, five, six, seven, eight, nine or ten amino acid substitutions may be made in each of the PYY and NPY fragments.
- an N- terminal fragment consisting essentially of the first 17 amino acids of the PPF polypeptide may exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to the first 17 amino acids of a native PYY.
- a C-terminal fragment of the PPF polypeptide consisting essentially of amino acid residues 18-36 may exhibit at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 92%, at least 94% or at least 97% sequence identity to amino acids 18-36 of a native NPY.
- amino acids in the N-terminal fragment of PYY e.g., prolines at positions 3, 5 and 8, or histidine 7
- amino acids in the C-terminal fragment of NPY e.g., alanine at position 18, tyrosines at positions 20 and 36, leucine at position 24, threonine at position 32, arginine at position 33, glutamine at position 34, or arginine at position 35
- the PPF polypeptides include those having an amino acid sequence of a PYY-NPY chimera such as SEQ ID Nos.
- PPF polypeptides further comprise an N-terminal cap.
- PPF polypeptides examples include SEQ ID NOs: 437, 462, 469, 470 and 472 of US 2006/013547A1.
- sequence 438 of US2006/013547 Al is Pro Lys Pro GIu His Pro GIy GIu Asp Ala Ser Pro GIu GIu Leu Ala Arg Tyr Tyr Ala Ser Leu Arg Ala Tyr lie Asn Leu He Thr Arg GIn Arg Tyr (SEQ ID NO:576).
- a hybrid of the present invention includes as one component the sequence 438 of US2006/O13547A1 or a PYY-NPY chimera with the amino acid sequence He, Lys, Pro, GIu, His, Pro, GIy, GIu, Asp, Ala, Ser, Pro, GIu, GIu, Leu, Ala, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, Ala, Tyr, He, Asn, Leu, lie, Thr, Arg, GIn, Arg, Tyr (SEQ ID No. 456), particularly in GIP hybrids useful to treat obesity, reduce weight, reduce or redistribute fat, and reduce caloric intake.
- Such a GIP hybrid can also further contain an amylinomimetic component or a leptin component or both.
- the GD? hybrids containing a PPF polypeptide or PPF chimera component find use in methods including, altering body composition of a subject, comprising administering to the subject the hybrid wherein the hybrid alters the fat to lean ratio, thereby alter*TM? and improving body composition.
- the PPF polypeptide can comprise an amino acid sequence selected from the group consisting of a PYY-NPY chimera compound with the amino acid sequence lie, Lys, Pro, GIu, His, Pro, GIy, GIu 5 Asp, Ala, Ser, Pro, GIu, GIu, Leu, Ala, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, Ala, Tyr, lie, Asn, Leu, lie, Thr, Arg, GIn, Arg, Tyr (SEQ ID No.
- the body fat and lean body mass are measured as percent body fat and percent lean body mass, respectively. In one further embodiment body weight is reduced. In another embodiment body weight is maintained or increased.
- the compounds can be administered peripherally.
- the PPF polypeptide or PPF chimera or PPF-containing GIP hybrid can be used in a method that further comprises administering to the subject at least one other agent selected from the group consisting of an amylin, amylin agonist or amylin analog agonist, salmon calcitonin, a cholecystokinin (CCK) or CCK agonist, a leptin (OB protein) or leptin agonist, an exendin or exendin analog agonist, a GLP-I, GLP-I agonist or GLP-I analog agonist, a CCK or CCK agonist, calcitonin, a calcitonin agonist, a small molecule cannabinoid CBl receptor antagonist, rimonabant, an 11 beta
- the subject is overweight or obese.
- the GIP hybrids containing a PPF polypeptide or PPF chimera component find use in methods including a method for preferentially lowering plasma triglyceride levels in a subject, comprising administering to the subject an amount of the compound effective to lower plasma triglyceride levels, wherein cholesterol levels are lowered to a lesser extent.
- triglyceride levels are lowered and cholesterol levels are not lowered.
- triglyceride levels are lowered and LDL cholesterol levels are not lowered.
- triglyceride levels are lowered and LDL cholesterol levels are lowered to a lesser extent.
- amylase levels are also lowered.
- the GIP hybrids containing a PPF polypeptide or PPF chimera find use in methods including a method for reducing body fat or body fat gain in a subject while maintaining or increasing lean body mass, comprising administering to the subject an amount of the compound effective to reduce body fat or body fat gain while maintaining or increasing lean body mass.
- the GIP hybrid containing a PPF polypeptide or PPF chimera find use in methods including a method of reducing visceral body fat in a subject, comprising administering to the subject an amount of the compound effective to reduce visceral body fat and preserve or increase lean body mass.
- the GBP hybrid containing a PPF polypeptide or PPF chimera find use in methods including a method to alter fat distribution in the subject. In one aspect, the alteration results from an increased metabolism of visceral or ectopic fat, or both in the subject.
- the GIP hybrid containing a PPF polypeptide or PPF chimera find use in methods including a method of increasing fatty acid ⁇ -oxidation while preserving or increasing lean body mass in a subject comprising administering to the subject an amount of the compound effective to increase fatty acid ⁇ -oxidation while preserving or increasing lean body mass.
- the GIP hybrid containing a PPF polypeptide or PPF chimera find use in methods including a method of treating nonalcoholic steatohepatitis or lipodystrophy in a subject comprising administering to the subject an amount of a compound effective to treat nonalcoholic steatohepatitis or lipodystrophy.
- GIP hybrids of particular interest in the above uses can contain a PPF chimera as described herein in further combination with a component from the leptin family or the amylin family, such as an amylin-sCT-amylin hybrid, or both.
- a GEP/PPF-chimera/leptin hybrid or a GIP/PPF- chimera/amylin-sCT-amylin hybrid will provide an effect superior to either parent compound alone.
- a GIP/PPF-chimera/leptin hybrid is administered with an amylinomimetic such as an amylin-sCT-amylin chimera, and alternatively a GIP/PPF-chimera/amylin-sCT-amylin hybrid is administered with a leptin.
- Component peptide hormones useful in the present invention also include GLP-I peptide hormones.
- GLP-I peptide hormones including GLP-l(l-37), GLP-l(7-37), and GLP-I (7-36)amide, are known in art, as are functional peptide analogs and derivatives.
- GLP-I refers to all native forms of GLP-I peptide hormones. Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known GLP-I peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- GLP-I glucagon-like peptide-1
- GLP-I Various truncated forms of GLP-I, are known to stimulate insulin secretion (insulinotropic action) and cAMP formation (see, e.g., Mojsov, S., Int. J. Pep. Pro. Res., 40:333-343 (1992)).
- a relationship between various in vitro laboratory experiments and mammalian, especially human, insulinotropic responses to exogenous administration of GLP-I, GLP-I (7-36) amide, and GLP-I (7-37) acid has been established (see, e.g., Nauck, M. A., et al., Diabetologia, 36:741-744 (1993); Gutniak, M., et al., New Eng. J.
- GLP-l(7-36) amide exerts a pronounced antidiabetogenic effect in insulin-dependent diabetics by stimulating insulin sensitivity and by enhancing glucose-induced insulin release at physiological concentrations (Gutniak M., et al., New Eng. J. Med., 326:1316-1322 (1992)).
- GLP-I (7-36) amide stimulates insulin release, lowers glucagon secretion, inhibits gastric emptying and enhances glucose utilization (Nauck, 1993; Gutniak, 1992; Nauck, 1993).
- GLP-I type molecules for prolonged therapy of diabetes has been complicated because the serum half- life of such peptides is quite short.
- GLP-I is a 30-amino acid peptide derived from proglucagon, a 160-amino acid prohormone. Actions of different prohormone convertases in the pancreas and intestine result in the production of glucagon and other ill-defined peptides, whereas cleavage of proglucagon results in the production of GLP-I and GLP-2 as well as two other peptides.
- the amino acid sequence of GLP-I is 100% homologous in all mammals studied so far, implying a critical physiological role.
- GLP-I (7-37) acid is C- terminally truncated and amidated to form GLP-I (7-36) NH2.
- GLP-I (7-37) OH 5 and the amide, GLP-I (7-36) NH2 are indistinguishable.
- the numbering of the amino acids is based on the processed GLP-I (1-37) OH from proglucagon.
- the biologically active GLP-I is the result of further processing: GLP-I (7-36) NH2.
- the first amino acid of GLP-I (7-37) OH or GLP-I (7-36)NH2 is 7His.
- GLP-I In the gastrointestinal tract, GLP-I is produced by L-cells of intestinal, colonic and rectal mucosa, in response to stimulation by intraluminal glucose.
- the plasma half-life of active GLP-I is ⁇ 5 minutes, and its metabolic clearance rate is around 12-13 minutes (Hoist, Gastroenterology 107(6):l 848-55 (1994)).
- GLP-I The major protease involved in the metabolism of GLP-I is dipeptidyl peptidase (DPP) IV (CD26) which cleaves the N-terminal His-Ala dipeptide, thus producing metabolites, GLP-I (9-37) OH or GLP-I (9- 36) NH2 which are variously described as inactive, weak agonist or antagonists of GLP-I receptor.
- DPP dipeptidyl peptidase
- CD26 dipeptidyl peptidase
- GLP-I 9-37
- GLP-I (9- 36) NH2 which are variously described as inactive, weak agonist or antagonists of GLP-I receptor.
- GLP- 1 receptor GLP- 1 receptor
- GLP-IR is a G protein coupled receptor of 463 amino acid and is localized in pancreatic beta cells, in the lungs, and to a lesser extent in the brain, adipose tissue and kidneys.
- GLP-I (7-37) OH or GLP-I (7-36)NH2 results in adenylate cyclase activation, cAMP synthesis, membrane depolarization, rise in intracellular calcium and increase in glucose-induced insulin secretion (HoIz et al, J. Biol. Chem. 270(30): 17749-57 (1995)).
- GLP-I is a potent insulin secretagogue that is secreted from the intestinal mucosa in response to food intake.
- the profound incretin effect of GLP-I is underscored by the fact that GLP-IR knockout mice are glucose-intolerant.
- the incretin response of i.v. infused GLP-I is preserved in diabetic subjects, though the incretin response to oral glucose in these patients is compromised.
- GLP-I administration by infusion or sc injections controls fasting glucose levels in diabetic patients, and maintains the glucose threshold for insulin secretion (Gutniak et al., N. Engl. J. Med. 326:1316-22 (1992); Nauck et al., Diabet. Med.
- GLP-I has shown tremendous potential as a therapeutic agent capable of augmenting insulin secretion in a physiological manner, while avoiding hypoglycemia associated with sulfonylurea drugs.
- Other important effects of GLP-I on glucose homeostasis are suppression of glucagon secretion and inhibition of gastric motility.
- GLP-I inhibitory actions on pancreatic alpha cell secretion of glucagon leads to decreases in hepatic glucose production via reduction in gluconeogenesis and glycogenolysis. This antiglucagon effect of GLP-I is preserved in diabetic patients.
- GLP-I gastric motility and gastric secretion are inhibited
- vagal efferent receptors vagal efferent receptors
- direct action on intestinal smooth muscle Reduction of gastric acid secretion by GLP-I contributes to a lag phase in nutrient availability, thus obviating the need for rapid insulin response.
- the gastrointestinal effects of GLP-I contribute significantly to delayed glucose and fatty acid absorption and modulate insulin secretion and glucose homeostasis.
- GLP-I has also been shown to induce beta cell specific genes, such as GLUT-I transporter, insulin (via the interaction of PDX-I with insulin gene promoter), and hexokinase-1.
- beta cell specific genes such as GLUT-I transporter, insulin (via the interaction of PDX-I with insulin gene promoter), and hexokinase-1.
- GLP-I could potentially reverse glucose intolerance normally associated with aging, as demonstrated by rodent experiments.
- GLP-I may contribute to beta cell neogenesis and increase beta cell mass, in addition to restoring beta cell function during states of beta cell insufficiency.
- GLP-I Central effects of GLP-I include increases in satiety coupled with decreases in food intake, effected via the action of hypothalamic GLP-IR.
- a GIP hybrid comprising an incretin family hormone module can provide the functions and uses associated with the incretin family module, e.g. exendin-4, GLPl, GLP2, as discussed, in addition to having a GP function.
- any GLP-I peptide analog or derivative known in the art may be used in conjunction with the present invention.
- the GLP-I peptide analogs and derivatives have at least one hormonal activity of a native GLP-I peptide.
- the GLP-I peptide analogs are agonists of a receptor which a native GLP-I peptide is capable of specifically binding.
- Exemplary GLP-I peptide analogs and derivatives include those described in, e.g., WO 91/11457 » which is hereby incorporated by reference.
- GLP-I analogs known in the art include:
- GLP-I analogs may preferably be amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- GLP-I analogs and derivatives are disclosed in U.S. Pat. No. 5,545,618 which is incorporated herein by reference.
- a exemplary group of GLP-I analogs and derivatives include those disclosed in U.S. Patent No. 6,747,006, which is herein incorporated by reference in its entirety.
- the use in the present invention of a molecule described in U.S. Pat. No. 5,188,666, which is expressly incorporated by reference, is also contemplated.
- Another group of molecules for use in the present invention includes compounds described in U.S. Pat. No. 5,512,549, which is expressly incorporated herein by reference.
- Another exemplary group of GLP-I compounds for use in the present invention is disclosed in WO 91/11457, which is herein incorporated by reference.
- exendin C-terminal sequence with or without the tryptophan (or similar residue) which can be optionally provided as described, e.g. by the presence of a tryptophan advantageously located in the hormone that is either naturally occurring, added as a substitution or as part of a linker.
- tryptophan advantageously located in the hormone that is either naturally occurring, added as a substitution or as part of a linker.
- HGEGTFTSDVSSYLEGQAAKLFIEWLKNGG PSSGAPPPS-NH2 (SEQ ID NO: 74);
- Component peptide hormones useful in the GIP hybrids of the present invention also include GLP-2 peptide hormones.
- GLP-2 peptide hormones e.g., rat GLP-2 and its homologous including ox GLP-2, porcine GLP-2, degu GLP-2, bovine GLP-2, guinea pig GLP-2, hamster GLP-2, human GLP-2, rainbow trout GLP-2, and chicken GLP-2, are known in art, as are functional peptide analogs and derivatives.
- Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known GLP-2 peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- any GLP-2 peptide analog or derivative known in the art may be used in conjunction with the present invention.
- the GLP-2 peptide analogs and derivatives have at least one hormonal activity of a native GLP-2 peptide.
- the GLP-2 peptide analogs are agonists of a receptor which a native GLP-2 peptide is capable of specifically binding.
- Exemplary GLP-2 peptide analogs and derivatives include those described in, e.g., U.S. Ser. No. 08/669,791 and PCT Application PCT/CA97/00252, both of which are hereby incorporated by reference.
- Specific GLP-2 analogs known in the art include: rat or human GLP-2 altered at position 2 to confer DPP-IV resistance by substituting a GIy for an Ala.
- Component peptide hormones useful in the present invention also include oxyntomodulin (OXM) peptide hormones.
- OXM oxyntomodulin
- Native OXM peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known OXM peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- any OXM peptide analog or derivative known in the art may be used in conjunction with the present invention.
- the OXM peptide analogs and derivatives have at least one hormonal activity of a native OXM peptide.
- the OXM peptide analogs are agonists of a receptor which a native OXM peptide is capable of specifically binding.
- Component peptide hormones useful in the present invention also include exendin peptide hormones.
- Native exendin peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain exemplary native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known exendin peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
- Exendins are another family of peptides implicated in insulin secretion. Exendins are found in the saliva of the Gila-monster, a lizard endogenous to Arizona, and the Mexican Beaded Lizard. Exendin-3 is present in the saliva of Heloderma horridum, and exendin-4 is present in the saliva of Heloderma suspectum (Eng, J., et al., J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al., J. Biol. Chem., 267:7402-05 (1992)).
- exendins have some sequence similarity to several members of the glucagon-like peptide family, with the highest identity, 53%, being to GLP-I (Goke, et al., J. Biol. Chem., 268:19650-55 (1993)).
- Exendin-4 binds the GLP-I receptors on insulin-secreting TCl cells, at dispersed acinar cells from guinea pig pancreas, and at parietal cells from stomach; the peptide also stimulates somatostatin release and inhibits gastrin release in isolated stomachs (Goke, et al., J. Biol. Chem., 268:19650-55 (1993); Schepp, et al., Eur. J. Pharmacol., 69:183-91 (1994); Eissele, et al., Life Sci., 55:629-34 (1994)).
- Exendin-3 and exendin-4 were found to bind the GLP-I receptors on, to stimulating cAMP production in, and amylase release from, pancreatic acinar cells (Malhotra, R., et al., Rommeatory Peptides, 41:149-56 (1992); Raufman, et al., J. Biol. Chem., 267:21432-37 (1992); Singh, et al., Regul. Pept., 53:47-59 (1994)).
- the use of the insulinotropic activities of exendin-3 and exendin-4 for the treatment of diabetes mellitus and the prevention of hyperglycemia has been proposed (Eng, U.S. Pat. No. 5,424,286).
- Truncated exendin peptides such as exendin[9-39], a carboxyamidated molecule, and fragments 3-39 through 9-39 have been reported to be potent and selective antagonists of GLP-I (Goke, et al., J. Biol. Chem., 268:19650-55 (1993); Raufrnan, J. P., et al., J. Biol. Chem., 266:2897-902 (1991); Schepp, W., et al., Eur. J. Pharm., 269:183-91 (1994); Montrose-Rafizadeh, et al., Diabetes, 45(Suppl. 2):152A (1996)).
- Exendin[9-39] blocks endogenous GLP-I in vivo, resulting in reduced insulin secretion (Wang, et al., J. Clin. Invest., 95:417-21 (1995); D'Alessio, et al., J. Clin. Invest., 97:133-38 (1996)).
- the receptor apparently responsible for the insulinotropic effect of GLP-I has been cloned from rat pancreatic islet cells (Thorens, B., Proc. Natl. Acad. Sci. USA 89:8641-8645 (1992)).
- Exendins and exendin[9-39] bind to the cloned GLP-I receptor (rat pancreatic -cell GLP-I receptor: Fehmann HC, et al., Peptides, 15 (3): 453-6 (1994); human GLP-I receptor: Thorens B 5 et al., Diabetes, 42 (11): 1678-82 (1993)).
- exendin-4 is an agonist, i.e., it increases cAMP
- exendin[9-39] is an antagonist, i.e., it blocks the stimulatory actions of exendin-4 and GLP-I . Id.
- exendin-4 is a 39 amino acid C-terminal amidated peptide found in the saliva of the GiIa Monster (Heloderma suspectum), with a 53% amino acid sequence identity to the GLP-I peptide sequence.
- Eng, J., et al. "Isolation and Characterization of Exendin-4, and Exendin-3 Analogue from Heloderma suspectum Venom," J. Bio. Chem., 267:11, p. 7402-7405 (1992), Young, A. A., et al., "Glucose-Lowering and Insulin-Sensitizing Actions of Exendin-4," Diabetes, Vol. 48, p.
- exendin-4 is a highly specific agonist for the GLP-I receptor, and, like GLP-I, is able to stimulate insulin secretion. Therefore, like GLP-I, exendin-4 is regarded as an insulinotropic peptide.
- exendin-4 has a relatively long half-life in humans, because of its resistance to the dipeptidyl peptidase IV which rapidly degrades the GLP-I sequence in vivo. Furthermore, it has been shown that, as compared to GLP-I, exendin-4 has a stronger capability to stimulate insulin secretion, and that a lower concentration of exendin-4 may be used to obtain such stimulating activity. See, e.g., U.S. Pat. No. 5,424,286, herein incorporated by reference. Therefore exendin-4 peptides or derivatives thereof (for examples of such derivatives, see, e.g., U.S. Pat. No.
- a GIP hybrid comprising an exendin family hormone module can provide the functions and uses associated with the exendin family module, e.g. exendin-4, exendin tail, as discussed, in addition to having a GIP function.
- exendin peptide analog or derivative known in the art may be used in conjunction with the present invention.
- the exendin peptide analogs and derivatives have at least one hormonal activity of a native exendin peptide.
- the exendin peptide analogs are agonists of a receptor which a native exendin peptide is capable of specifically binding.
- exendin analogs include:
- exendin analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
- Catestatin Family The catestatin fragment of chromogranin A is an endogenous inhibitor of nicotinic cholinergic transmission, functioning in negative feedback control of catecholamine secretion.
- the catestatin fragment of chromogranin A is an endogenous inhibitor of nicotinic cholinergic transmission, functioning in negative feedback control of catecholamine secretion.
- Catestatin species variants include:
- Natriuretic Peptides are a family of hormones that consist of atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP). They are synthesized and stored as 3 distinct precursor prohormones, which are the 126 amino acid ANP, 108 amino acid BNP, and 104 amino acid CNP. They are each encoded by separate genes and have distinct sites of synthesis and mechanisms of regulation. Parental natriuretic peptide sequences include:
- the main site of synthesis of the ANP prohormone is the atrial myocyte where it is synthesized as a 151-amino acid preprohormone. Removal of a 25-amino acid signal peptide from its N terminal end occurs in the endoplasmic reticulum, leaving a 126-amino acid ANP prohormone (ProANP), the main storage form of ANP within the heart.
- ProANP 126-amino acid ANP prohormone
- the prohormone consists of 4 biologically active peptide segments: amino acids 1- 30 (ProANF 1-30, also known as long acting Na stimulator), 31-67 (ProANF 31-67, also known as vessel dilator), 79-98 (ProANF 79-98, also known as potassium excreter), and 99-126 (ANF, also known as atrial natriuretic factor).
- BNP was originally isolated from porcine brain but in humans it is synthesized and secreted from the left ventricle. Sequence analysis reveals that preproBNP consists of 134 residues and is cleaved to a 108- amino acid ProBNP. Cleavage of a 32-amino acid sequence from the C-terminal end of ProBNP results in human BNP (77-108), which is the physiologically active form in plasma.
- CNP is the third member of the natriuretic peptide system and is primarily found in human vascular endothelial cells, kidney, and porcine brain. High concentrations of CNP are also found in human hypothalamus and midbrain.
- preproCNP is a 126-amino acid precursor processed into proCNP by cleavage of 23 residues from its N-terminal end. This 23-amino acid sequence serves as a signal peptide.
- the terminal 22 (105-126) amino acids are cleaved fromproCNP to yield a biologically active form of CNP.
- Urodilatin is a kidney-derived member of the natriuretic peptide family and is formed from the same ANP prohormone and consists of amino acids 95-126. Except for the 4 amino acid N terminal extension, it is identical to ANF (99-126). Urodilatin appears to be an important regulator of sodium and water handling in the kidney, as well as a mediator of sodium excretion in patients with congestive heart failure (CHF).
- CHF congestive heart failure
- Natriuretic peptides exert their biologic effects by binding to high-affinity receptors on the surface of target cells. Three subtypes of NPRs — NPR-A, NPR-B, and NPRC — have been isolated.
- Natriuretic peptides including prohormone variants can impart numerous natriuretic peptide hormone activities to hybrids of the invention.
- natriuretic antagonist hybrids are natriuretic antagonist hybrids.
- Natriuresis is the excretion of an excessively large amount of sodium into the urine. Natriuresis is similar to diuresis (the excretion of an unusually large quantity of urine), except that in natriuresis the urine is exceptionally salty. Natriuresis occurs with some diuretics and diseases (as of the adrenal) and can lead to the salt-losing syndrome characterized by dehydration, vomiting, low blood pressure, and the risk of sudden death.
- ProANF 1-30, ProANF 31-67 and ANF 99- 126 each have natriuretic, blood pressure lowering and diuretic properties with ProANF 31-67 and ANF 99- 126 having the greatest impact on blood pressure.
- ProANF 79-98 stimulates potassium excretion
- ProANF 31-67 spares potassium loss by inhibiting Na/K ATPase in the medullary collecting duct cells.
- Specific to ANF 99-126 is a dose-dependent inhibition of angiotensin II-mediated aldosterone secretion
- proANF 31-67 has the property of inducing natriuresis through generation of prostaglandin.
- BNP produces similar biologic effects as ANF in normal humans. Infusions of BNP in normal men produced a 2-fold increase in sodium excretion, 50% reduction in plasma renin, angiotensin II and aldosterone secretion as well as a reduction in plasma volume.
- CNP induces cardiovascular effects similar to the other natriuretic peptides but does not appear to mediate any renal effects.
- plasma cGMP rose with a concomitant reduction in mean arterial pressure, right atrial pressure and cardiac output, but glomerular filtration rate, renal blood flow and sodium excretion decreased.
- Natriuretic peptides can provide therapeutic benefit in heart failure.
- Congestive heart failure CHF is associated with increases in vasopressin, endothelin, and with activation of the renin-angiotensin- aldosterone system, and sympathetic nervous systems, mediating vasoconstriction, sodium and water retention, and negative vascular and cardiac remodeling. These effects occur despite the elevated levels of the natriuretic peptides in patients with heart failure.
- CHF Congestive heart failure
- CHF congestive heart failure
- renin-angiotensin- aldosterone system and sympathetic nervous systems, mediating vasoconstriction, sodium and water retention, and negative vascular and cardiac remodeling.
- BNP infusion markedly increases sodium excretion in patients with heart failure and exerts significant beneficial hemodynamic effects. As compared with ANP, the diuretic and natriuretic effects of BNP are significantly greater. BNP is cleared more slowly than ANP and exerts other effects including suppressing aldosterone secretion and increasing serum levels of ANP. BNP peptides can also provide a beneficial decrease in pulmonary capillary wedge pressure, systemic vascular resistance, right atrial pressure and systolic blood pressure, with an increase in cardiac index in patients hospitalized for symptomatic CHF.
- natriuretic peptide hybrids can provide a beneficial decrease in pulmonary capillary wedge pressure and an improved dyspnea score.
- Dyspnea is an unpleasant sensation of difficulty in breathing, typically associated with early stages of cardiac heart failure.
- the hybrids containing one, two or three natriuretic hormone functions provide methods of administration of pharmaceutically active compositions that are useful for both the prophylactic and therapeutic treatment of CHF patients, preferably CHF patients that are decompensated, patients with chronic CHF, and patients with hypertension.
- the natriuretic portion(s) of a hybrid is sufficient to provide a therapeutically effective amount of a natriurertic peptide to such patient when administered in a therapeutically effective dose over a therapeutically effective period.
- any of the family of therapeutically effective natriuretic peptides or their analogs can be used as a component of a GIP hybrid.
- Useful natriuretic peptides include, for example, atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP or B-type natriuretic peptide) and C-type natriuretic peptide (CNP). Sequences of useful forms of natriuretic peptides are disclosed in U.S. Patent Publication 20010027181, which is incorporated herein by reference.
- ANPs examples include human ANP (Kangawa et al., BBRC 118:131 (1984)) or that from various species, including pig and rat ANP (Kangawa et al., BBRC 121:585 (1984)).
- Such ANPs comprise 28 amino acids.
