WO2007123498A2 - MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE - Google Patents

MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE Download PDF

Info

Publication number
WO2007123498A2
WO2007123498A2 PCT/SI2007/000007 SI2007000007W WO2007123498A2 WO 2007123498 A2 WO2007123498 A2 WO 2007123498A2 SI 2007000007 W SI2007000007 W SI 2007000007W WO 2007123498 A2 WO2007123498 A2 WO 2007123498A2
Authority
WO
WIPO (PCT)
Prior art keywords
gene
fragment
pfkl
protein
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/SI2007/000007
Other languages
French (fr)
Other versions
WO2007123498A8 (en
WO2007123498A3 (en
Inventor
Matic Legisa
Mojca Bencina
Gregor Tevz
Maja Capuder
Tina Mlakar
Darija Oven
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Kemijski Institut
Original Assignee
Kemijski Institut
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Kemijski Institut filed Critical Kemijski Institut
Priority to BRPI0710863-0A priority Critical patent/BRPI0710863A2/en
Priority to US12/298,269 priority patent/US7807404B2/en
Priority to EP07709552.9A priority patent/EP2010651B1/en
Publication of WO2007123498A2 publication Critical patent/WO2007123498A2/en
Publication of WO2007123498A3 publication Critical patent/WO2007123498A3/en
Anticipated expiration legal-status Critical
Publication of WO2007123498A8 publication Critical patent/WO2007123498A8/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10—Transferases (2.)
    • C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1205—Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/01—Phosphotransferases with an alcohol group as acceptor (2.7.1)
    • C12Y207/01011—6-Phosphofructokinase (2.7.1.11)

Definitions

  • the subject of the invention is mutated truncated mt-pflcA gene encoding the synthesis of an active shorter fragment of 6-phosphofructo-l -kinase (PFKl), with no posttranslational modification needed to induce the activity.
  • the subject of the invention is the use of mutated truncated gene and its protein product for enhancing the rate of cell biomass synthesis and excretion of extracellular enzymes, as well as increasing the productivity of primary and secondary metabolites.
  • the invention is in the field of microbial biotechnology and biochemistry.
  • TCA tricarboxylic cycle
  • PFKl 6-phosphofructo-l -kinase
  • the enzyme is regulated by the feed back mechanism, by citrate and ATP inhibition. In other words its activity decreases when citric acid level, as an important intermediate of TCA cycle and ATP, as the final product of oxidative phosphorylation, increase over a certain level (Voet and Voet, 1995).
  • negative regulation of the enzyme activity diminishes the effectiveness of anapletoric reactions and consequently reduces the rate of synthesis of the final products.
  • a significant increase in the rate of product formation could be achieved by having undisturbed metabolic flow through glycolysis, which could be done by inserting a modified gene encoding PFKl enzyme that would be resistant to citrate inhibition but sensitive to activation with specific effectors.
  • Aspergillus niger cells were subjected to mutations in order to make the enzyme resistant to citrate inhibition.
  • a mutant was isolated that showed reduced inhibition by citrate, however the enzyme retained only 20% of its maximal velocity when inhibitor was present at slightly increased concentration of 10 mM.
  • a partially increased resistance toward the citrate inhibition had no positive effect on elevating the rate of product formation (Schreferl et al., 1986).
  • reduced inhibition by citrate of PFKl was obtained by cleaving 8 amino acid residues from the C-terminal part of the enzyme, isolated from the rabbit muscle. Modified enzyme has lost its activity only when 10 mM of citrate was present in the system, while the original enzyme was completely inactivated at 2.5 mM of inhibitor (Valaitis et al., 1987).
  • PFKl isolated from Aspergillus niger cells showed more resistance toward the citrate inhibition in comparison to the enzymes from other organisms, yet 1OmM of citrate almost prevented its catalytic activity.
  • Physiological concentration of citric acid in normal cells is in mM values, however in A. niger cells the citrate concentration can reach up to 10 mM (Legisa and Kidric, 1989).
  • PFKl enzyme isolated from the fungus Aspergillus niger was in past often a subject of investigation (Habison et al., 1979; Habison et al., 1983; Schreferel et al.
  • the shorter PFKl fragment was prepared from a truncated pflcA gene. A number of genes shortened at 3' end of the leading strain were prepared and transferred into A. niger cells. After induced phosphorylation, PFKl activity characteristic for the shorter fragment was detected in homogenate of transformants carrying t-pflcA gene of specific length (Capuder, 2004). Intracellular phosphorylation was induced by the addition of sodium azide, a well known inhibitor of electron transport at cytochrome oxidase aa.3 site, which interrupts the synthesis of ATP which decreases the activity of trans-membrane proton pumps (H + -ATPaSeS).
  • the enzyme is initially inactive. It is activated only after the phosphorylation of the protein molecule by cAMP-dependent protein kinase that is induced by an increase of cAMP level in the cells.
  • cyclic AMP is synthesised after specific changes that spontaneously appear in the medium or it might be triggered artificially by adding specific inhibitors, like azide, to the medium. According to our knowledge spontaneous drop of intracellular pH occurs only in one strain of A. niger (A60), where the shorter fragment could be spontaneously activated as well. In another A.
  • De-regulated glycolytic flux is of up-most importance in commercial micro-organisms for achieving high rates of specific productivity. Such conditions can be accomplished by inserting mutated, truncated mt-pflcA gene, encoding active shorter fragment of PFKl enzyme that is resistant to citrate inhibition, while other effectors increase its activity to a greater extend in respect to the native enzyme.
  • the present invention addresses