- Such ANPs may be administered as a peptide having a ring structure of ANP (formation of a disulfide bond based on Cys), and a C- terminal portion succeeding the ring structure.
- An example of such a peptide is a peptide having amino acid residues at the 7-position to the 28-position of ANP is provided in U.S. Patent Application Publication No. 20010027181.
- Another example is frog ANP.
- Human BNP comprises 32 amino acids and involves the formation of a disulfide bond (Sudoh et al., BBRC 159:1420 (1989)) and U.S. Pat. Nos. 5,114,923, 5,674,710, 5,674,710, and 5,948,761, each of which is incorporated by reference.
- Various BNP's of origin other than human, including as pig BNP and rat BNP, are also known, and can be used.
- a further example is chicken BNP.
- CNPs that can be used in the methods of the invention include pig CNP.
- Pig CNP comprises 22 amino acids and involves the formation of a disulfide bond, like the above- described ANP and BNP (Sudoh et al., BBRC 168:863 (1990)) (human and rat have the same amino acid sequence), chicken CNP (Arimura et al., BBRC 174:142 (1991)). Frog CNP (Yoshihara et al., BBRC 173:591 (1990) can also be used. As discussed herein, one skilled in the art can apply modifications, such as a deletion, substitution, addition or insertion, and/or chemical modification to amino acid residues in the amino acid sequence of a known natriuretic peptide as desired, by known methods. The resulting compound has the activity of acting on a receptor of the starting ANP, BNP or CNP. Analogs having this activity, therefore, are included in the hybrids for use in accordance with the methods of the present invention.
- the hybrids containing one or more natriuretic functions can be used in treating hypertension.
- a natriuretic hybrid will have no deleterious effect on heart rate and is not associated with arrhythmias.
- the hybrid will comprise at least one, two or three natriuretic peptide functions, for example, both ANP and BNP activity.
- One or more natriuretic hormone functions can be combined with any other hormone function or peptidic enhancer, as described herein.
- the natriuretic portion(s) is a more stable analog having an extended in vivo half-life when compared with that of a native natriuretic peptide.
- natriuretic containing hybrids are also further directed to hypertension reduction, diuresis inducement, natriuresis inducement, vascular conduct dilatation or relaxation, natriuretic peptide receptors (such as NPR-A) binding, renin secretion suppression from the kidney, aldosterone secretion suppression from the adrenal gland, treatment of cardiovascular diseases and disorders, reducing, stopping or reversing cardiac remodeling in congestive heart failure, treatment of renal diseases and disorders; treatment or prevention of ischemic stroke, and treatment of asthma.
- NPR-A natriuretic peptide receptors
- Hybrids can be administered to patients that would benefit from inducing natriuresis, diuresis and vasodilatation.
- Hybrids can be administered alone or in combination with one or more of the following types of compounds: ACE inhibitors, beta-blockers, diuretics, spironolactone, digoxin, anticoagulation and antiplatelet agents, and angiotensin receptor blockers.
- Additional diseases or conditions include renal disorders and diseases, asthma, hypertension and pulmonary hypertension.
- Hybrids are also useful to treat inflammatory-related diseases, erectile dysfunction and hypercholesterolemia.
- the GIP hybrid polypeptides of the present invention generally comprise at least two bio-active peptide hormone modules of the invention, wherein at least one of the bio-active peptide hormone modules, typically a GIP module, exhibits at least one hormonal activity.
- at least one of the bio-active peptide hormone modules will be comprised from a GIP peptide hormone, analog, derivative, fragment, or peptidic enhancer.
- the bio-active peptide hormone module that exhibits the at least one hormonal activity may be located at the N-terminal end of the hybrid polypeptide, the C-terminal end of the hybrid polypeptide, or in the event that the hybrid polypeptide comprises more than two bio-active peptide hormone modules, may be located in the internal portion of the hybrid polypeptide.
- bio-active peptide hormone module exhibiting the at least one hormonal activity such that the C-terminal end of the bio-active peptide hormone module is amidated.
- Amidation of the C-terminal end of the bio-active peptide hormone module may be accomplished by locating the module at the C-terminal end of the hybrid peptide, or by configuring the module in the C-te ⁇ ninal-to-N-terminal direction at the N-terminal end of the hybrid polypeptide. Ih both configurations, the C-terminal end of the bio-active peptide hormone module is available for amidation.
- Specific component peptide hormones where C-terminal amidation may preferably include amylin family peptide hormones, CCK, PYY, hGLP-l(7-36) and hGLP-2.
- Specific component peptide hormones where C- terminal amidation is not necessarily exemplary (stated otherwise, where elongation at the C-te ⁇ ninal end of the module is easily tolerated) include exendin-4, exendin-4(l-28), GIP, GLP-l(7-37), frog GLP-l(7-36), and frog GLP-2. However, if these component peptide hormones are located at the C-terminal end of the hybrid polypeptide, they may still be optionally amidated, and in fact may preferably be optionally amidated.
- bio-active peptide hormone modules may be covalently linked in any manner known in the art. Stable linkages may be used, or cleavable linkage may be used. In one embodiment, the carboxy of a first module may be directly linked to the amino of a second module. In another embodiment, linking groups may be used to attached modules. Further, if desired, spacers or turn inducers known in the art may be employed to stabilize the linkage.
- the module may be attached to a second module directly, or using any appropriate linking group known in the art, such as, an alkyl; PEG; amino acid, e.g., Lys, GIu, beta-Ala; polyaminoacids, e.g., poly-his, poly-arg, poly-lys, poly-ala, Gly-Lys-Arg (GKR) etc.; bifunctional linker (see, e.g., Pierce catalog, Rockford, D); aminocaproyl ("Aca”), beta-alanyl, 8-amino-3,6- dioxaoctanoyl, or other cleavable and non-cleavable linker known in the art.
- any appropriate linking group known in the art such as, an alkyl; PEG; amino acid, e.g., Lys, GIu, beta-Ala; polyaminoacids, e.g., poly-his, poly-arg, poly-lys, poly-ala
- GIy linker is GIy- Gly-Gly.
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-Linker- KCNTATCVLGRLSQELHRLQTYPRTNTGSETF SEQ ID NO: 92
- its GIy linker species analog is also specifically intended and disclosed: this species is YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-Gly-Gly-Gly-Gly-Gly-
- KCNTATCVLGRLSQELHRLQTYPRTNTGSETF (SEQ E) NO: 92).
- a linker or spacer is 1 to 30 residues long, in another embodiment 2 to 30 residues, and in yet another 3-30 residues long, and any integer length from 2 to 30 inclusive; each integer unit is contemplated, e.g. 2, 3, 4, 5, 6, 7, etc.
- a GIy linker is used, and in a particular embodiment a three residue linker Gly-Gly-Gly.
- the linker is an K(N-epsilon) linker, as used for example in 0601GP4619:
- the GIP is attached to the second bio-active hormone module in a C-terminus to C-terminus orientation.
- the C-terminus of a GIP is linked to the C-terminus of a second bio-active hormone module, optionally with a linker.
- Orthogonal chemistries can be used to ligate functionalized peptide modules, optionally with linkers as described herein. For example, native chemical ligation chemistries can be used. As shown below, where R is a good leaving group, a hybrid can be generated with a Cys-Lys linkage:
- hybrid can be prepared using functionalized modules:
- linkers are shown in Figure 24.
- the linkers are particularly useful for N-terminal to N- terminal linking, however either or both ends of these linkers can be readily adapted to react to the C- terminus of a GIP compound.
- the C-terrninus of a GIP compound is the preferred terminal for linking a GIP analog or derivative to another peptide component of a GIP-containing hybrid, because as shown herein, linking a peptide module to the N-terminus of GIP resulted in lack of receptor activation, unless the module was cleaved off in vivo.
- Such N-terminal extensions are known that act to extend plasma half life of the GIP compound and prevent or reduce receptor activation until removed by a serum or membrane protease.
- GIP-exendin family hybrids that are linked C-terminus to C-terrninus, keeping their respective receptor activation N-termini unhindered.
- the receptor activation regions of both molecules are present in such hybrids, for example using any of the GIP and the exendin and GLPl family peptides and analogs, active fragments and derivatives herein.
- a dAla(2)-GIP(l-30) analog can be linked to exendin-4, in a tail to tail manner, via suitable linking chemistry.
- the peptides of the invention may be C- terminally amidated, or may exist as a free acid.
- the peptides of the invention are C-terminally amidated.
- the module may again be attached to a second module using any appropriate linking group known in the art.
- exemplary linking groups include dicarboxylic acids, alkyls, PEGs, and amino acids such as Lys, Cys, and GIu.
- the hybrid polypeptides may also preferably include spacer to further stabilize the linkage of the bio-active peptide hormone modules. Any spacer or turn inducer known in the art may be used.
- referred beta-turn mimetics include mimic A and mimic B illustrated herein, also Ala-Aib and Ala-Pro dipeptides.
- Their IUPAC names are Mimic A: N-(3S,6S,9S)-2-oxo-3-amino-l- azabicyclo[4.3.0]-nonane-9-carboxylic acid.
- Mimic B J ⁇ T-(3S,6S,9R)-2-oxo-3-amino-7-thia-l- azabicyclo[4.3.0]-nonane-9-carboxylic acid.
- agonist is meant a compound which elicits a biological activity of native human hormone.
- the terms refer to a compound which elicits a biological effect in glucose lowering or other activity of native human GIP.
- Novel GIP analogs for example have activity in a glucose lowering assay, gastric secretion inhibition assay, dP/dt assay, blood pressure assay, insulin secretion assay, bone density assay, or plasma stability assay, preferably similar to or better than native human GIP and/or which binds specifically in a GIP receptor assay or in a competitive binding assay with labeled GIP.
- the agonists will bind in such assays with an affinity of greater than 1 ⁇ M, and more preferably with an affinity of greater than 1-5 nM.
- the agonist (or antagonist as the case may be) IC50 will be less than or about 100 micromolar, less than or about 50 micromolar, less than about 20 micromolar, and less than or about 10 micromolar.
- Such agonists may comprise a polypeptide having a GIP sequence with a Trp-cage motif (e.g. exendin tail PSSGAPS (SEQ ID NO: 93) or variant) or frog GLP-I tail or analog or derivative of the tail.
- amino acid and “amino acid residue” is meant natural amino acids, unnatural amino acids, and modified amino acid. Unless stated to the contrary, any reference to an amino acid, generally or specifically by name, includes reference to both the D and the L stereoisomers if their structure allow such stereoisomeric forms.
- Natural amino acids include alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (GIn), glutamic acid (GIu), glycine (GIy), histidine (His), isoleucine (He), leucine (Leu), Lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr) and valine (VaI).
- Unnatural amino acids include, but are not limited to homolysine, homoarginine, azetidinecarboxylic acid, 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, aminopropionic acid, 2-aminobutyric acid, 4-amino K utyric acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2-aminoisobutyric acid, 3-aminoisbutyric acid, 2-a ⁇ iopimelic acid, tertiaiy-butylglycine, 2,4- diatninoisobutyric acid, desmosine, 2,2'-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N- ethylasparagine, homoproline, hydroxylysine, allo-hydroxylysine, 3-hydroxyproline, 4-hydroxyproline, isodesmosine, allo-isoleucine,
- Additional unnatural amino acids include modified amino acid residues which are chemically blocked, reversibly or irreversibly, or chemically modified on their N-terminal amino group or their side chain groups, as for example, N-methylated D and L amino acids or residues wherein the side chain functional groups are chemically modified to another functional group.
- modified amino acids include methionine sulfoxide; methionine sulfone; aspartic acid- (beta-methyl ester), a modified amino acid of aspartic acid; N-ethylglycine, a modified amino acid of glycine; or alanine carboxamide, a modified amino acid of alanine. Additional residues that can be incorporated are described in Sandberg et al., J. Med. Chem. 41 : 2481-91, 1998.
- Ahx 6-amino hexanoic acid.
- 5 Apa means 5 amino-pentanoyl
- 12 Ado means 12-amino dodecanoyl
- PEG(8) mean 3,6,-dioxyoctanoyl
- PEG(13) means 1-amino- 4,7,10-trioxa-13-tridecanamine succinimoyl.
- ACN or "CH3CN” refers to acetonitrile.
- Boc "tBoc” or “Tboc” refers to t-butoxy carbonyl.
- DCU refers to N,N'- dicyclohexylcarbodiimide.
- Fmoc refers to fluorenylmethoxycarbonyl.
- HBTU refers to 2-(1H- benzotriazol-l-yl)-l,l,3,3,-tetramethyluronium hexaflurophosphate.
- HOBt refers to 1- hydroxybenzotriazole monohydrate.
- HomoP or “HPro” refers to homoproline.
- MeAIa or “Nme” refers to N-methylalanine.
- Naph refers to naphthylalanine.
- pG or “pGly” refers to pentylglycine.
- tBuG refers to tertiary-butylglycine.
- ThioP or “tPro” refers to thioproline.
- 3Hyp refers to 3-hydroxyproline.
- 4Hyp refers to 4-hydroxyproline.
- NAG refers to N-alkylglycine.
- NAPG N-alkylpentylglycine.
- Neval refers to norvaline.
- Neleu refers to norleucine.
- OctGly refers to octyl-glycine in which the glycine amino acid side group H is replaced with an eight carbon saturated aliphatic chain.
- bio-active peptide hormone modules to form the GIP hybrid polypeptides of the invention include combinations of two or more bio-active peptide hormone modules selected from: native peptide hormones, analogs and derivatives of peptide hormones that exhibit at least one hormonal activity, fragments of native peptide hormones that exhibit at least one hormonal activity, fragments of analogs and derivatives of peptides hormones that exhibit at least one hormonal activity, and peptidic enhancers, with the proviso that at least one module exhibit at least one hormonal activity.
- the hybrid polypeptides of the invention will include at least two bio-active peptide hormone modules, wherein at least one module is comprised from a GIP peptide hormone, analog, derivative, fragment or peptidic enhancer.
- at least two of the component peptide hormones are from different peptide hormone families, e.g., the amylin family, CCK, the leptin family, PPF, the proglucagon family, the natriuretic peptide family, and the exendin family.
- a GIP hybrid can comprise a GP portion, with or without a tail sequence, combined with a bio-active module that comprises two or more hormone modules (a non-GIP hormone hybrid) such as an exendin-amylin/sCT hybrid or a hormone chimera such as an amylin-sCT chimera.
- a non-GIP hormone hybrid such as an exendin-amylin/sCT hybrid or a hormone chimera such as an amylin-sCT chimera.
- the hybrid polypeptides of the invention may comprise two or more modules that exhibit at least one hormonal activity.
- the hybrid polypeptide may comprise a fragment of a first peptide hormone or analog that exhibits at least one hormonal activity covalently, linked to a fragment of at least one additional peptide hormone analog.
- the additional fragment(s) may optionally exhibit at least one hormonal activity.
- the first peptide hormone may be the same or different from the additional peptide hormone(s), with the proviso that at least one of the additional peptide hormones are different from the first peptide hormone, and the first hormonal activity may be the same or different from the optional additional hormonal activity.
- the hybrid polypeptides of the invention may comprise one or more modules that exhibit at least one hormonal activity in combination with one or more peptidic enhancer modules.
- a fragment of a first peptide hormone that exhibits a at least one hormonal activity may be covalently linked to a peptidic enhancer, or a fragment of a first peptide hormone that exhibits at least one hormonal activity may be covalently linked to a second peptide hormone that exhibits at least one hormonal activity, which is hi turn linked to a peptidic enhancer.
- a peptidic enhancer may be located between two peptide hormone modules as a stabilizing spacer.
- the first peptide hormone may be the same or different from the second peptide hormone
- the first hormonal activity may be the same or different from the second hormonal activity.
- the hybrid polypeptides of the invention may comprise two, three, four, or more bio-active peptide hormone modules.
- Exemplary combinations include a module with a hormonal activity in combination with one, two, or three peptidic enhancers; two modules with a hormonal activity in combination with one or two peptidic enhancers; three modules with a hormonal activity in combination with one peptidic enhancer, etc.
- the component peptide hormones are preferably selected from amylin, adrenomedullin, calcitonin, calcitonin gene related peptide, intermedin, cholecystokinin, leptin peptide YY, glucagon-like peptide-1, glucagon-like peptide 2, oxyntomodulin, ANP, BNP, CNP, urodilatin, GIP, GLPl or exendin-4.
- exemplary module combinations include those involving combinations of at least GIP and amylin (and/or sCT), BNP, CGRP, CT, CCK, leptin, PYY, GLPl, and exendin-4.
- a first module comprising a GIP peptide is linked to a second bio-active peptide hormone module comprising an amylin peptide that exhibits at least one hormonal activity.
- the second module is further linked to a third bio-active peptide hormone module comprising a calcitonin peptide that exhibits at least one hormonal activity.
- the third module may be further linked to a fourth bio-active peptide hormone module comprising a peptidic enhancer selected from amylin peptides.
- the first module may be located at the C- terminal end of the hybrid polypeptide.
- the first module may be located at the N-terminal end of the hybrid polypeptide.
- spacers or linkers such as betaAla or GIy may be inserted if desired to link the modules.
- exendin-4 peptides include: exendin-4, exendin-4(l-27), exendin-4(l-28), 14 Leu, 25 Phe- exendin-4(l-28), and s Ala, 14 Leu, 25 Phe-exendin-4(l-28). Also useful are exendin(7-15) and its Ser2 analog, HSEGTFTSD (SEQ ID NO. 94).
- amylin peptides that exhibit at least one hormonal activity include amylin, amylin fragments such as amylin(l-17), amylin (1-16), amylin(l-15), and amylin(l-7), and amylin analogs such as pramlintide, 2 Ala-h-amylin, 2>7 Ala-h-amylin, and fragments thereof.
- Exemplary calcitonin peptides that exhibit at least one hormonal activity sCT, sCT fragments such as sCT(8-10), sCT(8- 27), and, and calcitonin analogs such as lu8 Arg-sCT, 18 Arg-sCT, I4 Glu, 18 Arg-sCT, 14 GIu, 11>I8 Arg- sCT, and fragments thereof.
- Exemplary amylin peptidic enhancers include amylin(32-37), amylin(33-37), and amylin(34-37), and analogs thereof.
- Amylin/sCT combinations useful in connection with the present invention include those disclosed in PCT/US2005/004631 Amylin Family Agonist, Attorney Docket 18528.835, which is herein incorporated by reference.
- An amylin/sCT chimera particularly useful for creating hybrids of the invention with GIP is an aniylin-sCT-amylin chimera, for example hAmylin(l-7)- 1U8 Arg-sCT(8-27)-Amylin(33-37), which has the sequence
- KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY (SEQ ID NO: 95), and is preferably in its C-terminal amide form and analogs and derivatives thereof (described herein and in PCT/US2005/004631).
- module combinations include those involving a first module comprising GIP, a fragment of GIP that exhibits at least one hormonal activity, a GIP analog or derivative that exhibits at least one hormonal activity, or a fragment of an GIP analog that exhibits at least one hormonal activity in combination with a second module comprising CCK, a fragment of CCK that exhibits at least one hormonal activity, a CCK analog or derivative that exhibits at least one hormonal activity, or a fragment of a CCK analog that exhibits at least one hormonal activity.
- Exemplary CCK compounds include: CCK-8, and CCK- 8(Phe(CH 2 SO 3 )).
- the first module is located at the C-terminal end of the hybrid polypeptide and the second module is located at the N-terminal end of the hybrid polypeptide.
- the first module may be located at the N-terminal end of the hybrid polypeptide and second located at the C- terminal end of the hybrid polypeptide.
- spacers or linkers such as beta-Ala or GIy may be inserted if desired to attach the modules.
- exemplary module combinations include those involving a first module comprising GIP, a fragment of GIP that exhibits at least one hormonal activity, a GIP analog or derivative that exhibits at least one hormonal activity, or a fragment of an GIP analog that exhibits at least one hormonal activity in combination a second module comprising amylin, a fragment of amylin that exhibits at least one hormonal activity, an amylin analog or derivative that exhibits at least one hormonal activity, or a fragment of an amylin analog that exhibits at least one hormonal activity.
- the amylin module can be an Amylin/sCT chimera as disclosed herein.
- the first module is located at the C-terminal end of the hybrid polypeptide and the peptidic enhancer is located at the N-terminal end of the hybrid polypeptide.
- the first module may be located at the N-terminal end of the hybrid polypeptide and second located at the C-terminal end of the hybrid polypeptide.
- spacers or linkers such as betaAla or GIy may be inserted if desired to attach the modules.
- modules combinations include those involving combinations of GIP, amylin and calcitonin as tertiary and tetra-hybrid molecules.
- Exemplary combinations include Gff/amylin/calcitonin; GlP/amylin/calcitonin/amylin; amylin/calcitonin/GIP; and amylin/calcitonin/amylin/GIP combinations, with and without spacers or linking groups.
- Each module may independently be a peptidic enhancer or may exhibit a hormonal activity, depending on the desired properties of the hybrid polypeptide.
- one of the bio-active peptide hormone module(s) that exhibits at least one hormonal activity is GLP-I or an analog or fragment thereof, and a second bio-active peptide hormone module comprises GIP.
- the hybrid polypeptide comprises a third bio-active peptide hormone module.
- Exemplary third bio-active peptide hormone modules include amylin (including analogs, derivatives and fragments thereof) and amylin-sCT chimeras, PYY (including analogs, derivatives and fragments thereof) and CCK (including analogs, derivatives and fragments thereof).
- Exemplary compounds of GIP-Neuromedin peptide hybrids include
- YaGlP(l-30)-beta-Ala-beta-Ala-FN-38 YAEGTFISDYSIAMDKIHQQDFVNWLLAQK-beta-Ala-beta-Ala- FLFHYSKTQKLGKSNWEELQSPFASQSRGYFLFRPRN-NH2 (SEQ ID NO: 96);
- beta-Ala-beta-Ala spacer is optional, and can be replaced with Gly-Gly-Gly, a mini-PEG group, or other linker known in the art, particularly those described herein.
- Exemplary compounds of GIP and a natriuretic peptide include GIP-hBNP peptide hybrids, including
- the beta-Ala-beta-Ala spacer is optional, and can be replaced with Gly-Gly-Gly, a mini-PEG group, or other linker known in the art, particularly those described herein.
- Embodiments include:
- GIP hybrids include GIP and neuromedin hybrids, for example dAla2-GIP(l-30)- beta-Ala-beta-Ala-FN-38: YaEGTFISDYSIAMDKIHQQDFVNWLLAQK-beta-Ala-beta-Ala-. FLFHYSKTQKLGKSNWEELQSPFASQSRGYFLFRPRN-MH2 (SEQ ID No. 459); dAla2-GIP(l-30)-beta-Ala-beta-Ala-Neuromedin(U25):
- the beta-Ala-beta-Ala spacer is optional, and can be replaced with Gly-Gly-Gly, a mini-PEG group, or other linker known in the art, particularly those described herein.
- Exemplary GIP and natriuretic peptide hybrids include GIP-hBNP peptide hybrids, including dAla2-GIP(l -30)-beta-Ala-beta-Ala-hBNP:
- positions 1 including the N-terminus
- 2 or 3 can be modified to impart DPP-IV resistance.
- positions 1 including the N-terminus
- 2 or 3 can be modified to impart DPP-IV resistance.
- specifically exemplified herein are each of the D-Ala2 analogs of each embodiment herein as well as of the above species.
- GIP is C-terminally extended by a peptidic enhancer, e.g., a tail or C- terminal portion of another hormone, such as exendin or GLP-I, which provide analogs that have enhanced in vivo efficacy.
- Exendin-4 ( Figure 1) is a potent incretin mimetic that shares a 53% homology with GLP-I, and mirrors many of the key biological actions of GLP-I . Unlike GLP-I, exendin-4 is much more resistant to proteolytic cleavage to DPP-IV peptidase and NEP. This confers greater enhanced pharmacokinetics and improved in vivo efficacy in humans compared to GLP-I .
- Circular dichroism (CD) and NMR studies of Exendin-4 in aqueous media and in media containing organic cosolvents reveal that the C-terminal segment containing the sequence LFIEWLKNGGPSSGAPPPS (SEQ ID NO: 183) (residues 21-39) forms a unique hydrophobic Trp-cage cluster resulting from interactions of Pro37 with Phe22 and Pro38 with Trp25 (29-31).
- This Trp-cage cluster motif is the first example of a protein-like tertiary structure displayed by a peptide, and could be responsible for imparting greater metabolic stability by masking protease-sensitive sites in the molecule in vivo (32).
- exemplary module combinations include those involving a first module comprising GIP, a fragment of GP that exhibits at least one hormonal activity, a GIP analog or derivative that exhibits at least one hormonal activity, or a fragment of ah GIP analog that exhibits at least one hormonal activity in combination with a peptidic enhancer.
- Useful peptidic enhancers are the exendin-4 and frog GLP tails, as described herein, as well as PYY(25-36), PYY(30-36) and PYY(31-36).
- the first module is located at the C-terminal end of the hybrid polypeptide and the peptidic enhancer is located at the N-terminal end of the hybrid polypeptide.
- the first module may be located at the N-terminal end of the hybrid polypeptide and the peptidic enhancer may be located at the C-terminal end of the hybrid polypeptide.
- spacers or linkers such as betaAla or GIy may be inserted if desired to attach the modules.
- a particular compound of interest is YaEGTFISDYSIAMDKJHQQDFVNWLLAQKPSSGAPPPS- NH2 (Compound 0601GIP3794; which has a D-AIa at position 2, and is in amide form).
- Exemplary compounds having a modification at position 2 (i.e. residue 2) or positions 2 and 3 (e.g. Ser at 2 with Asp at 3), and their GIP Receptor binding and receptor activation activities include Y-Residue2- EGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS-NH2 where Residues 2 and/or 3 are shown in the table (and see Figure 12):
- 0601GIP4584 (SEQ ID No. 634) OIP(1-30> E ⁇ endin 4-(31-39) ⁇ -NH Z
- GIP compounds incorporate one or more modifications or derivatizations.
- 0601 GIP4294 contains both an octylglycyl N-terminus modification and a beta-Ala linker.
- Further exemplary compounds include:
- the GIP hybrids or GlP portions thereof have one or more of the following modifications (for reference only to formula N-te ⁇ n ⁇ us-YaEGTFISDYSIAMDKIHQQDFVNWLLAQK- Linker-PSSGAPPPS-NH2) (SEQ ID No. 652): dAla2 to Abu, Ala, GIy, or Ser; Metl4 to Leu; Hisl8 to Ala, Arg, or Lys; As ⁇ 21 to GIu; Lys30 to Arg or His; an N-terminus as Gly(Oct); and/or a bAla-bAla or Gly-Gly- GIy linker. In a further embodiment one or more of such changes are made to compound 0601 GIP3794.
- the GIP analogs or GIP portions of hybrids do not have a substitution, modification and/or substitution at any one or more of the following positions: Tyrl, TyIO, Val23, Leu27 and/or Phe22.
- substitution by alanine at one or more of these positions in 0601GIP3794 result in an analog having less than 25% inhibition of receptor binding (at 10 nM peptide concentration).
- the GIP analogs and hybrids do not contain an alanine substitution at one or more of Tyrl, TyIO, Val23, Leu27 and/or Phe22.
- a GIP analog or hybrid can have an alanine substitution at one or more of the positions as compared to 0601GIP3794 and retain receptor binding as indicated in the following table. The data also indicate that these positions of GIP are tolerant to substitution and modification, as described herein.
- Exemplary analogs also include amino acid modifications that eliminate or reduce oxidation. Such replacements include a deletion or replacement of methionine 14 with leucine and/or the tryptophan 25 with phenylalanine. Accordingly, specific exemplary analogs include a variant of each analog described herein by having one or more such replacements. As an example are compounds AAAA and BBBB which are the D- Ala2 and L-Ala2 analogs of 0601GIP3794 having a Phe for Trp replacement at position 25.
- GIP analogs having a potency loss of less than 25%, less than 15%, less than 10% or less than about 5%, at pH 4 to 9, at pH 5 to 7, or further at pH 6 to 7, under accelerated stability of 40 degrees C for at least 1, at least 3 or at least 7 days.
- the GIP analog has a solubility greater than about at least 1 mg/ml, at least 2 mg/ml, at least 3 mg/ml, at least 4mg/ml or greater than at least 5 mg/ml, at at least one or more of about pH 4, 5, 6, 7, 8, or 9, and further at at least three or more of these pHs, and even further at all of these pHs.
- the GIP compound has a solubility of at least about 2.0 mg/ml in 30 mM histidine buffer at pH 6 and/or at least about 5.0 mg/ml in 30 mM histidine buffer at pH 6. In yet a further embodiment, the GIP compound retains at least about 80% activity, at least about 90% activity or at least about 95% activity in 30 mM histidine buffer at pH 6 for at least 7 days at 40 degrees C.
- Leul4, Alal8 and Glu21 substitutions compared to 0601GIP3794 that increase solubility of GIP analogs, improve their duration of action and/or increase glucose lowering, as compared to 0601GIP4285, and that can be used alone or combined with other modifications and derivatizations, and the exemplary GIP compounds containing them, are depicted in the following table along with their receptor binding and activation data.
- the N for P substitution in the tail region of 0601G1P4974 as compared to 0601GIP4285, and more specifically the modified tail region are such modifications that can be incorporated into other GIP compounds.
- Ocg stands for octylglycine
- frog GLP-I tail region is substituted or modified at or near the "KK" sequence to prevent or reduce proteolytic cleavage. While such modified tail region is depicted in the context of specific GIP analogs in the table below, it is intended that such a modified tail sequence that increases plasma stability of the attached GIP portion, is to be used with any GIP analog or derivative, including those disclosed herein, to provide enhanced plasma stability and longer half-life.
- the modified tail can be combined with one or more other GIP modifications or derivatizations as discussed herein.
- modified-frog-tail-containing GIP compounds are particularly useful components of GIP hybrids.
- the frog GLPl tail and analogs and derivatives thereof that enhance stability are of particular interest as an alternative to the exendin tail as used with GIP, exendin, GLPl or other peptide hormones, as discussed herein.
- exemplary "tail" modifications (compare to 0601GIP3794 which incorporates the exendin tail PSSGAPPPS (SEQ ID NO. )) that can improve solubility, duration of action and/or glucose lowering activity, and which can be used alone or in combination with other modifications and derivatizations as disclosed herein, and exemplary GIP compounds having them, are depicted in the following table.
- a GIP analog or hybrid will incorporate (at its C-terminus) any one of the tail sequences, such as PSSGAPPNS, in the following table, to achieve greater solubility, improved duration of action or improved glucose lowering as compared to the parent compound.
- a GIP analog or hybrid can incorporate any one or more of the non-tail amino acid substitutions from the table below (as compared to 0601GIP3794) to improve solubility, duration of action or glucose lowering activity.
- 0601GEP4709 (SEQ ID No. 718) 0601GIP4763 (SEQ ID No. 719)
- Yet further embodiments contain modifications and specific GIP sequences described in the following table that may provide increased solubility, glucose lowering or duration of action as compared to human GIP, and in some embodiments, greater than or equal to 0601GIP3794. Modifications can be in the tail region (PSSGAPPPS) or elsewhere in the compound or both, as shown in the following table. The modified GIP sequences and modified tail sequences can be used in other GIP analogs or hybrids. Receptor binding and glucose lowering activity via OGTT are shown.
- GIP analogs with surprisingly high solubility, and in a further embodiment, surprisingly greater solubility than either or both 0601GIP3794 and 0601GIP4850, as measured at about pH 5 to 7, while retaining glucose lowering (e.g. OGTT or glucose lowering assay) greater than human GIP or about equal to or better than either or both 0601GIP3794 and 0601GIP4850, as shown in the following table.
- the analog has greater solubility than either or both 0601GIP3794 and 0601GIP4850 at pH 6.0 buffered with 30 mM histidine or pH 7.0 buffered with 3OmM histidine.
- GIP analogs or hybrids that contain one or more or all of the modifications in each of analogs 0601GIP5075, 0601GIP5076, 0601GIP5080, 0601GIP5081, 0601GIP5082 and 0601GIP4850 as compared to 0601GIP3794 that provide solubility and bioactivity.
- GIP analogs or hybrids that contain one or more or all of the modifications in each of analogs 0601GIP5070, 165071, 0601GBP5072, O601GIP5073 as compared to 0601GIP4288 that provide solubility and bioactivity.
- GIP analogs or hybrids that contain one or more or all of the modifications in analog 0601GIP4904 as compared to 0601GIP4233 that provide solubility and bioactivity.
- the analog has a solubility of greater than or about 5 mg/ml, and further retains glucose lowering greater than or about that of human GlP, 0601GIP3794 and/or 0601GIP4850.
- the GIP analog or hybrid is or comprises 0601GIP4904, 0601GBP5072, 0601GBP5075, 0601GIPS080, 0601GIP5081, O601GIP5082, 0601G1P5070, 0601GIP5071, 0601GIP5073, or 0601GIP5076.
- the GIP analog is or comprises 0601GIP4904, 0601GIP5072, 0601GIP5075, 0601GIP5080, 0601GBP5081, 0601GIP5082, which analogs also demonstrate superior stability in solution, for example as determined by an accelerated stability study at 40 degrees C for at least 3 days or at least 7 days.
- analogs or derivatives, or hybrids thereof, of the GIP compounds in the above table and further in each of the tables and figures herein, having no more than 5, no more than 4, no more than 3, no more than 2 or no more than 1 substitution, modification and/or derivatization as described herein and/or that exhibits at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity to the parent GIP analog of the above table, or other table or figure herein, over the entire length of the parent GIP compound.
- Figures 12.15 to 12.65 depict further exemplary analogs and reference peptides of the invention. It is intended that the various modifications and variants shown are to be used in the present invention, and may be combined as discussed herein.
- exendin tail or exendin trp-cage motif includes any of the exendin tail variants depicted, which are useful as shield sequences (peptidic enhancers).
- shield sequences peptidic enhancers.
- frog GLPl C-terminal extensions as shown in the figures, which are yet another example of a shield sequence that can be used in place of an exendin tail.
- the GlP compounds of the invention comprise a frog GLPl "tail" sequence as a peptidic enhancer as described herein (and see Figure 12).
- a frog GLPl "tail" sequence as a peptidic enhancer as described herein (and see Figure 12).
- the "S" or shield region or C-terminal tail can be any of the tails depicted herein, including for example PSSGQPPQSK, PSSGAPPQSK, PSSGAPPKSK, PSSGAPPPS, PSSGAPPKS, PSSGARPPS, PSSGAKPPS, PSSGAPKPS, PSSGAPDPS or PKGKlRYS.
- the "S" or shield region or C-terminal tail can be any of the tails found in any of theGIP analogs depicted herein including those from GIP compounds 0601GIP3794, 0601GIP4850, 0601GIP5075, 0601GIP5076, 06O1GIP5O80, 0601GJP5081, 0601GIP5082, 0601GIP5070, 0601GIP5071, 0601GIP5072, 0601GIP5073 or 0601GIP4904.
- any of the GIP modules herein is a Serine2, Aspartic acidS (i.e. S2,D3), double substitution at positions 2 and 3 at theN-terminus of a GIP.
- S2,D3 Serine2, Aspartic acidS
- the S2,D3 can be combined with one or two or more other modifications, for example a fatty acyl derivatization to decrease plasma (e.g. renal clearance) and/or increase duration of action, and/or with a C-terminal shield sequence, and/or with a GIP species amino acid substitution.
- these GP analogs can be used directly or as the GIP portion of a GF hybrid.
- Exemplary compounds showing exceptional GIP Receptor binding activity at less than about 10 nm include 0601GIP3794 at 3.8 nM, 0601GIP4283 0.41 nM, 0601GIP4284 1.8 nM, 0601GIP4285 0.58 nM, 0601GIP4288 0.28 nM, 0601GIP4289 0.58 nM, 0601G1P4290 0.35 nM, 0601GIP4147 at 7.4 nM, 0601GIP4178 1.5 nM, 0601GIP4293 0.12 nM, 0601GIP4292 0.17 nM, 0601GIP4238 4.2 nM, 0601GIP4179 3.3 nM, 0601GIP4294 0.92 nM, 0601GIP4252 5.6 nM, 0601GIP3794 3.8 nM, 0601GIP4190 2.4 nM, 0601GIP4152 2.3 nM, 0601GIP4
- DPP-IV resistant hybrids of the invention have increased plasma stability compared to native GIP.
- 0601GIP3796 amide form is essentially 100% present after 5 hours in human plasma, in contrast to about 60% for GlP(I -42) acid form.
- Embodiments of the invention further include the following.
- the following also provides in shorthand notation a description of each species and sub-genus derivable therefrom.
- the novel GIP analog or a GIP hybrid comprises a polypeptide comprising the formula D-L-C-S, wherein
- D comprises a dipeptidyl peptidase IV resistant GIP N-terminal region
- L comprises a linker
- the polypeptide comprises a shield region; and wherein L is optionally present and at least one of D or C are present, and wherein when C is present then C- S comprises a Trp-cage motif, or when C is absent then L-S further comprises a Trp-cage motif, and the polypeptide has GIP receptor binding and/or activating activity.
- the at least one of D or C has GIP receptor activation and/or binding activity.
- both D and C are present.
- Either or both D and C can have GIP receptor activation and/or binding activity.
- the polypeptide can specifically bind a GIP receptor.
- this binding will be at least twofold greater than binding to another receptor such as an incretin receptor, e.g., GLPlR.
- the binding can be at least 5-, 10-, 50-, or even 100-fold greater than binding to another receptor such as an incretin receptor, e.g., GLPlR.
- the novel GIP analog comprises GDP agonist activity.
- the polypeptide can specifically activate a GIP receptor.
- this activation will be at least two-fold greater than activation of another receptor such as an incretin receptor, e.g., GLPlR.
- the activation can be at least 3- , 4-, 5-, 10-, 50-, or even 100-fold greater than activation of another receptor such as an incretin receptor, e.g., GLPlR.
- the polypeptide comprises at least one desired activity of a native GIP.
- a desired activity of a novel GIP hybrid is greater than that of the native form, the activity can be at least twofold greater.
- the desired activity is at least 3-, 4-, 5-, 10-, 50-, or even 100-fold greater than the activity compared to a native GD?.
- the activity may be receptor binding, receptor activation, receptor antagonism, glucose lowering, inhibition or reduction of gastric secretion, or any other activity, in vitro, ex vivo or in vivo, that may be known in the art or that is provided herein.
- the D region of a novel GD? analog or hybrid comprises an 11 N-terminal amino acid sequence of a native GIP or a 14 N-terminal amino acid sequence of native GIP.
- the D region comprises the N-terminal portion of a modified or substituted GD?, e.g. see WO 00/58360, EPl 171465 or published United States Patent Application 20030232761.
- region C comprises C-terminal amino acids 19-26 of native GIP, C-terminal amino acids 19-30 of native GIP, C-terminal amino acids 19-39 of native GD? or C-terminal amino acids 19- 42 of a native GD?.
- region C can comprise amino acids 19-26, 19-30, 19-39 or 19- 42 of human, mouse, porcine or rat GD?.
- the C region comprises the C-terminal portion of a modified or substituted GD?, e.g. see published United States Patent Application 20030232761.
- L comprises a sequence from native GD?, including DKIH or DKIH.
- the D-L-C portion of a novel GD? analog comprises amino acids 1-26, 1-30, 1-39, or 1-42 of a native GD?.
- regions D-L-C comprise amino acids 1-26, 1-30, 1-39 or 1-42 of human, mouse, porcine or rat GD? (see for example Li et al., Regulatory Peptides 121(1-3) pages 107-112 (2004)).
- the D-L-C portion of a novel GD? analog comprises amino acids 1- 26, 1-30, 1-39, or 1-42 of an N-terminally modified or substituted GD? (in any of positions 1-4) that comprises DPP-IV resistance, e.g. see WO 00/58360, EPl 171465 or published United States Patent Application 20030232761.
- Novel GD? compounds of the formula D-L-C-S can comprise the sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ IDNO: 186), (Tyrl-glucitol)AEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 187), (Tyrl-pyroglutamyl)AEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 188), (Tyrl-glucitoOAEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 187), (Tyrl-9-fluorenylmethoxycarbonyl)AEGTFISDYSL ⁇ MDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 189), (Tyrl-palmitate)AEGTFISDYSlAMDKIHQQDFVNWLL
- YSEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 191)
- YGEGTFISDYSIAMDKJHQQDFVNWLLAQKPSSGAPPPS (SEQ IDNO: 192).
- novel GIP compounds comprise the sequence
- Novel GIP compounds can also comprise the sequence
- novel GTP compounds comprise the sequence
- D comprises the sequence X1-X2-X3-X4-X5-X6- X7-X8-X9-X10-X11-X12-X13-X14 (SEQ ID No. 465), wherein at least one of Xl, X2, and X3 is an amino acid substitution or modification providing DPP-TV resistance.
- DPP-TV resistance is provided by a modification comprising a peptide mimetic bond between X2 and X3.
- Such a bond can be provided as a reduced peptide bond of the formula ⁇ (CH2NH), for example as when X1-X2-X3 is Tyrl-Ala ⁇ (CH2NH)-Glu.
- any bond of the novel GD? analog is a reduced peptide bond of the formula ⁇ (CH2NH), particularly one that is identified as susceptible to protease or peptidase degradation.
- the substitution or modification comprises a D-amino acid substitution in Xl, X2 and/or X3 and/or glycation, alkylation, acetylation or acylation of the N-terminus.
- Positions Xl- X14 can be independently selected. In other embodiments any or more of X12-X14 are optionally absent.
- X2 and X3 are independently Lys, Ser, 4-amino butyric amino acid, Aib, D-AIa, Sarcosine or Pro.
- the N-terminal modification can be selected from the group of glycation, alkylation, acetylation, alkyloxycarbonylation or arylalkoxycarbonylation.
- Xl is Tyr, desamino-Tyr, D-Tyr, Ala, a D-amino acid, Tyr-glucitol, an N- methylated amino acid, and/or comprises an N-terminal glycation, alkylation, acetylation, alkyloxycarbonylation, arylalkoxycarbonylation or acylation.
- the N-terminus of the tyrosine residue can be modified by alkylation, alkyloxycarbonylation, arylalkoxycarbonylation, sulphonylation, glycation, homoserine formation, pyroglutamic acid formation, acylation, methylation, t-butylation, t-butyloxycarbonylation, 4-methylbenzylation, benzyloxymethylation, benzyloxycarbonylation, 4-toluenesulphonylation, diphenylmethylation, 2-bromobenzyloxycarbonylation, 9- fluorenylmethyloxycarbonylation, acylation, formylation, acetylation, benzylation, benzoylation, phosphorylation, sulphation, glycolysation with pentoses, deoxyhexoses, glucosamines, or N- acetylglucosamines, farnesylation, biotinylation, palm
- the N-terminus of the Xl residue can be modified by alkylation, alkyloxycarbonylation, arylalkoxycarbonylation, sulphonylation, glycation, homoserine formation, pyroglutamic acid formation, acylation, methylation, t-butylation, t- butyloxycarbonylation, 4-methylbenzylation, beiLzyloxymethylation, benzyloxycarbonylation, 4- toluenesulphonylation, diphenylmethylation, 2-bromobenzyloxycarbonylation, 9- fluorenylmethyloxycarbonylation, acylation, formylation, acetylation, benzylation, benzoylation, phosphorylation, sulphation, glycolysation with pentoses, deoxyhexoses, glucosamines, or N- acetylglucosamines, farnesylation, biotinylation, palrnitoylation,
- X2 is Ala, Ala ⁇ (CH2NH), Ser, D-amino acid, Lys, 4-amino butyric amino acid, Aib, D-AIa, Sarcosine, Pro, GIy, phosphorylated Ser, VaI, Leu, lie, Thr, or an N-methylated amino acid.
- X2 is a conservative amino acid change from a native residue or from an X2 residue provided herein.
- X2 is any naturally occurring amino acid.
- X2 is any non-proteinogenic amino acid.
- X3 is GIu, D-GIu, L-Pro, (N-Me)GIu, Pro, D-amino acid, Lys, Ser, 4- amino butyric amino acid, Aib, D-AIa, Sarcosine, Pro, or an N-methylated amino acid.
- X3 is a conservative amino acid change from a native residue or from an X3 residue provided herein.
- X3 is any naturally occurring amino acid.
- X3 is any non-proteinogenic amino acid.
- X4 is GIy or Ala.
- X4 is a conservative amino acid change from a native residue or from an X4 residue provided herein.
- X5 is Thr or Ser.
- X6 is Phe or Ala. In a further embodiment X6 is a conservative amino acid change from a native residue or from an X6 residue provided herein.
- X7 is lie or Ala. In a further embodiment X7 is a conservative amino acid change from a native residue or from an X7 residue provided herein.
- X8 is Ser or Ala. Ih a further embodiment X8 is a conservative amino acid change from a native residue or from an X8 residue provided herein.
- X9 is Asp or Ala. In a further embodiment X9 is a conservative amino acid change from a native residue or from an X9 residue provided herein.
- XlO is Tyr or Ala.
- XlO is a conservative amino acid change from a native residue or from an XlO residue provided herein.
- XIl is Ser or Ala. In a further embodiment XIl is a conservative amino acid change from a native residue or from an Xl 1 residue provided herein.
- Xl 2 is He, Ala, Ser, or Lys. In a further embodiment Xl 2 is a conservative amino acid change from a native residue or from an Xl 2 residue provided herein. In yet another embodiment X12 is any naturally occurring amino acid. In a still further embodiment X12 is absent.
- X13 is Ala, Tyr, Glutamine, or Asp. In a further embodiment X13 is a conservative amino acid change from a native residue or from an Xl 3 residue provided herein. In yet another embodiment X13 is any naturally occurring amino acid. In a still further embodiment X13 is absent.
- X14 is Met, Ala, or Leu. In a further embodiment X14 is a conservative amino acid change from a native residue or from an X14 residue provided herein. In yet another embodiment X14 is any naturally occurring amino acid. In a still further embodiment X14 is absent.
- a modified D region of a novel GIP analog and a hybrid comprises the sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Tyr-Met (SEQ ID NO: 204).
- D comprises the sequence Ala-Ala-Glu-Gly-Thr-Phe-lIe-Ser-As ⁇ -Tyr-Ser- ⁇ e-Ala-Met (SEQ ID NO: 205); Tyr-Ala-Ala-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-ne-Ala-Met (SEQ ID NO: 206); Tyr-Ala-Glu-Ala-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-He-Ala-Met (SEQ ID NO: 207); Tyr-Ala-Glu-Gly-Ala-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met (SEQ ID NO: 208); Tyr-Ala-Glu-Gly-Thr-Ala-Ile-Ser-Asp-Tyr-Ser-fle-Ala-Met (SEQ E) NO: 20
- D comprises the sequence
- D comprises the sequence Y(D-AIa)EGTFISDYSIAM, YAbuAEGTFISDYSIAM (SEQ E) NO: 225), or YSarAEGTFISDYSIAM (SEQ E) NO: 226).
- a novel GD* analog or hybrid region D may exhibit at least 60%, 65%, 70%, 80%, 85%, 90%, 95%, 98% or 100% sequence identity to a corresponding region of a native GE 1 , for example amino acids 1-11, 1-12, 1-13 or 1-14 of a native GJP, preferably a human GH>, over the entire length of each corresponding sequence.
- a region D of a novel GW analog may also exhibit at least 50%, 60%, 65%, 70%, 80%, 85%, 90%, 95% or even 100% sequence identity to a modified or substituted GJP, e.g. see WO 00/58360, EPl 171465 or published United States Patent Application 20030232761.
- Percent identity can be determined manually or by analysis with the AlignX module in Vector NTI (Invitrogen; Carlsbad CA) or the ClustalW algorithm for global alignment.
- Native region D GE* sequences include those derived from human, mouse, rat, porcine or bovine GE*.
- Native GE* sequences include human GlP(I -42) (YAEGTFISDYSIAMDKmQQDFVNWLLAQKGKKNDWKHNITQ; SEQ E ) NO: 2), mouse GP(I -42) (YAEGTFISDYSIAMDKmQQDFvT ⁇ WLLAQRGKKSDWKHNITQ; SEQ E ) NO: 10), rat GlP(I -42) (YAEGTFISDYSIAMDKmQQDFVNWLLAQKGKKNDWKHNLTQ; SEQ E ) NO: 11), pig GP(I -42) CYAEGTFISDYSIAMDKmQQDFVNWLLAQKGKKSDWKHNITQ; SEQ E ) NO: 12), or bovine GE > (l-42) (YAEGTFISDYSIAMDKJRQQDFVNWLLAQKGKKSDWE ⁇ N ⁇ Q; SEQ E) NO: 13).
- region D comprises amino acids 1-11, 1-12, 1-13 or 1-14 of human, mouse, rat, pig or bovine GIP, e.g. wherein region D comprises YAEGTFISDYS (SEQ ID NO: 227), YAEGTFISDYSI (SEQ ID NO: 228), YAEGTFISDYSIA (SEQ ID NO: 229) or YAEGTFISDYSIAM (SEQ ID NO: 14).
- a region D amino acid sequence further comprises a modified or substituted amino acid in addition to any one of positions Xl, X2 or X3.
- Xl 5 is D, E, or a conservative amino acid change thereof or of a native Xl 5 residue.
- Xl 6 is K, G, E, or a conservative amino acid change thereof or of a native X16 residue.
- X17 is I, Q, E, or a conservative amino acid change thereof or of a native X17 residue.
- X18 is H, R, A or a conservative amino acid change thereof or of a native Xl 8 residue.
- L can comprise the sequence D-K-I-H or D-K-I-R.
- L comprises a modified or substituted amino acid. In one such embodiment L comprises in a first position (e.g.
- X 16) a (hetero)aryl (both optionally substituted) or 3-7C cycloalkyl, 1-1 OC (hetero)alkylene, 2-1 OC (hetero)alkenylene, 2-lOC (hetero)alkynylene or phenyl, and in a second C- terminally adjacent position (e.g. X17) a 1-lOC (hetero)alkylene, 2-10C (hetero)alkenylene, 2-10C (hetero)alkynylene, or phenyl linked via a -CO- to the next residue in the amino acid backbone.
- a region L amino acid sequence further comprises a modified or substituted amino acid.
- region C comprises the sequence X19-X20-X21-X22-X23-X24- X25-X26-X27-X28-X29-X30 (SEQ ID NO. 467), each position being independently selected, wherein X19 is Q or a conservative amino acid substitution thereof,
- X20 is Q or a conservative amino acid substitution thereof
- X21 is D or a conservative amino acid substitution thereof
- X22 is F, Y or a conservative amino acid substitution thereof
- X23 is V, I, A, or a conservative amino acid substitution thereof
- X24 is N, Q or a conservative amino acid substitution thereof
- X25 is W, F, Y, napthylalanine or a conservative amino acid substitution thereof,
- X26 is L, A or a conservative amino acid substitution thereof
- X27 is L, K, R, V, A, I or a conservative amino acid substitution thereof, or is absent
- X28 is A, N, D, K, R, E or a conservative amino acid substitution thereof, or is absent
- X29 is Q, G or a conservative amino acid substitution thereof or is absent, and
- X30 is K, G, R, G, P, R or a conservative amino acid substitution thereof or is absent.
- any one, two, or three of X26 to X30 is absent in region C.
- a novel GIP analog region C comprises 8 to 24 C-terminal amino acids of a GIP (beginning at a position in the GIP corresponding to position Xl 9 (GIn) in human GIP), at least the first such 8 amino acids (e.g., comprising positions X19-X26, such as X19-27, X19-X28, X19-29), at least the first 12 such amino acids (e.g., comprising positions X19 to X30, such as X19-X31, X19-X32, X19-X33, X19-X34, X19-X35, X19-X36, X19-X37, X19-X38), at least the first 21 such amino acids (e.g.
- X27-X30 may be independently present or absent.
- region C can further comprise residues 31 to 39 of a GIP or a native GIP, and X27 to X30 may be optionally absent.
- a novel GIP analog or hybrid region C may exhibit at least 60%, 65%, 70%, 80%, 85%, 90%, 95%, 98% or 100% sequence identity to a corresponding region of a native GIP, for example amino acids 19-30, 19-26, 19-26 or 19-42 of a native GIP over the entire length of each corresponding sequence.
- a region C of a novel GIP analog may also exhibit at least 50%, 60%, 65%, 70%, 80%, 85%, 90%, 95%, 98% or even 100% sequence identity to a modified or substituted GIP, e.g. see WO 00/58360, EPl 171465 or published United States Patent Application 20030232761.
- Native region C GIP sequences include those derived from human, mouse, rat, porcine or bovine GIP.
- Native GIP sequences include human GEP(l-42) (YAEGTFISDYSlAMDK-HQQDFVNWLLAQKG-OaSrDWKHNITQ; SEQ ID NO: 2), mouse GIP(l-42) (YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ; SEQ ID NO: 10), rat Gff(l-42) (YAEGTFISDYSIAMDKIRQQDFvT ⁇ WLLAQKGKKNDWKHNLTQ; SEQ ID NO: 11), pig GIP(l-42) (YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ; SEQ ID NO: 12), or bovine GIP(I -42) (YAEGI ⁇ SDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNITQ; SEQ ID NO
- region C comprises amino acids 19-30, 19-26, 19-26 or 19-42 of human, mouse, rat, pig or bovine GIP, e.g. region C comprises GmGlnAspPheValAsnT ⁇ LeuLeuAlaGlnLys (SEQ ID NO: 233) or GlnGlnAspPheValAsnTrpLeuLeuAlaGlnArg (SEQ ID NO: 234).
- a region C amino acid sequence further comprises a modified or substituted amino acid.
- novel GIP analog or hybrid region S comprises the sequence X31-X32- X33-X34-X35-X36-X37-X38-X39 (SEQ ID No. 468), each independently selected, wherein
- X31 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine, G, S;
- X32 is Ser, Pro, His, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N- alkylalanine;
- X33 is Ser, Arg, Thr, Tip, Lys
- X34 is Gly, Ser
- X35 is Ala, Arg, Asp, GIu, Lys, GIy;
- X36 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine, A, absent;
- X37 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine,
- X38 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine,
- X39 is Ser, Thr, Tyr, Leu, Ala, Lys, His, Pro, Lys, Arg, GIy, or absent, wherein if an amino acid is absent then all subsequent positions are absent.
- region S comprises ProSerSerGlyAlaProProProSer (SEQ ID NO: 1), ProSerSerGlyAlaProProPro (SEQ ID NO: 235), ProSerSerGlyAlaProPro (SEQ ID NO: 236), ProSerSerGlyAlaPro (SEQ ID NO: 237), ProSerSerGlyAla (SEQ ID NO: 238), ProSerSerGly (SEQ ID NO: 239), or ProSerSer.
- region S comprises a C-terminal amide.
- region S comprises a sequence wherein X37 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine that is capable of interacting with a Trp or Trp-like residue in region C to form a Trp-cage.
- region S comprises a sequence wherein X31 is Pro, homoproline, 3Hyp, 4Hyp, thioproline, N- alkylglycine, N-alkylpentylglycine or N-alkylalanine that is capable of interacting with a Tip or Trp-like residue in region C to form a Tip-cage.
- region S comprises a sequence wherein X31 and X37 are both Pro, homoproline, 3Hyp, 4Hyp, thioproline, N-alkylglycine, N-alkylpentylglycine or N-alkylalanine and that is capable of interacting with a Trp or Trp-like residue in region C to form a Trp- cage.
- region S comprises a sequence of 5 to 14 amino acids, 5 to 10 amino acids, or 6 to 9 amino acids that is capable of forming a Trp cage with the region C.
- the S region contains or alternatively comprises a frog GLPl tail region.
- GIP analog 0601GIP4673 is an example of such a compound, which also has a DPPP-IV resistant N-terminus and modifications that reduce hydrophobicity to increase solubility.
- the GLP-I frog tail containing GIP compounds and hybrids further include at least one, two or three modifications that increase solubility of the parent compound, as discussed and exemplified herein.
- the frog GLP-I tail is PKKIRYS (SEQ ID No. 421) or an analog or derivative thereof.
- GIP analogs and derivatives, and GIP hybrids containing such GIP compounds do not include the frog GLP-I tails specifically exemplified in PCT/US2006/005020 of Levy et al., but would include the novel analogs and derivatives thereof disclosed herein. It is expressly intended that for each GP analog and derivative exemplified herein, a second compound is expressly intended wherein a novel frog GLP-I tail region as disclosed herein is substituted or added to the C-terminal region of the GIP compound as taught herein. According to this aspect, for example, the C-terminal PSSGAPPPS region of 0601GIP4645 would be replaced with PKKIRYS (SEQ ID No. 421) or a novel analog or derivative thereof to generate a new GIP compound useful either alone or as a GIP hybrid component. Such specific molecules are hereby expressly intended and described as if each was individually listed herein.
- GIP compounds having an anolog or derivative of the PKKIRYS tail (SEQ DD No. 421) wherein any one of the positions in the tail is substituted with an alanine, e.g. PAKIRYS (SEQ ID No. 422).
- the PKKIRYS tail (SEQ ID No. 421)analog has serine-proline dipeptide is inserted between the proline and lysine.
- GIP compounds have a PKKBRYS tail (SEQ ID No. 421) analog wherein any one, two or three of positions 3, 4 and 6 are substituted with serine, alanine and proline, respectively.
- the PKKIRYS tail SEQ ID No.
- PKKIRYS tail (SEQ ID No. 421) is an tail analog wherein any one or two of positions 2 and 3 are substituted with either asparagine, glutamine or both, which effectively reduces proteolytic cleavage at the 2- 3 bond.
- PKKIRYS tail (SEQ ID No. 421) is a tail analog wherein any one or two of positions 2 and 3 are substituted or derivatized to effectively reduce proteolytic cleavage at the 2-3 bond.
- substitutions or derivatives include those known to prevent cleavage of a KK bond, and will maintain peptide function as is readily determined as taught herein.
- having the PKKIRYS tail (SEQ ID No. 421) is an tail analog wherein any one or two of positions 2 and 3 are substituted with either asparagine, glutamine or both, which effectively reduces proteolytic cleavage at the 2- 3 bond.
- PKKIRYS tail (SEQ ID No. 421) is a tail analog wherein any one or two of positions 2 and 3 are substitute
- PKKIRYS tail (SEQ ID No. 421) is a tail analog wherein any one or two of positions 4 and 7 are substituted with an octylglycine, which effectively reduces proteolytic cleavage at the 2-3 bond.
- a PKKIRYS tail (SEQ ID No. 421) or analog or derivative thereof is combined with a modification that increases the hydrophilicity of the GIP analog.
- at least any one, two or three of positions N24, W25, L26 or L27 are substituted with a more hydrophilic amino acid, hi one such embodiment the more hydrophilic amino acid is selected from with E, P, N, S, T, K , R or Q.
- the N24 is substituted with E 5 P or Q.
- Li one such embodiment the W25 is substituted with E, P, N or Q.
- either or both L26 or L27 is substituted with E, P 5 Q, N, S, T or K.
- the W25 is substituted with E, P, N, S, T, K or Q.
- novel GIP analog or hybrid is modified.
- novel GIP hybrid can comprise a modification by fatty acid addition at an epsilon amino group of at least one lysine residue.
- a novel GIP analog or hybrid is a GIP-receptor agonist.
- the novel GD? hybrid can potentiate cyclic AMP production.
- a novel GIP hybrid is a GIP -receptor antagonist.
- GIP compounds and hybrids as disclosed herein may bind but not significantly activate the GIP receptor.
- Such GIP receptor antagonists are useful, for example, as in chronic administration to treat obesity-related diabetes, possibly by increasing insulin resistance (see for example, Gault et al. Diabetes (2005) 54(8):2436-3446).
- a novel GIP analog or hybrid comprises a sequence of the formula D-L-C-S where D comprises a D-amino acid alanine at X2 and wherein D, L, C and S are as defined herein and is any of the other embodiments herein.
- region C comprises amino acids 19-30 of a GIP, particularly a human GIP, even more particularly comprises the sequence QQDFVNWLLAQK (SEQ ID NO: 15).
- L is naturally occurring sequence X15-X18 from a native GIP, particularly human GIP.
- S is a sequence comprising PSSGAPPPS (SEQ ID NO: 1), PSSGAPPP (SEQ ID NO: 235), PSSGAPP (SEQ ID NO: 236), PSSGAP (SEQ ID NO: 237), PSSGA (SEQ ID NO: 238), or PSSG (SEQ ID NO: 239).
- a novel GIP hybrid comprise the sequence:
- Y(D-AIa)EGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID No. 469) ; Y(D-AIa)EGTFISDYSIAMDKIRQQDFVNWLLAQRPSSGAPPPS (SEQ IDNo. 470); Y(D-AIa)EGTFISDYSIAMDKIRQQDFVNWLLAQKPSSGAPPPS (SEQ ID No. 471); Y(D-AIa)EGTFISDYSIAMDKIRQQDFVNWLLAQKPSSGAPPPS (SEQ ID No. 472); or Y(D-AIa)EGTFISDYSIAMDKIRQQDFVNWLLAQKPSSGAPPPS (SEQ ID No. 473).
- an embodiment of such a novel D-Ala2-containing GIP analog or hybrid can exhibit at least 50% sequence identity to one of the above analogs and comprises a D-AIa at position X2.
- the embodiment can further comprise the sequence PSSGAPPPS (SEQ ID NO: 1) or KNGGKPSSGAPPPS (SEQ ID NO: 240).
- a novel GIP analog or hybrid region D comprises the formula X1-X2-X3-X4- X5-X6-X7-X8-X9-X10-X11-X12-X13-X14 (SEQ ID No. 474) wherein Xl and X2 are absent.
- region D comprises the formula X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X14 (SEQ ID NO.
- Xl and X2 are absent and at least one of X3, X4 or X5 is an amino acid substitution or modification providing DPP-IV resistance, for example with a modification or substitution or reduced bond as defined herein.
- Other amino acid positions are as defined herein.
- a novel GIP analog or hybrid has GIP antagonist activity.
- D is absent.
- a novel GIP analog can comprise L-C-S or C-S where region L or C comprises an N-terminal modification, substitution or modification providing protease resistance, particularly DPP-IV resistance.
- X18-X19-C-S wherein one or both of Xl 8 and X19 are absent, such that for X18-X19-X20, X19-X20-X21, and X20-X21-X22, an amino acid substitution or modification or N-terminal modification of at least one of X18, X19, X20, X21 or X22 provides DPP-IV resistance.
- Additional embodiments include compounds comprising the sequence Y(DAIa)EGTFISDYSIAMDKIHQQDFVlN[WLLAQKPSSGAPPPS (SEQ ID NO. 186), Y(pSer)EGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 241),
- YA(N-MeGlu)EGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 242), YPEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 243), YVEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ED NO: 244), (D-Tyr)AEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID No. 475), or YAPGTFISDYSIAMDK ⁇ HQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 245).
- Further embodiments include compounds comprising the sequence Y(DAIa)EGTFISDYSIAMDKmQQDFVNWLLAQKGKKNDWKBNITQPSSGAPPPS (SEQ ID No. 193),
- YPEGTFISDYSIAMDKfflQQDFVNWLLAQKGKKNDWKHNTTQPSSGAPPPS (SEQ ID NO: 248), YVEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQPSSGAPPPS (SEQ ID NO: 249), (D-Tyr)AEGmSDYSIAMDKfflQQDFVN ⁇ WX ⁇ (SEQ ID No. 476), or
- any of the GIP polypeptides comprises an N-terminal His, D-histidine, desamino-histidine, 2-amino-histidine, beta-hydroxy-histidine, homohistidine, alpha-fluoromethyl-histidine, alpha-methyl histidine.
- Additional embodiments include compounds comprising the sequence HGEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 251) or HGEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQPSSGAPPPS (SEQ ID NO: 252).
- region L and/or C comprises a modified or substituted amino acid.
- the novel GIP analog comprises Cys, D-Cys, HomoCys or Penicillamine.
- the linker L and/or region C comprises Cys, D-Cys, homoCys or penicillamine. These amino acids are inserted as a site for modification to add peg molecules, lipids or link to other SH containing molecules such as other peptides or reactive molecules.
- at least one Cys, D-Cys, HomoCys or Penicillamine is modified with a lipid or a peg molecule or a reactive group. Typically 0, 1, 2 or 3 such residues are present.
- region L and/or C comprises at least one Cys, D-Cys, homocys or penicillamine residue.
- at least one of Xl 5 to Xl 8 or X31 to X40 is Cys, D-Cys, homocys or penicillamine.
- no more than two of Xl 5 to Xl 8 or X31 to X40 is Cys, D-Cys, homocys or penicillamine.
- no more than one of X15 to Xl 8 or X31 to X40 is Cys, D-Cys, homocys or penicillamine.
- at least one of Xl 5 to Xl 8 or X31 to X40 is Cys, D-Cys, homocys or penicillamine and at least one of said residues is modified by a lipid.
- a novel GIP analog or hybrid comprises a pegylated amino acid.
- At least one PEG molecule can be attached to the polypeptide.
- each peg molecule is attached to the compound at a D-Cys, homocys or penicillamine or Lys amino acid or to the carboxy terminal amino acid.
- the at least one PEG molecule is attached to an amino acid in region L and/or C.
- a pegylated novel GE? analog has an elimination half-life of at least one hour.
- a novel GIP analog or hybrid can comprise 1, 2, or 3 peg molecules.
- At least one of X15 to X18 or X31 to X40 is Cys, D-Cys, homocys or penicillamine and at least one of said residues is attached to a peg molecule. Furthermore at least one, two or three of Xl 5 to Xl 8 or X31 to X40 is Cys, D- Cys, homocys or penicillamine and at least one, two or three of said residues are attached to a peg molecule.
- a GIP compound of the present invention can be modified by attaching or coupling a reactive group.
- a GJP compound is thereby capable of covalently binding to a blood component through the reactive group.
- the reactive group typically will covalently bond with an amino group, a hydroxyl group, or a thiol group on a blood component, thereby covalently linking the GIP peptide to the blood component.
- the reactive group will react with a thiol group on a blood component. More preferably, the reactive group will react with a thiol group on blood serum albumin.
- the reactive group may contain any of a number of chemically reactive entities that are capable of forming a covalent bond.
- the reactive group will be capable of reacting with a thiol group on a blood component to form a disulfide bond.
- a thiol group on a blood component to form a disulfide bond.
- the GIP compound is reacted ex vivo with along-lived blood component such as albumin to form a composition suitable for sustained release.
- suitable long-lived components of the blood include immunoglobulin, human serum albumin, red blood cells and platelets.
- Reactive groups that are capable of forming disulfide bonds with thiol groups include those having an activated disulfide bond or an S-sulfonate.
- Reactive groups having an activated disulfide bond can be derived by coupling a GIP peptide cysteine (or cysteine analog) with an activating group, such as 2,2'- dithiodipyridine (DTDP), 2,2'-dithiobis(5-Nitropyridine) (NPYS), 5,5'-dithiobis(2-nitrobenzoic acid) (Ellman's reagent), or 6,6'-dithiodinicotinic acid.
- DTDP 2,2'- dithiodipyridine
- NPYS 2,2'-dithiobis(5-Nitropyridine)
- Ellman's reagent 5,5'-dithiobis(2-nitrobenzoic acid)
- 6,6'-dithiodinicotinic acid such
- activated disulfide bond groups Reactive groups containing an activated disulfide bond are herein referred to as activated disulfide bond groups.
- an activated disulfide bond group can be derived by acylating a lysine side chain of a GIP peptide with a mercapto-activated carboxylic acid.
- Another exemplary embodiment of the present invention is to utilize a reactive group that is capable of reacting with a thiol group on a blood component to form a thioether linkage.
- such a reactive group will be derived by coupling a GIP peptide with a chemically reactive entity from a maleimido-containing group, such as gamma-maleimide- butyrylamide (GMBA), maleimide-benzoyl-succinimide (MBS), gamma- maleimido-butyryloxy succinimide ester (GMBS), and maleimidopropionic acid (MPA).
- GMBA gamma-maleimide- butyrylamide
- MMS maleimide-benzoyl-succinimide
- GMBS gamma- maleimido-butyryloxy succinimide ester
- MPA gamma-maleimidopropionic acid
- the reactive group of a GIP compound will be capable of covalently bonding to a primary amine on a blood component to form an amide bond.
- such reactive groups will be derived by coupling a GIP peptide with N- hydroxysuccinimide (NHS) or N-hydroxysulfosuccinimide (sulfo- NHS) to form an NHS or sulfo-NHS ester.
- NHS N- hydroxysuccinimide
- sulfo- NHS N-hydroxysulfosuccinimide
- These succinimidyl groups may potentially react with alpha-amine groups on the N-termini of blood component proteins, provided that such amine groups are accessible or available to the reactive group.
- these succinimidyl groups will react with the epsilon- amine of lysine in blood component proteins, since the epsilon-amine of lysine is the only amino acid side chain that reacts significantly with NHS esters.
- GIP compounds of the present invention contain reactive groups that are designed to covalently bond with thiol groups on blood components. Binding to thiol groups is exemplary over binding to amino groups, because thiol groups are less abundant in vivo than are amino groups. Fewer blood components are thereby targeted through binding to thiol groups compared to binding to amino groups, resulting in greater specificity of binding. Accordingly, the exemplary GIP compounds will contain GIP peptides modified with a maleimido group or more In one embodiment, an S-sulfonate or an activated disulfide bond group.
- the GIP compounds of the present invention may bind to any of several blood components that contain a free thiol group, the GIP compounds preferably will covalently bond with the thiol group on serum albumin.
- Serum albumin is the most abundant blood protein, and contains a single thiol group, located at amino acid residue 34 in the protein (Cys34), which is highly conserved among species.
- the binding of GIP compounds to serum albumin not only provides specificity of binding, but also provides a reproducible formation of conjugates having a 1:1 binding of GIP compound to serum albumin. The reproducibility of this 1:1 ratio is desirable for use of a GIP compound as a therapeutic, since reproducible conjugates of GIP compound and serum albumin will result upon administration of the GIP compound.
- conjugates of GIP compound and serum albumin are desirable for ex vivo or in vitro approaches to form conjugates for therapy.
- Conjugates can be formed ex vivo by combining GIP compounds of the present invention with blood, allowing formation of the conjugates, and then administering the conjugate-containing blood to the host.
- GIP compound-serum albumin conjugates can also be formed in vitro, by combining GIP compound with recombinant serum albumin to form conjugates which can be administered.
- the reproducibility of 1:1 conjugates of GIP compound and serum albumin provides for reproducible conjugates from ex vivo administration or in vitro batch to batch preparation.
- GIP compounds covalently attached to one or more molecules of polyethylene glycol (peg), or a derivative thereof wherein each peg is attached at a Cys or Lys amino acid or the carboxy terminus of the peptide, resulting in pegylated GIP compound with a half-life of at least one hour, at least 4, 6, 10, 15, 20 or 24.
- a pegylated GIP compound comprises any of the novel GIP compound sequences taught herein with a peg molecule covalently attached at 1 , 2 or 3 residues.
- embodiments presented above or herein are combined in any consistent combination.
- embodiments describing region D can be combined with embodiments describing region L to describe novel GIP analog embodiments having the combined changes in region D and in region L.
- the analogs can be further combined with a second hormone module to form a GIP hybrid.
- the novel GIP analog or hybrid polypeptides of the invention are at least amino acids 25 amino acids in length.
- the polypeptides may be at least 21, 22, 23, 24, 25, 26, 27, ' 28, 29, 30, 31, 32, 33, and each integer up to 54 amino acids in length (e.g. Gff(l-42) + long exendin tail (27-39)).
- the polypeptides of the invention include only natural L amino acid residues and/or modified natural L amino acid residues.
- the polypeptides of the invention do not include unnatural amino acid residues.
- the novel GIP analog or hybrid may exhibit at least 60%, 65%, 70%, 80%, 85%, 90%, 95% or 98% sequence identity to a native GIP(I -42), GIP(I -30), GE?(l-26), GEP(l-39), GEP(19-30), GIP(19-26), GIP(19-39), G ⁇ > (19-42) 5 GIP(I-Il) 5 or GIP(1-14) over the entire length of each corresponding sequence.
- Such polypeptides of the invention may also exhibit at least 50%, 60%, 65%, 70%, 80%, 85%, 90%, 95% or 98% sequence identity to a modified or substituted GIP, e.g.
- the D- L-C region of a novel GIP analog may exhibit at least 60%, 65%, 70%, 80%, 85%, 90%, 95% or 98% sequence identity to a native GIP(l-42), GIP(l-30), GIP(l-26), GIP(I -39), GIP(19-30), GBP(19-26), GB?(19- 39), GEP(19-42), GEP(I-Il), or GIP(I -14) over the entire length of each corresponding sequence.
- Native GIP sequences include those derived from human GIP(l-42)
- the S region of a novel GIP analog or hybrid of the invention may exhibit at least 50%, 60%, 65%, 70%, 80%, 85%, 90%, 95% or 98% sequence identity to a native Tip-cage sequence, such as PSSGAPPPS (SEQ ID NO: 1).
- a novel GIP analog or hybrid polypeptide of the invention comprises a sequence comprising at least 60%, 65%, 70%, 80%, 85%, 90%, 95% or 98% sequence identity to a novel GIP analog sequence disclosed herein.
- novel GIP analog or hybrid sequences which are also useful for the sequence comparison, include:
- YAEGTFISDYSIAMDKIHQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 186) (human GIP(I -30) core), YAEGTFISDYSMMDKIRQQDFvTSfWLLAQRGKKSDWKHNrrQPSSGAPPPS (SEQ ID NO: 268) (mouse GIP(I -42) core),
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQRPSSGAPPPS (SEQ ID NO: 269) (mouse GIP(I -30) core), YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQPSSGAPPPS (SEQ ID NO: 270) (rat GIP(l-42) core),
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 271) (rat GIP(I -30) core), YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQPSSGAPPPS (SEQ ID NO: 272) (pig GIP(I -42) core),
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQKPSSGAPPPS (SEQ ID NO: 273) (pig GIP(l-30) core), YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHN ⁇ QPPSGAPPPS (SEQ ID NO: 274) (bovine GIP(l-42) core), or YAEGTFISDYSIAMDKmQQDFVNWLLAQKPPSGAPPPS (SEQ ID NO: 275) (bovine GIP(I -30) core).
- YAEGTFISDYSIAMDKIHQQDFVNWLKNGGPSSGAPPPS (SEQ ID NO: 276) (human GIP(I -26) core), YAEGTFISDYSIAMDKIRQQDFVNWLKNGGPSSGAPPPS (SEQ ID NO: 277) (mouse GIP(I -26) core), YAEGTFISDYSIAMDKIRQQDFVNWLKNGGPSSGAPPPS (SEQ ID NO: 278) (rat GIP(I -26) core),
- YAEGTFISDYSIAMDKIRQQDFVNWLKNGGPSSGAPPPS (SEQ ID NO: 279) (pig GIP(l-26) core), or YAEGTFISDYSIAMDKIRQQDFVNWLKNGGPPSGAPPPS (SEQ ID NO: 280) (bovine GEP(l-26) core).
- YAEGTFISDYSlAMDK]RQQDFVrWLLAQKGKKM)WKHNPSSGAPPPS (SEQ ID NO: 283) (rat GIP(I -39) core), YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNPSSGAPPPS (SEQ ID NO: 284) (pig GIP(l-39) core), or
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNPPSGAPPPS (SEQ ID NO: 285) (bovine GIP(l-39) core).
- reference to a component peptide hormone or module includes reference to analogs, derivatives, fragments, as well as peptidic enhancers related thereto.
- novel GIP analogs are preferably C-terminally amidated, but need not be for the purposes of the instant invention.
- the C-terminus of these peptides may have a free -OH or - NH2 group.
- These peptides may also have other post-translational modifications.
- novel GIP analog polypeptides of the present invention may also be constructed with an N-terminal methionine residue.
- the present invention relates to novel GP analog polypeptides including one or more amino acid sequence modifications. Such modifications include substitutions, insertions, and/or deletions, alone or in combination.
- the GIP analog or hybrid polypeptide includes one or more modifications of a "non-essential" amino acid residue.
- a "non-essential" amino acid residue is a residue that can be altered, i.e., deleted or substituted, in the native human amino acid sequence without abolishing or substantially reducing the GIP or component peptide hormone receptor agonist activity of the GIP analog or hybrid.
- the GIP analog or hybrid polypeptides of the invention may have one or more substitutions in the amino acid sequence of native GIP, GIP(I -30), GIP(1-14), GEP(l-26), GIP(I- 39), GIP(19-26), GIP(19-30), GIP(19-39) or GIP(19-42) or a region S, alone or in combination with one or more insertions or deletions.
- the substitution does not abolish or substantially reduce the GIP agonist activity of the GIP analog polypeptide.
- the present invention relates to GIP analog polypeptides that have a single substitution, or consecutive or non-consecutive substitution of more than one amino acid residues in the amino acid sequence of native human GIP.
- the GIP analog polypeptides of the invention include one, two, or three amino acid substitutions.
- the native GIP is human, rat, mouse, porcine or bovine.
- substitutions include conservative amino acid substitutions.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain, or physicochemical characteristics ⁇ e.g., electrostatic, hydrogen bonding, isosteric, hydrophobic features). Families of amino acid residues having similar side chains are known in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, methionine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
- a novel GIP analog or hybrid will have ho more than one conservative amino acid substitution as compared to the sequence against which is being compared, alternatively no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 conservative amino acid substitution as compared to the sequence against which is being compared.
- the GIP analog or hybrid polypeptides of the invention may include substitutions of one or more unnatural and/or non-amino acids, e.g., amino acid mimetics, into the sequence of GIP.
- Exemplary linker molecules include aminocaproyl ("Aca”), beta-alanyl, and 8-amino-3,6-dioxaoctanoyl.
- beta-turn mimetics are available commercially (BioQuadrant Inc, Quebec, Canada) and have been described in literature (Hanessian et al, Tetrahedron 12789-854 (1997); Gu et al, Tetrahedron Letters 44: 5863-6 (2003); Bourguet et al., Bioorganic & Medicinal Chemistry Letters 13: 1561-4 (2003); Grieco et al, Tetrahedron Letters 43: 6297-9 (2002); Souers et al, Tetrahedron 57: 7431-48 (2001); Tsai et al, Bioorganic & Medicinal Chemistry 7: 29-38 (1999); Virgilio et al, Tetrahedron 53: 6635-44 (1997)).
- Exemplary beta-turn mimetics include mimic A and mimic B illustrated herein.
- Their IUPAC names are Mimic A: N-(3S,6S,9S)-2-oxo-3-amino-l-azabicyclo[4.3.0]- nonane-9-carboxylic acid.
- Mimic B N-(3S,6S,9R)-2-oxo-3-amino-7-thia-l-azabicyclo[4.3.0]-nonane-9- carboxylic acid.
- Exemplary GIP analog or hybrid polypeptides comprising amino acid sequence beta-turn mimetic substitutions include native human GIP 5 wherein amino acids at positions x and x+1 are substituted with beta- turn mimetics selected from the group consisting of mimic A and mimic B, wherein x is selected from the amino acids at amino acid positions 8 to 14 of native human GIP.
- beta-turn mimetics selected from the group consisting of mimic A and mimic B
- x is selected from the amino acids at amino acid positions 8 to 14 of native human GIP.
- These linkers are particularly useful to comprise region the region "L" of the D-L-C-S novel GIP analogs of the invention.
- the GIP analog or hybrid polypeptides of the invention may have one or more amino acid residues deleted from the amino acid sequence of native GIP, or a region S, alone or in combination with one or more insertions or substitutions. In one aspect, the GIP analog or hybrid polypeptides of the invention may have one or more amino acid residues deleted from the ⁇ - terminus or C-terminus of a native GIP.
- the GIP analog or hybrid polypeptides of the invention may have one or more amino acid residues deleted at amino acid positions 1 through 42 of a native GIP, GIP(1-14), GlP(l-26), GIP(l-30), GIP(I -39), Gff(19-26), GIP(19-30), GIP(19-39) or GIP(19-42) or a region S.
- Such deletions may include more than one consecutive or non-consecutive deletion.
- no more than 1, no more than 2, no more than 3, no more than 4, or no more than 5 amino acids are deleted from a native GIP, from GIP(l-30), GIP(1-14), GIP(l-26), GIP(l-39), GIP(19-30), GIP(19-26), GIP(19-39) or GIP(19-42) or from a region S as when region is exendin(31-39) or exendin(27- 39) for example.
- the native GIP is human, rat, mouse, porcine or bovine.
- the GIP compound when intended for use as an agonist, does not include a deletion at any one of positions 1-15, corresponding to positions YAEGTFISDYSIAMD (SEQ ID NO. 477), of the C-terminal sequence of GIP. In other words, each of the corresponding 1-15 positions of GIP will be present, although they may be substituted or derivatized.
- the agonist GIP compound does not include a deletion at any one of positions 4-15, corresponding to positions GTFISDYSIAMD (SEQ ID No. 478), of the C-terminal sequence of GIP. In other words, each of the corresponding 4-15 positions of GIP will be present, although they may be substituted or derivatized.
- each of the positions 1-15 or 4-15 will be present and occupied by the amino acid present in that position of a naturally-occurring GIP species or by a substitution or derivative thereof.
- excluded firom the various embodiments described herein are the GIP compounds that did not demonstrate adequate receptor binding activity or receptor activation activity as shown.
- the GP compound when intended for use as an agonist, does not include a deletion at any one of positions 1-15, corresponding to positions YAEGTFISDYSIAMD (SEQ ID No. 477), of the C-terminal sequence of GIP. In other words, each of the corresponding 1-15 positions of GIP will be present, although they may be substituted or derivatized.
- the agonist GIP compound does not include a deletion at any one of positions 4-15, corresponding to positions GTFISDYSIAMD (SEQ ID No. 478), of the C-terminal sequence of GIP. In other words, each of the corresponding 4-15 positions of GIP will be present, although they may be substituted or derivatized.
- the GIP analog or hybrid polypeptides of the invention may have one or more amino acid residues inserted into the amino acid sequence of native GIP from GIP(I -30), GIP(I- 14), GIP(l-26), GIP(l-39), GIP(19-3O), GIP(19-26), GlP(19-39) or GIP(19-42) or region S, alone or in combination with one or more deletions and/or substitutions.
- the present invention relates to GIP analog or hybrid polypeptides that have a single insertion, or consecutive or non-consecutive insertions of more than one amino acid residues into the amino acid sequence of native GIP, GIP(I -30), GIP(I -14), GIP(l-26), GlP(l-39), GIP(19-30), GIP(19-26), GIP(19-39) or GIP(19-42), or region S, for example exendin(27-39) and exendin(31-39).
- the native GIP is human, rat, mouse, porcine or bovine.
- the GIP analog or hybrid polypeptides of the invention may include insertions of one or more unnatural amino acids and/or non-amino acids into the sequence of GIP, GIP(I -30), GEP(1-14), GIP(l-26), GIP(l-39), GIP(19-30), GIP(19-26), Gff(19-39) or GIP(19-42), or a region S, for example exendin(27-39) and exendin(31-39).
- the unnatural amino acids inserted into the sequence of GIP, GIP(l-30), GIP(1-14), GIP(l-26), GIP(l-39), GIP(19-30), GlP(19-26), GIP(19-39) or GIP(19-42) or region S for example exendin(27-39) and exendin(31-39) may be beta-turn mimetics or linker molecules.
- the native GIP can be human, rat, mouse, porcine or bovine.
- region S retains at least Proline (or proline analog) at X37 in order to interact with a Trp (or Trp analog) to favor Tip cage formation.
- a Pro is retained at position X31 to also interact with Trp at X25.
- Trp-cages N-terminally truncated exendin-4 analogs (Trp-cages)
- Trp-cages N-terminally truncated exendin-4 analogs
- the linker is a GIy linker, for example Gly-Gly-Gly, or a betaAla linker, for example betaAla-betaAla; all of which are specifically envisioned.
- Linker molecules of particualr interest include aminocaproyl ("Aca"), beta-alanyl, and 8-amino-3,6-dioxaoctanoyl.
- a beta- turn mimetic which includes mimic A: N-(3S,6S,9S)-2-oxo-3-amino-l-azabicyclo[4.3.0]-nonane-9- carboxylic acid, mimic B: N-(3S,6S,9R)-2-oxo-3-amino-7-thia-l-azabicyclo[4.3.0]-nonane-9-carboxylic acid, and also Ala-Aib and Ala-Pro dipeptides.
- GIP analog or hybrid polypeptides of the invention may include insertions of polyamino acid sequences (e.g., poly-his, poly-arg, poly-lys, poly-ala, etc.) at either terminus of the polypeptide, known as "extensions” or “tails.”
- polyamino acid sequences e.g., poly-his, poly-arg, poly-lys, poly-ala, etc.
- novel GIP analog or hybrid polypeptides comprising amino acid sequence insertions include an alanine substitution at each amino acid position along the length of native GIP, GIP(I- 30), GIP(1-14), GIP(l-26), GIP(I -39), GIP(19-30), GIP(19-26), GIP(19-39) or GIP(19-42), or region S, for example exendin(27-39) and exendin(31-39).
- the present invention also relates to derivatives of the GIP analogs and hybrid polypeptides.
- Such derivatives include GIP analog and hybrid polypeptides conjugated to one or more water soluble polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, etc.), or by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala.
- PEG polyethylene glycol
- fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, etc.)
- polyamino acids such as poly-his, poly-arg, poly-lys, and poly-ala.
- Modifications to the polypeptides can also include small molecule substituents, such as short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
- the water soluble polymer molecules will preferably have a molecular weight ranging from about 500 to about 20,000 Daltons.
- Such polymer-conjugations and small molecule substituent modifications may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the GIP analog and hybrid polypeptides. Alternatively, there may be multiple sites of derivatization along the GIP analog and hybrid polypeptide.
- GIP analog and hybrid polypeptides may be conjugated to one, two, or three polymer molecules.
- the water soluble polymer molecules are preferably linked to an amino, carboxyl, or thiol group, and may be linked by N or C termini, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine. Alternatively, the water soluble polymer molecules may be linked with diamine and dicarboxylic groups.
- GIP analog and hybrid polypeptides of the invention are conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid.
- GIP analog and hybrid polypeptide derivatives of the invention also include GlP analog and hybrid polypeptides with chemical alterations to one or more amino acid residues.
- Such chemical alterations include amidation, glycosylation, acylation, sulfation, phosphorylation, acetylation, and cyclization.
- the chemical alterations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the GIP analog and hybrid polypeptides.
- the C-terminus of these peptides may have a free -OH or -NH2 group.
- the N-terminal end may be capped with an isobutyloxycarbonyl group, an isopropyloxycarbonyl group, an n-butyloxycarbonyl group, an ethoxycarbonyl group, an isocaproyl group (isocap), an octanyl group, an octyl glycine group (G(Oct)), or an 8-aminooctanic acid group or a Fmoc group.
- cyclization can be through the formation of disulfide bridges.
- the amino acid sequences of the peptides may be identical to the sequences of a GIP described herein, except that one or more of the peptide bonds are replaced by a retro-inverso pseudopeptide bond.
- the most N- terminal peptide bond is substituted, since such a substitution will confer resistance to proteolysis by exopeptidases acting on the N- terminus.
- Further modifications also can be made by replacing chemical groups of the amino acids with other chemical groups of similar structure.
- Another suitable pseudopeptide bond that is known to enhance stability to enzymatic cleavage with no or little loss of biological activity is the reduced isostere pseudopeptide bond (Couder, et al. (1993), Int. J. Peptide Protein Res., 41:181-184, incorporated herein by reference in its entirety).
- amino acid sequences of these peptides may be identical to the sequences of a novel GIP analog and hybrid peptide, except that one or more of the peptide bonds are replaced by an isostere pseudopeptide bond.
- the most N-terminal peptide bond is substituted, since such a substitution would confer resistance to proteolysis by exopeptidases acting on the N-terminus.
- the synthesis of peptides with one or more reduced isostere pseudopeptide bonds is known in the art (Couder, et al. (1993), cited above).
- Other examples include the introduction of ketomethylene or methylsulfide bonds to replace peptide bonds.
- the bond between the second and third residues that is a target for cleavage by DPP-IV is replaced to a peptidase-resistant bond as disclosed herein.
- Peptoid derivatives of GIP analog and hybrid peptides represent another class of peptide mimetics that retain the important structural determinants for biological activity, yet eliminate the peptide bonds, thereby conferring resistance to proteolysis (Simon, et al., Proc. Natl. Acad. Sci. USA, 89:9367-9371 (1992), incorporated herein by reference in its entirety).
- Peptoids are oligomers of N-substituted glycines. A number of N-alkyl groups have been described, each corresponding to the side chain of a natural amino acid (Simon, et al. (1992), cited above). Some or all of the amino acids of the GIP peptides may be replaced with the N- substituted glycine corresponding to the replaced amino acid.
- novel GIP analog or hybrid polypeptides include combinations of the above- described modifications, i.e., deletion, insertion, and substitution.
- GIP analog or hybrid polypeptides of the formulas wherein the indicated amino acid residue is chemical modified or derivitized e.g., through fatty acid derivatization, PEGylation, amidation, glycolization, etc.
- Exemplary embodiments include derivatization of a lysine residue, particularly at position 16 or 30.
- D-amino acid residues of the indicated amino acids are also contemplated within the scope of the invention.
- exemplary GIP analog or hybrid polypeptides include the polypeptides of the formulas with internal deletions, particularly in areas not corresponding to the active sites as described herein.
- Exemplary GIP analog or hybrid polypeptides comprising substitutions of unnatural amino acids.
- Exemplary derivatives of the GIP analog or hybrid polypeptides of the invention include polymer-conjugated GIP analog or hybrid polypeptides, wherein the GIP analog or hybrid polypeptide includes any of the above- described insertions, deletions, substitutions, or combinations thereof, and the polymer molecule is conjugated at a lysine residue.
- the GIP analog or GIP-containing hybrid is a derivative or substitution of the methionine at position 14 and having a longer duration of action compared to human GIP or to the patent analog.
- an octyl-glycine at the methionine position 14, as in 0601GIP4755 increases the duration of action of the compound in vivo. Duration of action was increased to at least 4 hours by this modification.
- D-Ala2 variants of each GIP sequence herein e.g., see tables.
- variants of each of the above sequences where the GIP portion is modified by one, two or three modifications as described herein.
- Exemplary modifications are those at the first, second or third N-terminal amino acid of GIP that impart DPP-IV resistance superior to that of native GIP.
- novel GIP compounds comprise a C-terminal amide.
- novel GIP analog or a GIP hybrid comprises a half-life at least twice that of human GIP(I -30)amide. Further the half-life can be at least 6 hours.
- novel GIP analogs and hybrids can be formulated in a composition comprising a pharmaceutically acceptable carrier.
- an analog of exenatide with leucine substituted for Met at position 14 is used either as a hybrid component or in adjunct therapy with a GBP hybrid: HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (SEQ ID NO: 286).
- the GIP analog or hybrid polypeptides of the invention retain at least about 25%, preferably about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% percent of the biological activity of native human GP with regard to glucose lowering.
- the GIP analog or hybrid polypeptides of the invention exhibit improved GIP agonist activity.
- the GIP analog or hybrid polypeptides of the invention exhibits at least about 110%, 125%, 130%, 140%, 150%, 200%, or more of the biological activity of native human GlP.
- the novel GIP analog or hybrids can be antagonists.
- Exemplary GIP analog or hybrid polypeptide are those having a potency which is equal to or greater than the potency of GIP(l-42) or GIP(l-30) in that same assay.
- exemplary GIP analog or hybrid polypeptides of the invention may exhibit improved ease of manufacture, stability, and/or ease of formulation, as compared to GIP(I -42) or GP(I -30).
- the novel GIP analogs of the invention, as well as GIP analogs can be administered with agents such as small molecules or antibodies that are agonists or antagonists, as may be the case, for the peptide hormones and growth factors mentioned herein.
- GIP hybrids having the naturally-occurring C-terminal amino acid sequence of exendin-4, particularly PSSGAPPPS (SEQ ID NO: 1) sequence, described herein, specifically excluded are those having a modification at the "P' 1 " position as described in WO2004/103390.
- Hybrid Polypeptides in the Treatment or Prevention Disease Conditions or Disorders.
- Metabolic diseases and disorders take on many forms, including obesity, diabetes, dyslipidemia, insulin resistance, cellular apoptosis, etc. Obesity and its associated disorders are common and very serious public health problems in the United States and throughout the world. Upper body obesity is the strongest risk factor known for type 2 diabetes mellitus, and is a strong risk factor for cardiovascular disease.
- Obesity is a recognized risk factor for hypertension, atherosclerosis, congestive heart failure, stroke, gallbladder disease, osteoarthritis, sleep apnea, reproductive disorders such as polycystic ovarian syndrome, cancers of the breast, prostate, and colon, and increased incidence of complications of general anesthesia (see, e.g., Kopelman, Nature 404: 635-43 (2000)).
- the pathogenesis of obesity is believed to be multifactorial but the basic problem is that in obese subjects nutrient availability and energy expenditure do not come into balance until there is excess adipose tissue. Obesity is currently a poorly treatable, chronic, essentially intractable metabolic disorder. A therapeutic drug useful in weight reduction of obese persons could have a profound beneficial effect on their health.
- Diabetes is a disorder of carbohydrate metabolism characterized by hyperglycemia and glucosuria resulting from insufficient production or utilization of insulin. Diabetes severely affects the quality of life of large parts of the populations in developed countries. Insufficient production of insulin is characterized as type 1 diabetes and insufficient utilization of insulin is type 2 diabetes. However, it is now widely recognized that there are many distinct diabetes related diseases which have their onset long before patients are diagnosed as having overt diabetes. Also, the effects from the suboptimal control of glucose metabolism in diabetes gives rise to a wide spectrum of related lipid and cardiovascular disorders. [00411] Dyslipidemia, or abnormal levels of lipoproteins in blood plasma, is a frequent occurrence among diabetics.
- Dyslipidemia is typically characterized by elevated plasma triglycerides, low HDL (High Density Lipoprotein) cholesterol, normal to elevated levels of LDL (Low Density Lipoprotein) cholesterol and increased levels of small dense, LDL (Low Density Lipoprotein) particles in the blood.
- Dyslipidemia is one of the main contributors to the increased incidence of coronary events and deaths among diabetic subjects. Epidemiological studies have confirmed this by showing a several-fold increase in coronary deaths among diabetic subjects when compared with non-diabetic subjects. Several lipoprotein abnormalities have been described among diabetic subjects.
- Insulin resistance is the diminished ability of insulin to exert its biologically action across a broad range of concentrations.
- the body secretes abnormally high amounts of insulin to compensate for this defect and a state of impaired glucose tolerance develops. Failing to compensate for the defective insulin action, the plasma glucose concentration inevitable rises, resulting in the clinical state of diabetes.
- insulin resistance and relative hyperinsulinemia have a contributory role in obesity, hypertension, atherosclerosis and type 2 diabetes.
- the association of insulin resistance with obesity, hypertension and angina has been described as a syndrome, Syndrome X, having insulin resistance as the common pathogenic link.
- Apoptosis is an active process of cellular self-destruction that is regulated by extrinsic and intrinsic signals occurring during normal development. It is well documented that apoptosis plays a key role in regulation of pancreatic endocrine beta cells. There is increasing evidence that in adult mammals the beta- cell mass is subject to dynamic changes to adapt insulin production for maintaining euglycemia in particular conditions, such as pregnancy and obesity. The control of beta cell mass depends on a subtle balance between cell proliferation, growth and programmed cell death (apoptosis). A disturbance of this balance may lead to impairment of glucose homeostasis.
- glucose intolerance develops with aging when beta cell replication rates are reduced and human autopsy studies repeatedly showed a 40- 60% reduction of beta cell mass in patients with non-insulin-dependent-diabetes mellitus compared with nondiabetic subjects. It is generally agreed that insulin resistance is an invariable accompaniment of obesity but that normoglycemia is maintained by compensatory hyperinsulinemia until the beta cells become unable to meet the increased demand for insulin, at which point type 2 diabetes begins.
- GIP gastric inhibitory polypeptide
- GLP-I ghicagon-like peptide 1
- GLP-I, GLP-I analogs and mimetics such as exenatide have been shown to be efficacious in controlling glucose levels in type 2 diabetic patients, the insulinotropic effect of GIP is significantly reduced in diabetic subjects, compared to normal individuals [4-6].
- the preservation of insulinotropic action of GLP-I but not of GIP in the same diabetic subjects suggests that GIP signal transduction is impaired in type 2 diabetes.
- Reduced GIP receptor expression in pancreatic beta cells has been proposed to contribute to overall reduced incretin effects in diabetic subjects [7].
- Amylin Pharmaceuticals, Inc. has conducted three pivotal clinical studies to evaluate the effects of exenatide in patients with type 2 diabetes not achieving target blood glucose concentrations using metformin alone, sulfonylureas alone, or using a combination of metformin and a sulfonylurea. All three studies met the primary glucose control endpoint as measured by HbAIc. The average reduction in HbAIc across the Phase 3 program in patients completing the studies on the highest dose of exenatide (10 ⁇ g twice daily) was approximately one percent. Additionally, approximately 40 percent of these patients achieved HbAIc measurements of 7 percent or less. The clinical data indicate that despite the efficacy of exenatide, some diabetic individuals fail to attain normal glucose concentrations.
- GIP lacks the gastric emptying effect of GLP-I [13-14] that is a possible contributing factor to the incidence of nausea during GLP-I treatment and which limits the peptide's therapeutic window [15]. Thus, it should permit the use of higher GIP dosing regimens.
- the methods of the present invention are based on the notion that patients can be primed for GIP therapy through prior glucose lowering with other anti-diabetic agents, such as GLP-I, a GLP-I analog or exendin-4 or other agents, e.g. metformin, sulfonyureas, thiazolidinediones (TZDs), pramlintide, insulin, acarbose, dipeptidyl peptidase (DPP-IV) inhibitors.
- DPP-IV inhibitors are well- known and described for example in published application US20050004117, US Patent 6710040, and US Patent 6645995, which are incorporated herein by reference for their compounds.
- SFUs sulfonylureas
- Glimepiride sulfonylureas
- Adjunct therapy of a metabolically stable GIP analog or hybrid or novel GIP analog or hybrid with exenatide (or other antidiabetics) will provide for increased insulinotropic responses than either alone, in patients with conditions associated with elevated glucose, such as patients with type 2 diabetes.
- exenatide or other antidiabetics
- Such a treatment regimen leads to normalization of glucose concentrations, improvement in beta-cell function, and through their trophic activity on the ⁇ cells slows disease progression to obviate or lesson the need for insulin therapy.
- GIP hybrids of the invention can be useful for reducing food intake, reducing appetite, reducing caloric intake, inducing satiety, reducing nutrient availability, causing weight loss, affecting body composition, altering body energy content or energy expenditure, improving lipid profile (including reducing LDL cholesterol and triglyceride levels and/or changing HDL cholesterol levels), slowing gastrointestinal motility, delay gastric emptying, moderating the postprandial blood glucose excursions, preventing or inhibiting glucagon secretion, and decreasing blood pressure.
- such GIP hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- GIP -containing hybrids that contain an exendin, amylin (e.g. amylin-sCT-amylin chimera), leptin or PYY (e.g. PYY-NPY chimera) family module that can effectively reduce food intake, change body composition, redistribute fat and/or reduce body weight.
- amylin e.g. amylin-sCT-amylin chimera
- leptin or PYY e.g. PYY-NPY chimera
- GIP hybrids comprising an exendin-4 or analog or derivative thereof, an amylin component such as pramlintide of an amylin-sCT-amylin chimera, an FN38 family member such as FN38 or an analog or derivative thereof, a PYY member such as a PYY-NPY chimera as described herein such as SEQ ID Nos.
- the GD? hybrid can have at least one, preferably two components, which act on the CNS.
- Forebrain structures or nuclei residing in the hypothalamus involved in food intake and/or body weight modulation include, for example, the arcuate nucleus (ARC), the paraventricular nucleus (PVN), the dorsomedial hypothalamus (DMH), the ventromedial nucleus (VMH), and the lateral hypothalamus nucleus (LHA).
- Hindbrain structures or nuclei residing in the brainstem involved in food intake and/or body weight modulation include, for example, the nucleus of the solitary tract (NST), the area postrema (AP), and the lateral parabrachial nucleus (LPBN).
- Brainstem nuclei that control the elements of the consummatory motor control system are likely controlled by primary or second order projections from brainstem regions like the NST, AP, and IPBN. It is noteworthy that the AP, NST and IPBN have all been shown to (collectively and independently) possess their own integrative abilities.
- CNS-directed anti-obesity agents act upon these forebrain structures residing in the hypothalamus involved in food intake and/or body weight modulation.
- CNS-directed anti- obesity agents act upon hindbrain structures residing in the brainstem involved in food intake and/or body weight modulation. Examples of such anti-obesity agents are described herein. See the table below for further examples of peptide family modules that can be combined with a GIP compound to form an anti- obesity agent hybrid, and can be combined to form an anti-obesity hybrid with activity on both the forebrain and hindbrain.
- Such components include, for example, neuropeptide Yl (NPYl) receptor antagonists, NPY5 receptor antagonists, leptin and leptin agonists, ciliary neurotrophic factor (CNTF) and CNTF agonists, peptide YY (PYY) and PYY agonists, exendin and exendin agonists, GLP-I and GLP-I agonist, ghrelin and ghrelin antagonists, cholecystokinin (CCK) and CCK agonists, and amylin and amylin agonists, including those described herein.
- NPYl neuropeptide Yl
- PYY ciliary neurotrophic factor
- PYY ciliary neurotrophic factor
- PYY peptide YY
- exendin and exendin agonists GLP-I and GLP-I agonist
- ghrelin and ghrelin antagonists cholecystokinin (CC
- the GIP hybrid is an anti-obesity agent that can include one or more predominantly forebrain acting peptide family components in addition to a GIP compound.
- the hybrid is an anti-obesity agent that can include one or more predominantly hindbrain acting anti-obesity agents.
- Exemplary peptide families and components are an NPYl receptor antagonist, an NPY5 receptor antagonist, a leptin or a leptin agonist or analog, a CNTF, an NPY2 receptor agonist (e.g., a PYY(3- 36) or a PYY(3-36) agonist), an exendin or an exendin agonist or analog, a GLP-I or a GLP-I agonist or analog, a ghrelin antagonist, a CCK or a CCK agonist or analog, and an amylin or an amylin agonist or analog.
- the GIP hybrid and method for it use include a first component that predominantly targets the energy balance centers of the hypothalamus, such as the ARC, PVN, VM, and LH.
- the GIP hybrid further contains one or more other peptide family component that also target the hypothalamus but at a different location or via a different mechanism of action than the first component.
- the GIP hybrid contains more than one other peptide family component and these also target the hypothalamus, the more than one other peptide family components may target the same location via the same mechanism of action as each other, or they may target different locations and/or different mechanisms of action.
- the GIP hybrid then contains one or more other peptide family components that provide one or more additional beneficial therapeutic effects as desired, including an anti- obesity effect via a location or mechanism of action different than the first component and each other, control of blood glucose, cardioprotection, and/or control of hypertension.
- the additional peptide family component is one that predominantly targets the energy balance centers of the hindbrain such as the NST, the AP and the IPBN.
- the GIP hybrid and method for it use include a first component that predominantly targets the energy balance centers of the hindbrain such as the NST, the AP and the IPBN.
- the GIP hybrid further contains one or more other peptide family component that also target the hypothalamus but at a different location or via a different mechanism of action than the first component and each other.
- the GIP hybrid then contains one or more other peptide family components that provide one or more additional beneficial therapeutic effects as desired, including an anti- obesity effect via a location or mechanism of action different than the first component and each other, control of blood glucose, cardioprotection, and/or control of hypertension.
- the additional peptide family component is one that predominantly targets the energy balance centers of the hypothalamus, such as the ARC, PVN, VM, and LH.
- an anti-obesity agent that "acts on a forebrain structure involved in food intake and/or body weight modulation" stimulates or suppresses activity of a particular region, e.g., particular nuclei and/or neuronal circuits, in the forebrain. This forebrain stimulation or suppression leads to a reduction in nutrient availability to the body.
- An anti-obesity agent that "acts on a hindbrain structure involved in food intake and/or body weight modulation” stimulates or suppresses activity of a particular region, e.g., particular nuclei and/or neuronal circuits, in the hindbrain. This hindbrain stimulation or suppression results in a reduction in nutrient availability to the body.
- methods for reducing fat mass by increasing the metabolic rate in a subject comprising administering an anti-obesity GIP hybrid in amounts effective to reduce fat mass by increasing the subject's metabolic rate.
- Fat mass can be expressed as a percentage of the total body mass.
- the fat mass is reduced by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, or at least 25% over the course of treatment.
- the subject's lean mass is not decreased over the course of the treatment.
- the subject's lean mass is maintained or increased over the course of the treatment.
- the subject is on a reduced calorie diet or restricted diet.
- reduced calorie diet is meant that the subject is ingesting fewer calories per day than compared to the same subject's normal diet. In one instance, the subject is consuming at least 50 fewer calories per day. In other instances, the subject is consuming at least 100, 150, 200, 250, 300, 400, 500, 600, 700, 800, 900, or 1000 fewer calories per day.
- methods of use in altering fat distribution, reducing fat mass, or both in a subject are provided. Accordingly, subjects for whom altering body composition is of benefit can also benefit from the present methods.
- Altered body composition includes loss or maintenance of body fat, with minimization of loss, maintenance, or gain of lean body mass. In such situations, weight may increase as well as decrease. Accordingly, subjects may be lean, overweight, or obese as these terms are generally used in the art.
- Methods provided may also include reducing fat in non-adipose tissue while sparing lean mass. Uses for this method include treating diseases such as nonalcoholic steatohepatitis (NASH) or lipodystrophy.
- NASH nonalcoholic steatohepatitis
- a method for altering the fat distribution in a subject comprising administering an anti-obesity GIP hybrid in amounts effective to alter fat distribution in the subject.
- the alteration results from an increased metabolism of visceral or ectopic fat, or both in the subject.
- fat distribution is meant the location of fat deposits in the body. Such locations of fat deposition include, for example, subcutaneous, visceral and ectopic fat depots.
- subcutaneous fat is meant the deposit of lipids just below the skin's surface. The amount of subcutaneous fat in a subject can be measured using any method available for the measurement of subcutaneous fat.
- ectopic fat storage is meant lipid deposits within and around tissues and organs that constitute the lean body mass (e.g., skeletal muscle, heart, liver, pancreas, kidneys, blood vessels). Generally, ectopic fat storage is an accumulation of lipids outside classical adipose tissue depots in the body.
- visceral fat is meant the deposit of fat as intra-abdominal adipose tissue. Visceral fat surrounds vital organs and can be metabolized by the liver to produce blood cholesterol.
- Visceral fat has been associated with increased risks of conditions such as polycystic ovary syndrome, metabolic syndrome and cardiovascular diseases.
- the method involves the metabolism of visceral or ectopic fat or both at a rate of at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, or 50% greater than for subcutaneous fat.
- the methods result in a favorable fat distribution.
- favorable fat distribution is an increased ratio of subcutaneous fat to visceral fat, ectopic fat, or both.
- the method involves an increase in lean body mass, for example, as a result of an increase in muscle cell mass.
- methods for reducing the amount of subcutaneous fat in a subject comprising administering, to a subject in need thereof, an anti-obesity GIP hybrid in amounts effective to reduce the amount of subcutaneous fat in the subject.
- the amount of subcutaneous fat is reduced in a subject by at least about 5%.
- the amount of subcutaneous fat is reduced by at least about 10%, 15%, 20%, 25%, 30% 40%, or 50% compared to the subject prior to administration of the anti-obesity hybrid.
- the methods described herein can be used to reduce the amount of visceral fat in a subject.
- the visceral fat is reduced in a subject by at least about 5%.
- the visceral fat is reduced in the subject by at least about 10%, 15%, 20%, 25%, 30% 40%, or 50% compared to the subject prior to administration of the anti-obesity GIP hybrid.
- Visceral fat can be measured through any means available to determine the amount of visceral fat in a subject. Such methods include, for example, abdominal tomography by means of CT scanning and MRI. Other methods for determining visceral fat are described, for example, in U.S. Patent Nos. 6,864,415, 6,850,797, and 6,487,445.
- a method for preventing the accumulation of ectopic fat or reducing the amount of ectopic fat in a subject comprises administering, to a subject in need thereof, an anti-obesity GIP hybrid in amounts effective to prevent accumulation of ectopic fat or to reduce the amount of ectopic fat in the subject.
- the amount of ectopic fat is reduced in a subject by at least about 5% compared to the subject prior to administration of the anti-obesity hybrid.
- the amount of ectopic fat is reduced in a subject by at least about 10%, or by at least about 15%, 20%, 25%, 30% 40%, or 50%.
- the amount of ectopic fat is proportionally reduced 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% in comparison to subcutaneous fat in a subject.
- Ectopic fat can be measured in a subject using any method available for measuring ectopic fat.
- methods for producing a more favorable fat distribution in a subject, where the method comprises administering to a subject a GIP hybrid that is effective as an anti- obesity agent in an amount effective to produce a favorable fat distribution.
- administration of an anti-obesity GIP hybrid reduces the amount of visceral fat or ectopic fat, or both, in a subject.
- an anti-obesity hybrid that comprises at least one family module that acts upon forebrain structures involved in food intake or body weight modulation or both in combination with at least one family module that acts upon hindbrain structures involved in food intake or body weight modulation or both.
- the methods preferentially reduce the amount of visceral or ectopic fat, or a combination of both, over the reduction in subcutaneous fat. Such methods result in a higher ratio of subcutaneous fat to visceral fat or ectopic fat. Such improved ratios may result in a reduced risk of the development of cardiovascular diseases, polycystic ovary syndrome, metabolic syndrome, or any combinations thereof.
- ectopic or visceral fat is metabolized at a rate 5% greater than subcutaneous fat. In other embodiments, ectopic or visceral fat is metabolized at a rate at least 10% 15%, 20%, 25%, 30% 50%, 60%, 70%, 80%, 90%, or 100% greater than subcutaneous fat.
- GIP hybrids containing an exendin, amylin (e.g. amylin-sCT-amylin chimera), leptin and/or PPF (e.g. PYY analogs or PPY/NPY chimera) family modules.
- a GIP hybrid contains at least two of these peptide family modules.
- the GD? hybrid can be administered either alone or in combination with a second anti-obesity agent such as an amylin. Leptin, PYY or exendin family peptide.
- Glucocorticosteroids have the adverse effect of increasing fat mass and decreasing lean mass. Accordingly, it is contemplated that the anti-obesity agent combination can be used in conjunction with glucocorticosteroids under conditions where glucocorticosteroid use is beneficial, in order to counteract the adverse effect of the glucocoriticosteroid.
- a GP hybrid of the invention can be administered separately or together with one or more other agents in order to obtain additional benefits or to enhance the effect of either the hybrid or the other agent.
- an anti-obesity GIP hybrid can be administered with an anti-obesity agent or a cardioprotective or anti-hypertension agent, depending on the risk factors pertinent to the subject in need of treatment and desired treatment outcome.
- exemplary anti-obesity agents for administration (either separately or mixed; either prior to, concomitantly or after) with a hybrid include serotonin (5HT) transport inhibitors, including, but not limited to, paroxetine, fluoxetine, fenfluramine, fluvoxamine, sertraline, and imipramine.
- Anti-obesity agents also include selective serotonin reuptake inhibitors, including, but not limited to dexfenfluramine, fluoxetine, sibutramine (e.g., MEREDIA®) and those described in U.S. Pat. No. 6,365,633 and PCT Patent Application Publication Nos. WO 01/27060 and WO 01/162341, which are hereby incorporated by reference in their entirety.
- selective serotonin reuptake inhibitors including, but not limited to dexfenfluramine, fluoxetine, sibutramine (e.g., MEREDIA®) and those described in U.S. Pat. No. 6,365,633 and PCT Patent Application Publication Nos. WO 01/27060 and WO 01/162341, which are hereby incorporated by reference in their entirety.
- Such 5HT transport inhibitors and serotonin reuptake inhibitors, analogs, derivatives, preparations, formulations, pharmaceutical compositions, doses, and administration routes have previously been described.
- Anti-obesity agents also include selective serotonin agonists and selective 5-HT2C receptor agonists, including, but not limited to, U.S. Pat. No. 3,914,250; and PCT Application Publication Nos. WO 02/36596, WO 02/48124, WO 02/10169, WO 01/66548, WO 02/44152; WO 02/51844, WO 02/40456, and WO 02/40457, which are hereby incorporated by reference in their entirety.
- Such selective serotonin agonists and 5-HT2C receptor agonists, compositions containing such agonists, and administration routes appropriate for use in the methods provided are known in the art. See, for example, Halford et al. (2005) Curr. Drag Targets 6:201-213 and Weintraub et al. (1984) Arch. Intern. Med. 144:1143-1148.
- Anti-obesity agents also include antagonists/inverse agonists of the central cannabinoid receptors (the CB-I receptors), including, but not limited to, rimonabant (Sanofi Synthelabo), and SR-147778 (Sanof ⁇ Synthelabo).
- CB-I antagonists/inverse agonsits, derivatives, preparations, formulations, pharmaceutical compositions, doses, and administration routes have previously been described, for example, in U.S. Pat. Nos.
- WO 96/33159 WO 98/33765, WO98/43636, WO98/43635, WO 01/09120, WO98/31227, WO98/41519, WO98/37061, WO00/10967, WOOO/10968, WO97/29079, WO99/02499, WO 01/58869, and WO 02/076949, which are hereby incorporated by reference in their entirety.
- Anti-obesity agents also include melanocortins and melanocortin agonists.
- the receptor MC4R appears to play a role in energy balance and obesity. See, for example, Anderson et al., Expert Opin. Ther. Patents 11:1583-1592 (2001), Speake et al,. Expert Opin. Ther. Patents 12:1631-1638 (2002), Bednarek et al., Expert Opin. Ther. Patents 14:327-336 (2004).
- Melanocortin agonists including, but not limited to, MC4R agonists, and composition containing such agonist appropriate for use in the methods provided are known in the art.
- MCR agonists, MC4R agonists, derivatives, preparations, formulation, pharmaceutical compositions, doses, and administration routes have previously been described, for example, in the following PCT patent applications, which are hereby incorporated by reference in their entirety: WO 03/007949, WO 02/068388, WO 02/068387, WO 02/067869, WO 03/040117, WO 03/066587, WO 03/068738, WO 03/094918, and WO 03/031410.
- Anti-obesity agents also include metabotropic glutamate subtype 5 receptor (mGluR5) antagonists, including, but are not limited to, compounds such as 2-methyl-6-(phenylethynyl)-pyridine (MPEP) and (3- [(2-methyl-l,3-thiazol-4-yl)ethynyl]pyridine) (MTEP) and those compounds described in Anderson et al. J. Eur. J. Pharmacol. 473:35-40 (2003); Cosford et al. Bioorg. Med. Chem. Lett. 13(3):351-4 (2003); and Anderson et al. J. Pharmacol. Exp. Ther. 303:1044-1051 (2002).
- MPEP 2-methyl-6-(phenylethynyl)-pyridine
- MTEP 3- [(2-methyl-l,3-thiazol-4-yl)ethynyl]pyridine
- Anti-obesity agents also include topiramate (TOPIMAX® (Ortho McNeil Pharmaceuticals), indicated as an anti-convulsant and an anti-convulsant, but also shown to increase weight loss.
- TOPIMAX® Ortho McNeil Pharmaceuticals
- Anti-obesity agents also include neuropeptide Yl (NPYl) antagonists and NPY5 antagonists.
- NPYl and NPY5 antagonists are known in the art. See, for example Duhault et al. (2000) Can. J Physiol. Pharm. 78:173-185, and U.S. Pat. Nos. 6,124,331, 6,214,853, and 6,340,683.
- NPYl and NPY5 antagonists, derivatives, preparations, formulation, pharmaceutical compositions, doses, and administration routes have previously been described.
- NPYl antagonists useful in the compositions and methods provided include: U.S. Pat. No. 6,001,836; and PCT Application Publication Nos.
- NPY5 antagonists useful in compositions and methods of use provided herein include, but are not limited to, the compounds described in: U.S. Pat. Nos. 6,140,354, 6,191,160, 6,258,837, 6,313,298, 6,337,332, 6,329,395, 6,340,683, 6,326,375, and 6,335,345; European Patent Nos. EP-Ol 010691, and EP- 01044970; and PCT Patent Publication Nos.
- WO 97/19682 WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 98/27063, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO,01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/22592, WO 0248152, WO 02/49648, and WO 01/14376.
- Anti-obesity agents also include melanin-concentrating • hormone (MCH) antagonists including melanin-concentrating hormone 1 receptor (MCHlR) antagonists, such as T-226296 (Takeda) and melanin- concentrating hormone 2 receptor (MCH2R) antagonists.
- MCH receptor antagonists, derivatives, preparations, formulation, pharmaceutical compositions, doses, and administration routes have previously been described, for example, in U.S. Patent Application Publication Nos. 2005/0009815, 2005/0026915, 2004/0152742, 2004/0209865; PCT Patent Application Publication Nos. WO 01/82925, WO 01/87834, WO 02/06245, WO 02/04433, and WO 02/51809; and Japanese Patent Application No. JP 13226269, which are hereby incorporated by reference in their entirety.
- Anti-obesity agents also include opioid antagonists, including, but not limited to those described in PCT Application No. WO 00/21509.
- opioid antagonists useful in compositions and methods of use provided herein include, but are not limited to, nalmefene (REVEX®), 3-methoxynaltrexone naloxone, naltrexone, naloxonazine, beta-funaltrexamine, deltal ([D-Ala2,Leu5,Cys6]-enkephalin (DALCE), naltrindole isothiocyanate, and nor-binalto ⁇ hamine.
- REVEX® 3-methoxynaltrexone naloxone
- naltrexone naloxonazine
- beta-funaltrexamine beta-funaltrexamine
- deltal [D-Ala2,Leu5,Cys6]-enkephalin (DALCE)
- DALCE naltrindole
- Anti-obesity agents also include orexin antagonists, including, but not limited to, those described in PCT Patent Application Nos. WO 01/96302, WO 01/68609, WO 02/51232, and WO 02/51838.
- Specific orexin antagonists useful in compositions and methods of use provided include, but are not limited to, SB- 334867-A.
- Anti-obesity agents also include neuropeptide Y2 (NPY2) agonists, including, but not limited to, compounds such as PYY3-36 (e.g., Batterham et al. (2003) Nature 418:650-654), NPY3-36 and other Y2 agonists such as N acetyl [Leu(28,31)] NPY 24-36 (White-Smith et al. (1999) Neuropeptides 33:526-533, TASP-V (Malis et al. (1999) Br. J. Pharmacol.
- NPY2 neuropeptide Y2
- Anti-obesity agents also include neuropeptide Y4 (NPY4) agonists including, but not limited to, compounds such as pancreatic peptide (PP) (e.g., Batterham et al. (2003) J. Clin. Endocrinol. Metab. 88:3989-3992) and other Y4 agonists such as 1229U91 (Raposinho et al.
- PP pancreatic peptide
- NPY2 agonists and NPY4 agonsits have previously been described, for example, in U.S. Pat. Publication No.2002/0141985 and PCT Application Publication No. WO 2005/077094.
- Anti-obesity agents also include histamine 3 (H3) antagonist/inverse agonists including but not limited to, those described in PCT Application No. WO 02/15905, O-[3-(lH-imidazol-4- yl)propanol]carbamates (Kiec-Kononowicz et al. (2000) Pharmazie 55:349-355), piperidine-containing histamine H3-receptor antagonists (Lazewska et al. (2001) Pharmazie 56:927-932), benzophenone derivatives and related compounds (Sasse et al. (2001) Arch.
- H3 histamine 3
- H3 antagonists/inverse agonists useful in compositions and methods of use provided include, but are not limited to, tbioperamide, 3-(lH-imidazol-4-yl)propyl N-(4- pentenyl)carbamate, clobenpropit, iodophenpropit, imoproxifan, and GT2394 (Gliatech).
- Anti-obesity agents also include cholecystokinin (CCK) and CCK agonists.
- Cholecystokinin-A (CCK-A) agonists of use include, but are not limited to, those described in U.S. Pat. No. 5,739,106.
- Specific CCK-A agonists include, but are not limited to, AR-R 15849, GI 181771, JMV-180, A-71378, A-71623 and SR146131.
- Anti-obesity agents also include ghrelin antagonists such as those described in PCT Application Publication Nos. WO 01/87335 and WO 02/08250. Ghrelin antagonists are also known as GHS (growth hormone secretagogue receptor) antagonists. The compositions and methods provided therefore contemplate the use GHS antagonists in place of ghrelin antagonists.
- Anti-obesity agents include obestatin and obestatin analogs and agonists.
- Obestatin is a peptide derived from the same precursor from which ghrelin is derived, preproghrelin. See, for example, Zhang et al. (2005) Science 310: 996-999; Nogueiras et al. (2005) Science 310: 985-986; Pan et al. (2006) Peptides 27:911-916.
- obestatin appears to act as an anorexic hormone by decreasing food intake, gastric emptying activities, jejunal motility, and body weight gain.
- Obestatin peptides of use include, but are not limited to those described in Zhang et al. (2005) Science 310: 996-999.
- amylinomimetics e.g. pramlintide, amylin-sCT-amylin, incretins, e.g. exendin-4, and PYY analogs
- amylinomimetics e.g. pramlintide, amylin-sCT-amylin, incretins, e.g. exendin-4, and PYY analogs
- a GIP-leptin hybrid may be administered with exendin-4, a PYY analog, and/or an amylin analog.
- the hybrids of the invention are useful for treating or preventing conditions or disorders which can be alleviated by reducing nutrient availability comprising administering to said subject a therapeutically or prophylactically effective amount of a compound of the invention.
- Such conditions and disorders include, but are not limited to, eating disorders, insulin-resistance, obesity, abnormal postprandial hyperglycemia, diabetes of any kind, including Type I, Type II, and gestational diabetes, Metabolic Syndrome, Dumping Syndrome, hypertension, dyslipidemia, cardiovascular disease, hyperlipidemia, sleep apnea, cancer, pulmonary hypertension, cholecystitis, and osteoarthritis.
- such hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- Non-limiting examples of a cardiovascular condition or disease are hypertension, myocardial ischemia, and myocardial reperfusion.
- Compounds of the invention may also be useful in treating or preventing other conditions associated with obesity including stroke, cancer (e.g,. endometrial, breast, prostate, and colon cancer), gallbladder disease, sleep apnea, reduced fertility, and osteoarthritis, (see Lyznicki et al, Am. Fam. Phys. 63:2185, 2001).
- compounds of the invention may be used to alter body composition for aesthetic reasons, to enhance one's physical capabilities, or to produce a leaner meat source.
- Hybrids are useful to change body composition by decreasing fat without significant decrease in muscle mass, thus producing a desirable loss of body fat while preserving lean body mass.
- such hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- the method comprises administering a therapeutically or prophylactically effective amount of a hybrid polypeptide to a subject in need thereof. Ih a exemplary embodiment, the subject is an obese or overweight subject.
- any subject including those with a body mass index of less than 30, who needs or wishes to reduce body weight is included in the scope of "obese.”
- such GIP hybrids contain an exendin, PYY, GLPl, amylin and/or sCT portion.
- methods of reducing food intake, reducing nutrient availability, causing weight loss, affecting body composition, and altering body energy content or increasing energy expenditure, treating diabetes mellitus, and improving lipid profile (including reducing LDL cholesterol and triglyceride levels and/or changing HDL cholesterol levels) are provided, wherein the methods comprise administering to a subject an effective amount of a hybrid polypeptide of the invention.
- the methods of the invention are used to treat or prevent conditions or disorders which can be alleviated by reducing nutrient availability in a subject in need thereof, comprising administering to said subject a therapeutically or prophylactically effective amount of a hybrid polypeptide of the invention.
- Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind.
- such hybrids contain an exendin, PYY, GLPl, amylin and/or sCT portion.
- a PPF or PYY family member comprises a GIP-hybrid component
- a GIP-hybrid component a GIP-hybrid component
- the effects of such peripherally-administered GIP hybrid polypeptides in the reduction of food intake, in the delay of gastric emptying, in the reduction of nutrient availability, and in the causation of weight loss are determined by interactions with one or more unique receptor classes in, or similar to, those in the PP family. More particularly, it appears that a receptor or receptors similar to the PYY-preferring (or Y7) receptors are involved.
- Additional assays useful to the invention include those that can determine the effect of GIP hybrid compounds, particularly those containing an exendin, PPF, PYY, GLPl, amylin and/or sCT portion, on body composition.
- An exemplary assay can be one that involves utilization of a diet-induced obese (DIO) mouse model for metabolic disease. Prior to the treatment period, male C57BL/6J mice can be fed a high-fat diet (#D12331, 58% of calories from fat; Research Diets, Inc.,) for 6 weeks beginning at 4 weeks of age. During the study, the mice can continue to eat their high-fat diet. Water can be provided ad libitum throughout the study.
- DIO mice can be implanted with subcutaneous (SC) intrascapular osmotic pumps to deliver either vehicle (50% dimethylsulfoxide (DMSO) in water) or a compound of the invention.
- SC subcutaneous
- the pumps of the latter group can be set to deliver any amount, e.g., 1000 ⁇ g/kg/d of a compound of the invention for 7-28 days.
- Body weights and food intake can be measured over regular intervals throughout the study periods.
- Respiratory quotient (RQ, defined as CO 2 production ⁇ O 2 consumption) and metabolic rate can be determined using whole-animal indirect calorimetry (Oxymax, Columbus Instruments, Columbus, OH).
- the mice can be euthanized by isoflurane overdose, and an index of adiposity (bilateral epididymal fat pad weight) measured.
- body composition (lean mass, fat mass) for each mouse can be analyzed using a Dual Energy X-ray Absorptiometry (DEXA) instrument per manufacturer's instructions (Lunar Piximus, GE Imaging System).
- DEXA Dual Energy X-ray Absorptiometry
- GIP hybrids particularly those comprising an exendin, PPF, PYY, GLPl, amylin and/or sCT portion having a potency in one of the assays described herein (preferably food intake, gastric emptying, pancreatic secretion, weight reduction or body composition assays) which is greater than the potency of a component peptide hormone in that same assay, can be identified.
- assays described herein preferably food intake, gastric emptying, pancreatic secretion, weight reduction or body composition assays
- compounds of the invention maybe used to treat hypotension.
- hybrids of the invention may be used to inhibit the secretion of ghrelin. Accordingly, compounds of the invention may be utilize this mechanism to treat or prevent ghrelin related disorders such as Prader-Willi syndrome, diabetes of all types and its complications, obesity, hyperphagia, hyperlipidemia, or other disorders associated with hypemutrition.
- ghrelin related disorders such as Prader-Willi syndrome, diabetes of all types and its complications, obesity, hyperphagia, hyperlipidemia, or other disorders associated with hypemutrition.
- such hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- Compounds of the invention may also be useful for potentiating, inducing, enhancing or restoring glucose responsivity in pancreatic islets or cells. These actions may be useful for treating or preventing conditions associated with metabolic disorders such as those described above and in U.S. patent application no. US2004/0228846. Assays for determining such activity are known in the art. For example, in published U.S. patent application no. US2004/0228846 (incorporated by reference in its entirety), assays are described for islet isolation and culture as well as determining fetal islet maturation.
- intestine-derived hormone peptides including pancreatic polypeptide (PP), neuropeptide Y (NPY), neuropeptide K (NPK), PYY, secretin, glucagon-like peptide-1 (GLP-I) and bombesin were purchased from Sigma.
- Collagenase type XI was obtained from Sigma.
- RPMI 1640 culture medium and fetal bovine serum were obtained from Gibco.
- a radioimmunoassay kit containing anti-insulin antibody [ 125 I]-RIA kit) was purchased from Linco, St Louis.
- Post-partem rat islets were obtained from P-02 year old rats.
- Adult rat islets were obtained from 6-8 week old rats.
- Fetal rat islets were obtained as follows. Pregnant female rats were sacrificed on pregnancy day E21. Fetuses were removed from the uterus. 10-14 pancreata were dissected from each litter and washed twice in Hanks buffer. The pancreata were pooled, suspended in 6 ml 1 mg/ml collagenase (Type XI, Sigma) and incubated at 37° C for 8-10 minutes with constant shaking. The digestion was stopped by adding 10 volumes of ice-cold Hanks buffer followed by three washes with Hanks buffer.
- the islets were then purified by Ficoll gradient and cultured in 10% fetal bovine serum (FBS)/RPMI medium with or without addition of 1 uM IBMX. At the end of five days, 20 islets were hand picked into each tube and assayed for static insulin release. Generally, islets were first washed with KRP buffer and then incubated with 1 ml of KRP buffer containing 3 mM (low) glucose for 30 minutes at 37° C. with constant shaking. After collecting the supernatant, the islets were then incubated with 17 mM (high) glucose for one hour at 37° C. The insulin released from low or high glucose stimulation were assayed by radioimmunoassay (RIA) using the [ 125 I]-RIA kit. E21 fetal islets were cultured for 5 days in the presence of 200 ng/ml PYY, PP, CCK, NPK, NPY, Secretin, GLP-I or Bombesin.
- RIA radioimmunoassay
- An exemplary in vivo assay is also provided using the Zucker Diabetic Fatty (ZDF) male rat, an inbred (>F30 Generations) rat model that spontaneously expresses diabetes in all fa/fa males fed a standard rodent diet Purina 5008.
- ZDF Zucker Diabetic Fatty
- Li ZDF fa-fa males, hyperglycemia begins to develop at about seven weeks of age and glucose levels (fed) typically reach 500 mg/DL by 10 to 11 weeks of age. Insulin levels (fed) are high during the development of diabetes. However, by 19 weeks of age insulin drops to about the level of lean control litter mates. Triglyceride and cholesterol levels of obese rats are normally higher than those of leans.
- Hybrids are also useful for the therapeutic and prophylactic treatment of neurological and nervous system disorders associated with neuronal loss or dysfunction, including, but not limited to, Parkinson's Disease, Alzheimer's Disease, Huntington's Disease, ALS, stroke, ADD, and neuropsychiatric syndromes, and to enhance or facilitate learning, memory and cognition in mammals.
- GIP hybrids containing an exendin or GLPl active portion, more specifically comprising at least the N- terminal 7-15 amino acids or analog thereof for example HSEGTFTSD (SEQ ID NO. 94).
- hybrid polypeptides include methods for reducing aluminum (Al) concentrations in the central nervous system (see U.S. Pat. 6,734,166, incorporated by reference in its entirety) for treating, preventing, or delay the onset of Alzheimer's disease.
- Assays for determining effects on Al are known in the art and can be found in US Pat 6,734,166 using diploid .and Ts mice. These mice were individually housed in Nalgene® brand metabolism or polypropylene cages and given three days to adjust to the cages before experimentation. Mice had free access to food (LabDiet® NIH Rat and Moust/Auto 6F5K52, St.
- mice were given daily subcutaneous injections of either active compound or saline. Mice were sacrificed at the end of day 13 for one experiment and day 3 for another, and samples were collected. Mice brain samples were weighted in clean teflon liners and prepared for analysis by microwave digestion in low trace element grade nitric acid. Samples were then analyzed for Al content using Inductively Coupled Plasma Mass Spectrometry (Nuttall et al., Annals of Clinical and Laboratory Science 25, 3, 264-271 (1995)). All tissue handling during analysis took place in a clean room environment utilizing HEPA air filtration systems to minimize background contamination.
- Hybrids of the invention are useful for prevention and treatment of nephropathy, including hypertensive and diabetic nephropathy, and nephropathy associated with insulin resistance and metabolic syndrome. Hybrids achieve these ends by, among other things, improving or preventing worsening of hypertension, endothelial function, renal function, and glomerulosclerosis.
- the invention provides a method for preventing or treating nephropathy, including hypertensive and diabetic nephropathy, or that related to insulin resistance, comprising administering a compound of the invention.
- Hybrids find further use for improving endothelial function in a patient having reduced vasodilatory capacity, or having glomerulosclerosis or any other reduction in glomerular flow. Such improvement in endothelial function serves both to reduce hypertension and to improve the function of the capillaries of the glomeruli.
- the molecules of the invention are useful to prevent progression of nephropathy to ESRD, to prevent, slow the progression of, treat or ameliorate proteinuria and/or glomerulosclerosis.
- Hybrids are useful for reducing the risk of suffering from, preventing, or treating cardiac arrhythmias.
- Hybrids can provide anti-arrhythmic effects in patients with cardiac ischemia, cardiac ischemia-reperfusion, and congestive heart failure.
- incretin GLP-I has been found to reduce cardiac injury and enhance recovery in patients with these disorders.
- Incretins, including GLP-I are glucose-dependent insulinotropic hormones. GLP-I and exendin effectively enhance peripheral glucose uptake without inducing dangerous hypoglycemia. They also strongly suppress glucagon secretion, independent of its insulinotropic action, and thereby powerfully reduce plasma free fatty acid (FFA) levels substantially more than can be accomplished with insulin.
- FFA plasma free fatty acid
- hybrids are useful for preventing and treating cardiac arrhythmias that reliably reduce injury associated with reperfusion and ischemia, and enhance patient recovery.
- hybrid treatment after acute stroke or hemorrhage preferably intravenous administration, provides a means for optimizing insulin secretion, increasing brain anabolism, enhancing insulin effectiveness by suppressing glucagon, and maintaining euglycemia or mild hypoglycemia with no risk of severe hypoglycemia or other adverse side effects.
- such GIP hybrids contain a GLP 1 or exendin portion.
- hybrids that are capable of lowering insulin resistance or increasing insulin sensitivity are useful to treat polycystic ovary syndrome (PCOS).
- Administering hybrids of the invention can reduce or prevent insulin resistance in a subject suffering from PCOS.
- hybrids prevent the onset of type-2 diabetes in a subject suffering from PCOS.
- Further hybrids can restore regular menses, ovulation, or fertility in a subject suffering from PCOS.
- GIP hybrids contain a GLPl or an exendin portion for binding and activating a GLPl receptor.
- the compounds of the invention can exhibit a broad range of biological activities, some related to their antisecretory and antimotility properties.
- the compounds may suppress gastrointestinal secretions by direct interaction with epithelial cells or, perhaps, by inhibiting secretion of hormones or neurotransmitters which stimulate intestinal secretion.
- Anti-secretory properties include inhibition of gastric and/or pancreatic secretions and can be useful in the treatment or prevention of diseases and disorders including gastritis, pancreatitis, Barrett's esophagus, and Gastroesophageal Reflux Disease, as well as conditions associated therewith including heartburn, heartburn accompanied by regurgitation of gastric/intestinal contents into the mouth or the lungs, difficulty in swallowing, coughing, intermittent wheezing and vocal cord inflammation (conditions associated with GERD), esophageal erosion, esophageal ulcer, esophageal stricture, Barrett's metaplasia (replacement of normal esophageal epithelium with abnormal epithelium), Barrett's espohageal adenocarcinoma, and pulmonary aspiration.
- diseases and disorders including gastritis, pancreatitis, Barrett's esophagus, and Gastroesophageal Reflux Disease, as well as conditions associated therewith
- GIP hybrids containing amylin and/or sCT portions can be useful for treating or preventing these diseases and conditions, such as Barrett's esophagus, Gastroesophageal Reflux Disease (GERD) and conditions associated therewith as disclosed herein.
- Such hybrids have particularly effective anti-secretory properties, such as inhibition of gastric acids, inhibition of bile acids, and inhibition of pancreatic enzymes.
- such hybrids can have a gastroprotective effect, which renders them particularly useful in the treatment or prevention of intestinal diseases and conditions and of Barrett's esophagus, and/or GERD and related or associated conditions as described herein.
- Compounds of the invention are useful in the treatment of any number of gastrointestinal disorders (see e.g., Harrison's Principles of Internal Medicine, McGraw-Hill Ihco, New York, 12th Ed.) that are associated with excess intestinal electrolyte and water secretion as well as decreased absorption, e.g., infectious diarrhea, inflammatory diarrhea, short bowel syndrome, or the diarrhea which typically occurs following surgical procedures, e.g., ileostomy.
- infectious diarrhea include, without limitation, acute viral diarrhea, acute bacterial diarrhea (e.g., salmonella, Campylobacter, and Clostridium or due to protozoal infections), or traveller's diarrhea (e.g., Norwalk virus or rotavirus).
- inflammatory diarrhea examples include, without limitation, malabsorption syndrome, tropical sprue, chronic pancreatitis, Crohn's disease, diarrhea, and irritable bowel syndrome. It has also been discovered that the peptides of the invention can be used to treat an emergency or life-threatening situation involving a gastrointestinal disorder, e.g., after surgery or due to cholera.
- Compounds of the invention may also be useful for treating or preventing intestinal, including gastrointestinal, damage as opposed to merely treating the symptoms associated with the intestinal damage (for example, diarrhea).
- Such damage to the intestine may be, or a result of, ulcerative colitis, inflammatory bowel disease, bowel atrophy, loss bowel mucosa, and/or loss of bowel mucosal function (see WO 03/105763, incorporated herein by reference in its entirety).
- Assays for such activity include 11 week old male HSD rats, ranging 250- 300 grams housed in a 12:12 light:dark cycle, and allowed ad libitum access to a standard rodent diet (Teklad LM 485, Madison, WT) and water. The animals were fasted for 24 hours before the experiment.
- a simple and reproducible rat model of chronic colonic inflammation has been previously described by Morris GP, et al., "Hapten- induced model of chronic inflammation and ulceration in the rat colon.” Gastroenterology. 1989; 96:795-803. It exhibits a relatively long duration of inflammation and ulceration, affording an opportunity to study the pathophysiology of colonic inflammatory disease in a specifically controlled fashion, and to evaluate new treatments potentially applicable to inflammatory bowel disease in humans.
- Rats were anesthetized with 3% isofluorane and placed on a regulated heating pad set at 37°C. A gavage needle was inserted rectally into the colon 7 cm. The hapten trinitrobenzenesulfonic acid (TNBS) dissolved in 50% ethanol (v/v) was delivered into the lumen of the colon through the gavage needle at a dose of 30 mg/kg, in a total volume of 0 0.4-0.6 mL, as described in Mazelin, et ah, "Protective role of vagal afferents in experimentally-induced colitis in rats.” Juton Nerv Syst. 73:38-45 (1998).
- TNBS hapten trinitrobenzenesulfonic acid
- Control groups received saline solution (NaCl 0.9%) intracolonically.
- saline solution NaCl 0.9%) intracolonically.
- the colon was resected from anesthetized rats, which were then euthanized by decapitation. Weights of excised colon and spleen were measured, and the colons photographed for scoring of gross morphologic damage. Inflammation was defined as regions of hyperemia and bowel wall thickening.
- GBP hybrids can be useful for treating or preventing pancreatitis, pancreatic carcinoma, and gastritis, particularly in the treatment and prevention of pancreatitis in patients who have undergone endoscopic retrograde cholangiopancreatography (ERCP).
- ERCP endoscopic retrograde cholangiopancreatography
- Amylin and/or sCT containing GIP hybrid agonists can have a surprisingly superior therapeutic effect when combined with somatostatin.
- methods for treating or preventing pancreatitis comprise administering such hybrids and administering somatostatin and somatostatin agonists to a subject.
- Hybrid polypeptides of the invention may also be used to treat or prevent Barrett's esophageal adenocarcinoma or pancreatic tumors (e.g., inhibit the proliferation of pancreatic tumors).
- Methods of the invention include reducing the proliferation of tumor cells.
- the types of benign pancreatic tumor cells which may be treated in accordance with the present invention include serous cyst adenomas, microcystic tumors, and solid-cystic tumors.
- the method is also effective in reducing the proliferation of malignant pancreatic tumor cells such as carcinomas arising from the ducts, acini, or islets of the pancreas.
- Particularly useful GIP hybrids in this regard are those comprising a hormone module component of the PYY or PPF family.
- U.S. Pat. 5,574,010 (incorporated by reference in its entirety) provides exemplary assays for testing antiproliferative properties.
- the OlO patent provides that PANC-I and MiaPaCa-2 are two human pancreatic adenocarcinoma cancer cell lines which are available commercially from suppliers such as American Type Culture Collection, ATCC (Rockville, Md.).
- the two tumor cells were grown in RPMI-1640 culture media supplemented with 10% fetal bovine serum, 29.2 mg/L of glutamine, 25 ⁇ g gentamicin, 5 ml penicillin, streptomycin, and fungizone solution (JRH Biosciences, Lenexa, Kans.) at 37 degrees Celcius in a NAPCO water jacketed 5 % CO 2 incubator. All cell lines were detached with 0.25 % trypsin (Clonetics, San Diego, Calif.) once to twice a week when a confluent monolayer of tumor cells was achieved.
- Control wells received 2 ul of 0.9% saline to mimic the volume and physical disturbance upon adhered tumor cells.
- Each 96 well plate contained 18 control wells to allow for comparison within each plate during experimentation.
- Ninety-six (96) well plates were repeated 6 times with varying concentrations of PYY and test compound in both the PANC-I and MiaPaCa-2 cells.
- An exemplary in vivo assay is also provided.
- the human pancreatic ductal adenocarcinoma Mia Paca-2 was examined for in vivo growth inhibition by peptide YY and test compound. Seventy thousand to 100,000 human Mia PaCa-2 cells were orthotopically transplanted into 48 male athymic mice. After one week, the animals were treated with either PYY or test compound at 200 pmol/kg/hr via mini-osmotic pumps for four weeks. The paired cultures received saline. At sacrifice, both tumor size and mass were measured. Control mice had significant human cancer growth within the pancreas as evidenced by histologic sections. At 9 weeks, ninety percent (90%) of control mice had substantial metastatic disease. Tumor mass was decreased by 60.5 % in test treated mice and 27% in PYY treated mice.
- hybrids are useful for decreasing bone resorption, decreasing plasma calcium, and/or inducing an analgesic effect, particularly to treat bone disorders such as osteopenia and osteoporosis.
- hybrids are useful to treat pain and painful neuropathy.
- such hybrids contain an exendin, GLPl, amylin and/or sCT portion.
- a GIP-sCT or GIP-amylin/sCT hybrid compound of the invention can have a selectable property of a salmon calcitonin or amylin/sCT/Amylin chimera, such as decreasing bone loss and bone resorption or reducing cartilage turnover (chondroprotection), and a property of a GIP, such as plasma glucose lowering (concomitant with an anti- catabolic aspect as described herein) and/or inhibiting bone resorption and maintaining or increasing bone density.
- a GIP hybrid with such selectable properties can enhance treatment of osteoporosis or conditions of high cartilage turnover, particularly in those who can also benefit from glycemic control, such as subjects with diabetes or under going critical care.
- GIP compounds particularly GP analogs, extended half-life GIP hybrids (e.g. DPP-IV cleavage resistant (such as a D-Ala2, N-Acetyl or N-pyroglutamyl analogs) optionally further comprising a peptidic enhancer such as a heterologous C-terminal tail, and GIP hybrids comprising other hormone modules known to provide beneficial cardiovascular effects, are useful to treat cardiovascular disease and related conditions.
- GIP compounds increase cardiac contractility (dP/dt), decrease blood pressure (for example by acute vasodilatation), decrease systolic pressure, decrease diastolic pressure, and can provide a direct beneficial action on cardiac cells.
- GIP compounds also improve cardiac function via metabolic actions, e.g. glucose lowering, insulin secretion, beta cell proliferation. By also providing direct effects on the cardiovascular system, the GIP compounds are surprisingly even more therapeutically beneficial.
- a GIP compound can be administered concurrently, sequentially or alternately with another agent.
- the cardiovascular disease or condition is hypertension (including stage 1, stage 2 and stage 3 hypertension, diastolic or systolic), pulmonary hypertension, congestive heart failure, cardiac insufficiency, reduced stroke volume, cardiomyopathy (dilated, hypertrophic or restrictive), decreased cardiac contractility, pulmonary congestion associated with cardiovascular conditions, pulmonary and systemic edema, decreased cardiac output, abnormal left ventricular function, diastolic blood pressure abnormalities, renal failure associated with decreased cardiac contractility, increased cardiovascular risk (e.g.
- systolic pressure associated with elevated systolic pressure accompanied by normal diastolic pressure, associated with elevated diastolic pressure accompanied by normal systolic pressure, associated with elevated diastolic and systolic pressure, associated with elevated mean arterial blood pressure
- non-ischemic or ischemic heart tissue degeneration such as from myocardial infarction
- the patient in need of treatment includes those who are diabetic (e.g. suffering from diabetic cardiomyopathy), obese, undergoing intensive care, undergoing surgery, or a combination thereof, or who are otherwise normal.
- the patient may have had or be at risk of having such a disease or condition.
- diabetic e.g. suffering from diabetic cardiomyopathy
- obese e.g. suffering from diabetic cardiomyopathy
- intensive care e.g., undergoing surgery, or a combination thereof
- a combination thereof e.g., a combination thereof.
- the patient may have had or be at risk of having such a disease or condition.
- patients post myocardial infarction that are in need of preventing further heart failure can benefit from the methods herein.
- Preventing a disease or condition includes preventing the initiation of, delaying the initiation of, preventing the progression or advancement of, slowing the progression or advancement of, delaying the progression or advancement of, and reversing the progression of the disease or condition from an advanced to a less advanced stage.
- the method provides treating or delaying the onset of such diseases or conditions.
- impaired contractility can decrease stroke volume which in turn can precipitate congestive heart failure.
- treating heart failure refers to treating any one or more of the conditions underlying heart failure, including, without limitation, decreased cardiac contractility, abnormal diastolic compliance, reduced stroke volume, high blood pressure, pulmonary congestion, and decreased cardiac output.
- a method for inducing an inotropic response for reducing blood pressure, for reducing diastolic pressure, for reducing diastolic pressure, increasing vasodilation, or a any combination of the above, with or without a concomitant beneficial metabolic action of a GIP such as glucose lowering, insulin secretion, or beta cell proliferation, comprising administration of a therapeutically effective amount of a GIP compound to provide such desired beneficial action.
- a GIP such as glucose lowering, insulin secretion, or beta cell proliferation
- Inotropic compounds are compounds that induce inotropic effects (e.g., increase of force of contraction of the heart) have been recognized as being useful for the treatment of, for example, congestive heart failure.
- Congestive heart failure which is one of the most common causes of death and disability in industrialized nations, has a mortality rate of about 50% at five years (Goodman and Gilman s The Pharmacological Basis of Therapeutics, 9th Ed. McGraw Hill, N. Y., pp. 809-838). Criteria, testing and guidelines as established by the American Heart Association (AHA) are suitable for diagnosing the cardiovascular diseases and conditions discussed herein.
- AHA American Heart Association
- GP compounds display a desired positive inotropic effect without a substantial, concomitant increase in blood pressure. Such blood pressure changes in subjects experiencing heart failure or cardiovascular disease or condition could cause further deterioration in heart function. In fact as demonstrated herein, GIP compounds can function to reduce blood pressure or the rate of change in blood pressure.
- inotropic agents can provide these benefits.
- GIP compounds of the invention arises from a lack of or reduced anorectic effect and an absence of or relatively insignificant nausea effect, which can be important in the patient populations discussed throughout.
- a peptidic enhancer such as an exendin tail
- ICU intensive care unit
- the methods are intended to benefit those patients in which the effect of GIP agonist analogs and hybrids to stimulate insulin secretion and incur the benefits associated with intensive insulin therapy (GIK therapy; glucose- insulin-potassium), without the hazards and complexity associated with insulin/glucose infusion and without the side effects reportedly associated with the use of some glucagon-like peptide-1 agonists.
- GIP can favorably affect a patient's metabolic state in addition to simply indirectly regulating glucose levels in response to digestion of food. Accordingly GIP compounds are useful to reduce the mortality and morbidity that occurs in critically ill patients.
- GIP compounds provide beneficial metabolic effects such as glucose lowering, insulin secretion and/or beta cell proliferation.
- GIP compounds also improve cardiac function by increasing cardiac contractility (dP/dt), decreasing blood pressure (for example by acute vasodilatation), and decreasing systolic pressure, decreasing diastolic pressure, and providing a direct beneficial action on cardiac cells. Since many critically ill patients have or are at risk for or are complicated by cardiovascular diseases or conditions, these cardiovascular effects can provided additional benefit. By also providing direct effects on the cardiovascular system, the GIP compounds, surprisingly, have added therapeutic value.
- a GIP compound can be administered concurrently, sequentially or alternately with another agent.
- the "intensive care unit” can be a part of a hospital where critically ill patients are treated, and of course may not officially bear the name "Intensive Care Unit".
- ICU also includes a nursing home a clinic, for example, a private clinic, or the like if the same or similar activities are performed there.
- a "critically ill patient” can be a patient who has sustained or are at risk of sustaining acutely life-threatening single or multiple organ system failure due to disease or injury, a patient who is being operated and where complications supervene, and a patient who has been operated in a vital organ within the last week or has been subject to major surgery within the last week.
- a critically ill patient can be a patient who needs vital organ support (either mechanically such as with mechanical ventilation or dialysis etc., or pharmacologically such as with inotropes or vasopressors) without which they would not survive.
- Expressions "critical care”, “intensive care” and “critically ill” are used interchangeably.
- Critically ill patients are those who generally experience an unstable metabolic state.
- This unstable metabolic state e.g. catabolic state
- a critically ill patient is a patient in need of cardiac surgery, cerebral surgery, thoracic surgery, abdominal surgery, vascular surgery, or transplantation, or a patient suffering from cerebral trauma, respiratory insufficiency, critical illness polyneuropathy, multiple traumas or severe burns, or a patient being mechanically ventilated.
- the critical care disease or condition is classified as medical, surgical (e.g. trauma) or coronary care, and further can be classified as sepsis and respiratory care. Of particular interest are those classifications, such as septic shock or myocardial infarction, for which GK. therapy would be warranted.
- Catabolic change e.g., loss of body weight
- ICU Intravenous lines that deliver calories in some form
- a Canadian study of nutritional support in ICU reported that typically only 58% of daily requirements were supplied and only 26% received parenteral nutrition.
- a critically ill patient in need of prevention or alleviating catabolic effects such as weigh loss
- a therapeutically effective amount of a GIP compound as provided herein to prevent or alleviate the catabolism.
- the critically ill patient in need of treatment includes patients who are non-diabetic patient (not diagnosed as having diabetes or prediabetes), diabetic, prediabetic, and/or obese. The patient may have had or be at risk of having the disease or conditions indicated.
- GEP compounds can minimize or avoid risks associated with GLP-I in invoking a GIK- like benefit.
- Slowing of gastric emptying can complicate the delivery of oral medicines, for example, by altering their kinetics, and decrease nutrient uptake; GLP-I agonists, amylin agonists, CCK agonists, and secretin agonists, for example, slow gastric emptying.
- doses of GIP compounds do not slow gastric emptying or show only a weak effect, and in any event much less so than GLPl and exendin 4. Typically such effect was blocked with a selective amylin antagonist, e.g.
- This fat-sparing effect is possibly attributable to an antilipolytic effect in adipocytes or to such effects as promotion of lipoprotein lipase, amplification of insulin signaling, and/or an increase of fatty acid incorporation into adipocyte lipid.
- 0601GIP3794 provided a slight decrease in percentage body fat with an increase in body protein without a concomitant reduction in body weight, indicating that body composition was affected. It is well recognized that loss of body energy stores predicts adverse outcomes in critical care whereas preservation of body energy stores promotes beneficial outcomes.
- GIP receptor mKNA has been detected in heart tissue, hormone binding in heart has not been detected to date.
- GIP binds to and activates cardiac myocytes and displays a positive inotropic effect in vivo.
- GIP compounds provide further benefit in patients with or at risk of compromised myocardium, and certain other conditions such as renal failure, independent of its insulinotropic action.
- the method includes administering to patients in need thereof a therapeutically effective amount of a GIP compound that provides a sparing of cardiac muscle, which otherwise tends to atrophy in catabolic states.
- the critical care patient has a disease or condition of catabolic change associated with a critical illness, sepsis, post-traumatic, post-surgical, post-shock, comatose patients, stress-induced hyperglycemia (for example after a vascular event), stroke, myocardial infarction, acute mesenteric ischemia, respiratory distress, ventilator dependency, renal failure, congestive heart failure, edema, hibernating myocardium, cardiomyopathies (ischemic, diabetic), lowering of BNP, ejection dysfunction, hypertension, polyneuropathy, ischemia/reperfusion injury (for example post-thrombolytic therapy, post cardiac surgery), histoprotection of organ beds, myocardial infarction (mortality, function, symptomatology), acute coronary syndrome (stable/unstable angina, non-Q wave infarct, ECG positive), disturbances of conduction or rhythm, papillary dysfunction, and/or pulmonary edema.
- stress-induced hyperglycemia
- the method comprises attenuating, ameliorating or reducing such disease or conditions including pre- or post-surgical catabolic changes, comprising, administering to a patient in need thereof a GIP compound.
- the GIP compound is designed to provide a therapeutic benefit, for example a benefit measured for example as a reduction in APACHE score, a reduction in mortality, a reduction in days in hospital, a reduction in need for readmission, a reduction in hospitalization costs.
- In one embodiment is a method for the treatment of a critically ill patient in need thereof, to prevent or decrease the incidence of blood stream infection, sepsis or septic shock, to reduce morbidity associated with the critical care, to reduce mortality (e.g.
- in-hospital mortality associated with the critical care, to prevent or decrease the incidence of prolonged inflammation, to prevent or decrease the incidence of acute renal failure and/or renal replacement therapy, to prevent or decrease the incidence of critical care polyneuropathy, to reduce the use of antibiotics, to prevent or decrease the incidence of immune-mediated destruction of the beta cells, to reduce the likelihood of disturbance in markers of inflammation and/or inflammatory responses, to prevent or decrease the incidence of systemic inflammatory response syndrome (SIRS), to reduce the amount of red cell transfusion, to reduce stress-induced hyperglycemia, to protect from cholestasis, to reduce the need for invasive treatment, to prevent or decrease the incidence of endoneural edema, to decrease dialysis or hemofiltration, to reduce or eliminate a need of vital organ system support, to allow at least about one third of the caloric need through the normal enteral route, to reduce the risk or likelihood of multiple organ failure, to reduce the risk or likelihood of multiple organ failure associated with sepsis or septic shock, to reduce the use of mechanical ventilatory support, to reduce the
- Critical care patients can include those suffering from respiratory distress in which the patient has difficulty breathing as a result of pulmonary dysfunction.
- the patient may exhibit varying degrees of hypoxemia that that may or may not be controlled with supplemental oxygen.
- Respiratory distress may occur in patients with impaired pulmonary function due to direct lung injury, such as from pneumonia, aspiration of gastric contents, pulmonary contusion, fat emboli, near-drowning, inhalation injury, high altitude and reperfusion pulmonary edema, or from indirect lung injury as from sepsis, severe trauma with shock and multiple transfusions, cardiopulmonary bypass, drug overdose, and acute pancreatitis.
- a critically ill patient may have a pulmonary disorders associated with chronic hypoxemia, which can result in raised pressure within the pulmonary circulation called pulmonary hypertension.
- a critically ill patient may have cor pulmonale, which is a failure of the right side of the heart caused by prolonged high blood pressure in the pulmonary artery and right ventricle of the heart.
- a critically ill patient may have acute respiratory distress syndrome (ARDS) or chronic obstructive pulmonary diseases (COPDs) which include emphysema and chronic bronchitis, which also cause respiratory distress.
- ARDS acute respiratory distress syndrome
- COPDs chronic obstructive pulmonary diseases
- the critical care patient is one who with a disturbed glucose metabolism such as insulin resistance but no overt diabetes, as well as a patient who for any reason cannot receive nutrition through the alimentary canal.
- a disturbed glucose metabolism such as insulin resistance but no overt diabetes
- Such patients include surgery patients, comatose patients, patients in shock, patients with gastrointestinal disease, patients with digestive hormone disease, and the like.
- obese patients atherosclerotic patients, vascular disease patients, patients with gestational diabetes, patients with liver disease such as liver cirrhosis, patients with acromegaly, patients with glucorticoid excess such as Cortisol treatment or Cushings disease, patients with activated counter-regulatory hormones such as would occur after trauma, accidents and surgery and the like
- patients with hypertriglyceridemia and patients with chronic pancreatitis can be readily and suitably nourished according to the invention without subjecting the patient to hypo- or hyperglycemia, while reducing undesirable catabolic changes and/or providing cardiovascular benefit.
- the administration of a GIP compound reduces morbidity or mortality in critically ill patients (who require intensive care) or the time they stay in the ICU.
- a reduction in morbidity means reducing the likelihood that the critically ill patient will develop additional illnesses, conditions, or symptoms or reducing the severity of additional illnesses, conditions or symptoms.
- reducing morbidity can be achieved by decreasing the incidence of bacteremia or sepsis or complications associated with multiple organ failure.
- a method for inducing an insulinotropic response for providing an anti- or non-catabolic effect (e.g. reducing a catabolic effect) or providing any one of the cardiovascular benefits discussed herein, or a any combination of the above, comprising administration of a therapeutically effective amount of a GIP compound to provide such desired beneficial action.
- the GIP compound includes GP and GDP analogs and hybrids, particularly novel GIP analogs as described herein, extended half-life GIP hybrids (e.g. DPP-IV cleavage resistant (such as a D-Ala2, N-Acetyl or N-pyroglutamyl analogs) optionally further comprising a peptidic enhancer such as a heterologous C- terminal tail, and GIP hybrids comprising at least one hormone module known to provide beneficial benefit to a patient undergoing critical or intensive care.
- GIP compounds of the invention particularly useful are the GP hybrids comprising a DPP-IV resistant GP analog with a peptidic enhancer such as an exendin tail (e.g.
- Compound G or GP hybrids comprising a GP analog and a amylin family or salmon calcitonin hormone module, which are additionally beneficial by their lack of or reduced anorectic effect while maintaining a desirable glucose lowering, insulinotropic and/or cardiovascular benefit.
- administering a GP compound reduces the problems associated with parenteral nourishment. Very often it is not possible to infuse a desired amount of glucose even to people with healthy metabolism without provoking hyperglycemia. This can be exacerbated in critical care patients. Insulin secretion during parenteral nourishment in the presence of a GP compound can be controlled such that the plasma glucose increase will be less than without the GP compound. Therefore more glucose can be delivered over a 24-hour period than otherwise. The calorie deficit seen with parenterally nourished patients can thus be better satisfied.
- a method for non-alimentary nutrition comprising administering by a parenteral route to a patient in need of parenteral nutrition, a nutritively effective amount of one or more nutrients selected from the group consisting of carbohydrates, ammo acids, lipids, free fatty acids, mono-or diglycerides, glycerol and any combination thereof; and a GP compound, wherein the administration of the nutrient(s) produces a blood glucose level in the patient of from about 80 to 180 mg glucose per deciliter of blood, and the rate of administration is calculated to deliver up to about 1000 g of glucose or its equivalent per patient per day.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Endocrinology (AREA)
- Urology & Nephrology (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Vascular Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Hospice & Palliative Care (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Emergency Medicine (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nutrition Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Abstract
Description
Claims
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2007284365A AU2007284365A1 (en) | 2006-08-17 | 2007-08-17 | DPP-IV resistant GIP hybrid polypeptides with selectable properties |
US12/377,856 US8497240B2 (en) | 2006-08-17 | 2007-08-17 | DPP-IV resistant GIP hybrid polypeptides with selectable properties |
EP07837095.4A EP2057188B1 (en) | 2006-08-17 | 2007-08-17 | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
JP2009524707A JP5399244B2 (en) | 2006-08-17 | 2007-08-17 | DPP-IV resistant GIP hybrid polypeptide with selectable properties |
CA002660835A CA2660835A1 (en) | 2006-08-17 | 2007-08-17 | Dpp-iv resistant gip hybrid polypeptides with selectable propperties |
US13/868,891 US20130281374A1 (en) | 2006-08-17 | 2013-04-23 | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US50708106A | 2006-08-17 | 2006-08-17 | |
US11/507,081 | 2006-08-17 |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US50708106A Continuation-In-Part | 2005-02-11 | 2006-08-17 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/868,891 Division US20130281374A1 (en) | 2006-08-17 | 2013-04-23 | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2008021560A2 true WO2008021560A2 (en) | 2008-02-21 |
WO2008021560A3 WO2008021560A3 (en) | 2008-07-10 |
Family
ID=38926291
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2007/018415 WO2008021560A2 (en) | 2006-08-17 | 2007-08-17 | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP2057188B1 (en) |
JP (2) | JP5399244B2 (en) |
AU (1) | AU2007284365A1 (en) |
CA (1) | CA2660835A1 (en) |
WO (1) | WO2008021560A2 (en) |
Cited By (72)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009021740A2 (en) | 2007-08-15 | 2009-02-19 | Sanofis-Aventis | Substituted tetrahydronaphthalenes, process for the preparation thereof and the use thereof as medicaments |
WO2010071807A1 (en) * | 2008-12-19 | 2010-06-24 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
WO2011107494A1 (en) | 2010-03-03 | 2011-09-09 | Sanofi | Novel aromatic glycoside derivatives, medicaments containing said compounds, and the use thereof |
DE102010015123A1 (en) | 2010-04-16 | 2011-10-20 | Sanofi-Aventis Deutschland Gmbh | New benzylamidic diphenylazetidinone compounds, useful for treating lipid disorders, hyperlipidemia, atherosclerotic manifestations or insulin resistance, and for reducing serum cholesterol levels |
WO2011157827A1 (en) | 2010-06-18 | 2011-12-22 | Sanofi | Azolopyridin-3-one derivatives as inhibitors of lipases and phospholipases |
WO2011161030A1 (en) | 2010-06-21 | 2011-12-29 | Sanofi | Heterocyclic substituted methoxyphenyl derivatives having an oxo group, method for producing same, and use thereof as gpr40 receptor modulators |
WO2012004269A1 (en) | 2010-07-05 | 2012-01-12 | Sanofi | (2-aryloxy-acetylamino)-phenyl-propionic acid derivatives, method for producing same and use thereof as pharmaceuticals |
WO2012004270A1 (en) | 2010-07-05 | 2012-01-12 | Sanofi | Spirocyclically substituted 1,3-propane dioxide derivatives, methods for the production thereof and use of the same as medicament |
WO2012010413A1 (en) | 2010-07-05 | 2012-01-26 | Sanofi | Aryloxy-alkylene substituted hydroxyphenyl hexynoic acids, methods for the production thereof and use of the same as medicament |
AU2009280012B2 (en) * | 2008-08-07 | 2012-12-06 | Ipsen Pharma S.A.S. | Truncated analogues of glucose-dependent insulinotropic polypeptide |
US8338368B2 (en) | 2005-11-07 | 2012-12-25 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
AU2009280017B2 (en) * | 2008-08-07 | 2013-01-10 | Ipsen Pharma S.A.S. | Analogues of glucose-dependent insulinotropic polypeptide |
EP2567959A1 (en) | 2011-09-12 | 2013-03-13 | Sanofi | 6-(4-Hydroxy-phenyl)-3-styryl-1H-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
WO2013037390A1 (en) | 2011-09-12 | 2013-03-21 | Sanofi | 6-(4-hydroxy-phenyl)-3-styryl-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
WO2013045413A1 (en) | 2011-09-27 | 2013-04-04 | Sanofi | 6-(4-hydroxy-phenyl)-3-alkyl-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
US8481485B2 (en) | 2008-12-19 | 2013-07-09 | Indiana University Research And Technology Corporation | Insulin analogs |
JP2014028843A (en) * | 2008-08-07 | 2014-02-13 | Ipsen Pharma Sas | Glucose-dependent insulinotropic polypeptide analogues |
JP2014051501A (en) * | 2008-08-07 | 2014-03-20 | Ipsen Pharma Sas | Analogues of glucose-dependent insulinotropic polypeptide (gip) modified at n-terminal |
US8697632B2 (en) | 2008-12-19 | 2014-04-15 | Indiana University Research And Technology Corporation | Amide based insulin prodrugs |
US8697838B2 (en) | 2008-01-30 | 2014-04-15 | Indiana University Research And Technology Corporation | Ester-based insulin prodrugs |
US8822413B2 (en) | 2007-07-06 | 2014-09-02 | Theratechnologies Inc. | Bifunctional hormone having alpha-MSH activity and natriuretic peptide activity and uses thereof |
US8859491B2 (en) | 2011-11-17 | 2014-10-14 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
US8895498B2 (en) | 2005-02-11 | 2014-11-25 | Astrazeneca Pharmaceuticals, Lp | GIP and exendin hybrid polypeptides |
US8900593B2 (en) | 2007-02-15 | 2014-12-02 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US8940860B2 (en) | 2010-06-16 | 2015-01-27 | Indiana University Research And Technology Corporation | Single-chain insulin agonists exhibiting high activity at the insulin receptor |
US8946147B2 (en) | 2010-06-24 | 2015-02-03 | Indiana University Research And Technology Corporation | Amide-based insulin prodrugs |
TWI474835B (en) * | 2008-06-17 | 2015-03-01 | Univ Indiana Res & Tech Corp | Gip-based mixed agonists for treatment of metabolic disorders and obesity |
US8981047B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Glucagon antagonists |
US9023986B2 (en) | 2010-10-25 | 2015-05-05 | Hoffmann-La Roche Inc. | Glucose-dependent insulinotropic peptide analogs |
WO2015095719A1 (en) * | 2013-12-20 | 2015-06-25 | The Regents Of The University Of California | Anti-obesity compounds derived from neuromedin u |
US9133260B2 (en) | 2005-02-11 | 2015-09-15 | Amylin Pharmaceuticals, Llc | GIP analog and hybrid polypeptides with selectable properties |
US9156902B2 (en) | 2011-06-22 | 2015-10-13 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US9200051B2 (en) | 2013-05-28 | 2015-12-01 | Takeda Pharmaceutical Company Limited | Peptide compound |
US9249206B2 (en) | 2010-12-22 | 2016-02-02 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
US9309301B2 (en) | 2011-06-22 | 2016-04-12 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US9487571B2 (en) | 2010-01-27 | 2016-11-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
US9526764B2 (en) | 2008-10-17 | 2016-12-27 | Sanofi-Aventis Deutschland Gmbh | Combination of an insulin and a GLP-1-agonist |
US9573987B2 (en) | 2011-12-20 | 2017-02-21 | Indiana University Research And Technology Corporation | CTP-based insulin analogs for treatment of diabetes |
US9593156B2 (en) | 2012-09-26 | 2017-03-14 | Indiana University Research And Technology Corporation | Insulin analog dimers |
US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
US9707176B2 (en) | 2009-11-13 | 2017-07-18 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist and methionine |
US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
US9783592B2 (en) | 2010-05-13 | 2017-10-10 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
US9821032B2 (en) | 2011-05-13 | 2017-11-21 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin |
US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
US9950039B2 (en) | 2014-12-12 | 2018-04-24 | Sanofi-Aventis Deutschland Gmbh | Insulin glargine/lixisenatide fixed ratio formulation |
US9981013B2 (en) | 2010-08-30 | 2018-05-29 | Sanofi-Aventis Deutschland Gmbh | Use of AVE0010 for the treatment of diabetes mellitus type 2 |
US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
US9987332B2 (en) | 2011-09-01 | 2018-06-05 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition for use in the treatment of a neurodegenerative disease |
US10029011B2 (en) | 2009-11-13 | 2018-07-24 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist, an insulin and methionine |
WO2018181864A1 (en) | 2017-03-31 | 2018-10-04 | Takeda Pharmaceutical Company Limited | Gip receptor activating peptide |
US10159713B2 (en) | 2015-03-18 | 2018-12-25 | Sanofi-Aventis Deutschland Gmbh | Treatment of type 2 diabetes mellitus patients |
US10232020B2 (en) | 2014-09-24 | 2019-03-19 | Indiana University Research And Technology Corporation | Incretin-insulin conjugates |
US10294303B2 (en) | 2015-12-23 | 2019-05-21 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using binding proteins for gastric inhibitory peptide receptor (GIPR) in combination with GLP-1 agonists |
US10385107B2 (en) | 2014-09-24 | 2019-08-20 | Indiana Univeresity Researc and Technology Corporation | Lipidated amide-based insulin prodrugs |
CN110151973A (en) * | 2019-04-25 | 2019-08-23 | 上海交通大学医学院附属瑞金医院 | A kind of application of biologically active polypeptide PACAP |
US10434147B2 (en) | 2015-03-13 | 2019-10-08 | Sanofi-Aventis Deutschland Gmbh | Treatment type 2 diabetes mellitus patients |
WO2019207505A1 (en) * | 2018-04-25 | 2019-10-31 | Janssen Pharmaceutica Nv | Glucagon like peptide 1 (glp-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof |
US10501516B2 (en) | 2016-05-24 | 2019-12-10 | Takeda Pharmaceutical Company Limited | Peptide compound |
US10696726B2 (en) | 2013-03-14 | 2020-06-30 | Indiana University Research And Technology Corporation | Insulin-incretin conjugates |
US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
US10875902B2 (en) | 2018-04-25 | 2020-12-29 | Janssen Pharmaceutica Nv | Glucagon like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof |
US10905772B2 (en) | 2017-01-17 | 2021-02-02 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using GLP-1 receptor agonists conjugated to antagonists for gastric inhibitory peptide receptor (GIPR) |
WO2021193983A3 (en) * | 2020-03-25 | 2021-11-04 | Takeda Pharmaceutical Company Limited | Gif receptor agonist peptide compounds and uses thereof |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2558155T3 (en) | 2007-10-30 | 2016-02-02 | Indiana University Research And Technology Corporation | Compounds showing glucacon antagonist activity and GLP-1 agonist |
BR112012028707A2 (en) | 2010-05-13 | 2019-09-24 | Univ Indiana Res & Tech Corp | glucagon compound of the peptide superfamily exhibiting g receptor activity with coupled protein, prodrug, dimer or multimer, pharmaceutical composition comprising it and method of administration thereof. |
PL2707017T3 (en) * | 2011-05-13 | 2016-03-31 | Sanofi Aventis Deutschland | Lixisenatide and metformin for treatment of diabetes type 2 |
RU2015101697A (en) | 2012-06-21 | 2016-08-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | GLUCAGON ANALOGUES WITH GIP RECEPTOR ACTIVITY |
WO2014064811A1 (en) * | 2012-10-25 | 2014-05-01 | 国立大学法人 東京医科歯科大学 | Pulmonary hypertension therapeutic agent |
WO2018220123A1 (en) | 2017-05-31 | 2018-12-06 | University Of Copenhagen | Long-acting gip peptide analogues |
EA202092269A1 (en) * | 2018-03-23 | 2020-12-14 | Кармот Терапьютикс, Инк. | G-PROTEIN-COUPLED RECEPTOR MODULATORS |
WO2022139552A1 (en) * | 2020-12-24 | 2022-06-30 | 한미약품 주식회사 | Combination therapy of insulinotropic peptide and glp-2, for preventing or treating short bowel syndrome |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005077072A2 (en) * | 2004-02-11 | 2005-08-25 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
WO2005082928A2 (en) * | 2004-02-25 | 2005-09-09 | University Of Ulster | Peptide analogues of gip for treatment of diabetes, insulin resistance and obesity |
WO2006086769A2 (en) * | 2005-02-11 | 2006-08-17 | Amylin Pharmaceuticals, Inc. | Gip analog and hybrid polypeptides with selectable properties |
WO2007022123A2 (en) * | 2005-08-11 | 2007-02-22 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
-
2007
- 2007-08-17 CA CA002660835A patent/CA2660835A1/en not_active Abandoned
- 2007-08-17 JP JP2009524707A patent/JP5399244B2/en not_active Expired - Fee Related
- 2007-08-17 EP EP07837095.4A patent/EP2057188B1/en not_active Not-in-force
- 2007-08-17 AU AU2007284365A patent/AU2007284365A1/en not_active Abandoned
- 2007-08-17 WO PCT/US2007/018415 patent/WO2008021560A2/en active Application Filing
-
2013
- 2013-10-23 JP JP2013220531A patent/JP2014058528A/en active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005077072A2 (en) * | 2004-02-11 | 2005-08-25 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
WO2005082928A2 (en) * | 2004-02-25 | 2005-09-09 | University Of Ulster | Peptide analogues of gip for treatment of diabetes, insulin resistance and obesity |
WO2006086769A2 (en) * | 2005-02-11 | 2006-08-17 | Amylin Pharmaceuticals, Inc. | Gip analog and hybrid polypeptides with selectable properties |
WO2007022123A2 (en) * | 2005-08-11 | 2007-02-22 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
Non-Patent Citations (2)
Title |
---|
GALLWITZ BAPTIST ET AL: "GLP-1/GIP chimeric peptides define the structural requirements for specific ligand-receptor interaction of GLP-1" REGULATORY PEPTIDES, ELSEVIER SCIENCE BV, NL, vol. 63, no. 1, 1 January 1996 (1996-01-01), pages 17-22, XP002387301 ISSN: 0167-0115 * |
HINKE SIMON A ET AL: "In depth analysis of the N-terminal bioactive domain of gastric inhibitory polypeptide" LIFE SCIENCES, PERGAMON PRESS, OXFORD, GB, vol. 75, no. 15, 27 August 2004 (2004-08-27), pages 1857-1870, XP002387302 ISSN: 0024-3205 * |
Cited By (99)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9133260B2 (en) | 2005-02-11 | 2015-09-15 | Amylin Pharmaceuticals, Llc | GIP analog and hybrid polypeptides with selectable properties |
US8895498B2 (en) | 2005-02-11 | 2014-11-25 | Astrazeneca Pharmaceuticals, Lp | GIP and exendin hybrid polypeptides |
US9018164B2 (en) | 2005-11-07 | 2015-04-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
US8338368B2 (en) | 2005-11-07 | 2012-12-25 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
US9447162B2 (en) | 2007-02-15 | 2016-09-20 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US8900593B2 (en) | 2007-02-15 | 2014-12-02 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US8822413B2 (en) | 2007-07-06 | 2014-09-02 | Theratechnologies Inc. | Bifunctional hormone having alpha-MSH activity and natriuretic peptide activity and uses thereof |
WO2009021740A2 (en) | 2007-08-15 | 2009-02-19 | Sanofis-Aventis | Substituted tetrahydronaphthalenes, process for the preparation thereof and the use thereof as medicaments |
US8981047B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Glucagon antagonists |
US8697838B2 (en) | 2008-01-30 | 2014-04-15 | Indiana University Research And Technology Corporation | Ester-based insulin prodrugs |
US9089539B2 (en) | 2008-01-30 | 2015-07-28 | Indiana University Research And Technology Corporation | Ester-based insulin prodrugs |
US9062124B2 (en) | 2008-06-17 | 2015-06-23 | Indiana University Research And Technology Corporation | GIP-based mixed agonists for treatment of metabolic disorders and obesity |
TWI474835B (en) * | 2008-06-17 | 2015-03-01 | Univ Indiana Res & Tech Corp | Gip-based mixed agonists for treatment of metabolic disorders and obesity |
US8450266B2 (en) | 2008-08-07 | 2013-05-28 | Ipsen Pharma S.A.S. | Analogues of glucose-dependent insulinotropic polypeptide |
US9072703B2 (en) | 2008-08-07 | 2015-07-07 | Ipsen Pharma S.A.S. | Glucose-dependent insulinotropic polypeptide analogues |
AU2009280012B2 (en) * | 2008-08-07 | 2012-12-06 | Ipsen Pharma S.A.S. | Truncated analogues of glucose-dependent insulinotropic polypeptide |
US9074014B2 (en) | 2008-08-07 | 2015-07-07 | Ipsen Pharma S.A.S. | Analogues of glucose-dependent insulinotropic polypeptide |
JP2014028846A (en) * | 2008-08-07 | 2014-02-13 | Ipsen Pharma Sas | Glucose-dependent insulinotropic polypeptide analogues |
JP2014028843A (en) * | 2008-08-07 | 2014-02-13 | Ipsen Pharma Sas | Glucose-dependent insulinotropic polypeptide analogues |
JP2014051501A (en) * | 2008-08-07 | 2014-03-20 | Ipsen Pharma Sas | Analogues of glucose-dependent insulinotropic polypeptide (gip) modified at n-terminal |
JP2014051505A (en) * | 2008-08-07 | 2014-03-20 | Ipsen Pharma Sas | Truncated analogues of glucose-dependent insulinotropic polypeptide |
JP2016175892A (en) * | 2008-08-07 | 2016-10-06 | イプセン ファルマ ソシエテ パール アクシオン サンプリフィエIpsen Pharma S.A.S. | Glucose dependent insulinotropic polypeptide (gip) analogs modified at n-terminal |
AU2009280017B2 (en) * | 2008-08-07 | 2013-01-10 | Ipsen Pharma S.A.S. | Analogues of glucose-dependent insulinotropic polypeptide |
US10117909B2 (en) | 2008-10-17 | 2018-11-06 | Sanofi-Aventis Deutschland Gmbh | Combination of an insulin and a GLP-1 agonist |
US9526764B2 (en) | 2008-10-17 | 2016-12-27 | Sanofi-Aventis Deutschland Gmbh | Combination of an insulin and a GLP-1-agonist |
CN102325539A (en) * | 2008-12-19 | 2012-01-18 | 印第安纳大学研究及科技有限公司 | Amide based glucagon superfamily peptide prodrugs |
US8697632B2 (en) | 2008-12-19 | 2014-04-15 | Indiana University Research And Technology Corporation | Amide based insulin prodrugs |
US8481485B2 (en) | 2008-12-19 | 2013-07-09 | Indiana University Research And Technology Corporation | Insulin analogs |
US8969288B2 (en) | 2008-12-19 | 2015-03-03 | Indiana University Research And Technology Corporation | Amide based glucagon and superfamily peptide prodrugs |
RU2550696C2 (en) * | 2008-12-19 | 2015-05-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Amide-based prodrugs of glucagon superfamily peptides |
WO2010071807A1 (en) * | 2008-12-19 | 2010-06-24 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
US9707176B2 (en) | 2009-11-13 | 2017-07-18 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist and methionine |
US10029011B2 (en) | 2009-11-13 | 2018-07-24 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist, an insulin and methionine |
US9487571B2 (en) | 2010-01-27 | 2016-11-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
WO2011107494A1 (en) | 2010-03-03 | 2011-09-09 | Sanofi | Novel aromatic glycoside derivatives, medicaments containing said compounds, and the use thereof |
DE102010015123A1 (en) | 2010-04-16 | 2011-10-20 | Sanofi-Aventis Deutschland Gmbh | New benzylamidic diphenylazetidinone compounds, useful for treating lipid disorders, hyperlipidemia, atherosclerotic manifestations or insulin resistance, and for reducing serum cholesterol levels |
US9783592B2 (en) | 2010-05-13 | 2017-10-10 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
US9458220B2 (en) | 2010-06-16 | 2016-10-04 | Indiana University Research And Technology Corporation | Single-chain insulin agonists exhibiting high activity at the insulin receptor |
US10233225B2 (en) | 2010-06-16 | 2019-03-19 | Indiana University Research And Technology Corporation | Single chain insulin agonists exhibiting high activity at the insulin receptor |
US8940860B2 (en) | 2010-06-16 | 2015-01-27 | Indiana University Research And Technology Corporation | Single-chain insulin agonists exhibiting high activity at the insulin receptor |
WO2011157827A1 (en) | 2010-06-18 | 2011-12-22 | Sanofi | Azolopyridin-3-one derivatives as inhibitors of lipases and phospholipases |
WO2011161030A1 (en) | 2010-06-21 | 2011-12-29 | Sanofi | Heterocyclic substituted methoxyphenyl derivatives having an oxo group, method for producing same, and use thereof as gpr40 receptor modulators |
US8946147B2 (en) | 2010-06-24 | 2015-02-03 | Indiana University Research And Technology Corporation | Amide-based insulin prodrugs |
WO2012010413A1 (en) | 2010-07-05 | 2012-01-26 | Sanofi | Aryloxy-alkylene substituted hydroxyphenyl hexynoic acids, methods for the production thereof and use of the same as medicament |
WO2012004270A1 (en) | 2010-07-05 | 2012-01-12 | Sanofi | Spirocyclically substituted 1,3-propane dioxide derivatives, methods for the production thereof and use of the same as medicament |
WO2012004269A1 (en) | 2010-07-05 | 2012-01-12 | Sanofi | (2-aryloxy-acetylamino)-phenyl-propionic acid derivatives, method for producing same and use thereof as pharmaceuticals |
US9981013B2 (en) | 2010-08-30 | 2018-05-29 | Sanofi-Aventis Deutschland Gmbh | Use of AVE0010 for the treatment of diabetes mellitus type 2 |
US9023986B2 (en) | 2010-10-25 | 2015-05-05 | Hoffmann-La Roche Inc. | Glucose-dependent insulinotropic peptide analogs |
US9249206B2 (en) | 2010-12-22 | 2016-02-02 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
US9821032B2 (en) | 2011-05-13 | 2017-11-21 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin |
US9156902B2 (en) | 2011-06-22 | 2015-10-13 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US10730923B2 (en) | 2011-06-22 | 2020-08-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US9309301B2 (en) | 2011-06-22 | 2016-04-12 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US10174093B2 (en) | 2011-06-22 | 2019-01-08 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US9987332B2 (en) | 2011-09-01 | 2018-06-05 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition for use in the treatment of a neurodegenerative disease |
EP2567959A1 (en) | 2011-09-12 | 2013-03-13 | Sanofi | 6-(4-Hydroxy-phenyl)-3-styryl-1H-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
WO2013037390A1 (en) | 2011-09-12 | 2013-03-21 | Sanofi | 6-(4-hydroxy-phenyl)-3-styryl-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
WO2013045413A1 (en) | 2011-09-27 | 2013-04-04 | Sanofi | 6-(4-hydroxy-phenyl)-3-alkyl-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
US8859491B2 (en) | 2011-11-17 | 2014-10-14 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
US9573987B2 (en) | 2011-12-20 | 2017-02-21 | Indiana University Research And Technology Corporation | CTP-based insulin analogs for treatment of diabetes |
US9593156B2 (en) | 2012-09-26 | 2017-03-14 | Indiana University Research And Technology Corporation | Insulin analog dimers |
US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
US9745360B2 (en) | 2012-12-21 | 2017-08-29 | Sanofi | Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists |
US10253079B2 (en) | 2012-12-21 | 2019-04-09 | Sanofi | Functionalized Exendin-4 derivatives |
US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
US10696726B2 (en) | 2013-03-14 | 2020-06-30 | Indiana University Research And Technology Corporation | Insulin-incretin conjugates |
US10087229B2 (en) | 2013-05-28 | 2018-10-02 | Takeda Pharmaceutical Company Limited | Peptide compound |
US9200051B2 (en) | 2013-05-28 | 2015-12-01 | Takeda Pharmaceutical Company Limited | Peptide compound |
US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
US10155798B2 (en) | 2013-12-20 | 2018-12-18 | The Regents Of The University Of California | Anti-obesity compounds derived from neuromedin U |
WO2015095719A1 (en) * | 2013-12-20 | 2015-06-25 | The Regents Of The University Of California | Anti-obesity compounds derived from neuromedin u |
US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
US10385107B2 (en) | 2014-09-24 | 2019-08-20 | Indiana Univeresity Researc and Technology Corporation | Lipidated amide-based insulin prodrugs |
US10232020B2 (en) | 2014-09-24 | 2019-03-19 | Indiana University Research And Technology Corporation | Incretin-insulin conjugates |
US9950039B2 (en) | 2014-12-12 | 2018-04-24 | Sanofi-Aventis Deutschland Gmbh | Insulin glargine/lixisenatide fixed ratio formulation |
US10434147B2 (en) | 2015-03-13 | 2019-10-08 | Sanofi-Aventis Deutschland Gmbh | Treatment type 2 diabetes mellitus patients |
US10159713B2 (en) | 2015-03-18 | 2018-12-25 | Sanofi-Aventis Deutschland Gmbh | Treatment of type 2 diabetes mellitus patients |
US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
US10294303B2 (en) | 2015-12-23 | 2019-05-21 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using binding proteins for gastric inhibitory peptide receptor (GIPR) in combination with GLP-1 agonists |
US11046774B2 (en) | 2015-12-23 | 2021-06-29 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using binding proteins for gastric inhibitory peptide receptor (GIPR) in combination with GLP-1 agonists |
US10501516B2 (en) | 2016-05-24 | 2019-12-10 | Takeda Pharmaceutical Company Limited | Peptide compound |
US10905772B2 (en) | 2017-01-17 | 2021-02-02 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using GLP-1 receptor agonists conjugated to antagonists for gastric inhibitory peptide receptor (GIPR) |
WO2018181864A1 (en) | 2017-03-31 | 2018-10-04 | Takeda Pharmaceutical Company Limited | Gip receptor activating peptide |
US10435445B2 (en) | 2017-03-31 | 2019-10-08 | Takeda Pharmaceutical Company Limited | Peptide compound |
US11174301B2 (en) | 2017-03-31 | 2021-11-16 | Takeda Pharmaceutical Company Limited | Peptide compound |
WO2019207505A1 (en) * | 2018-04-25 | 2019-10-31 | Janssen Pharmaceutica Nv | Glucagon like peptide 1 (glp-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof |
US10875902B2 (en) | 2018-04-25 | 2020-12-29 | Janssen Pharmaceutica Nv | Glucagon like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof |
US11780900B2 (en) | 2018-04-25 | 2023-10-10 | Janssen Sciences Ireland Unlimited Company | Glucagon like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof |
CN110151973A (en) * | 2019-04-25 | 2019-08-23 | 上海交通大学医学院附属瑞金医院 | A kind of application of biologically active polypeptide PACAP |
WO2021193983A3 (en) * | 2020-03-25 | 2021-11-04 | Takeda Pharmaceutical Company Limited | Gif receptor agonist peptide compounds and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
EP2057188A2 (en) | 2009-05-13 |
WO2008021560A3 (en) | 2008-07-10 |
JP2014058528A (en) | 2014-04-03 |
CA2660835A1 (en) | 2008-02-21 |
AU2007284365A2 (en) | 2009-07-16 |
JP2010500996A (en) | 2010-01-14 |
EP2057188B1 (en) | 2013-07-31 |
JP5399244B2 (en) | 2014-01-29 |
AU2007284365A1 (en) | 2008-02-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP2057188B1 (en) | Dpp-iv resistant gip hybrid polypeptides with selectable properties | |
US8895498B2 (en) | GIP and exendin hybrid polypeptides | |
US8497240B2 (en) | DPP-IV resistant GIP hybrid polypeptides with selectable properties | |
US9133260B2 (en) | GIP analog and hybrid polypeptides with selectable properties | |
US9453063B2 (en) | Hybrid polypeptides with selectable properties | |
EP1922336B1 (en) | Hybrid polypeptides with selectable properties | |
MX2008002028A (en) | Hybrid polypeptides with selectable properties. | |
EP2330125A2 (en) | Hybrid polypeptides with selectable properties |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07837095 Country of ref document: EP Kind code of ref document: A2 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2660835 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009524707 Country of ref document: JP |
|
NENP | Non-entry into the national phase in: |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007284365 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007837095 Country of ref document: EP |
|
NENP | Non-entry into the national phase in: |
Ref country code: RU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1770/DELNP/2009 Country of ref document: IN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12377856 Country of ref document: US |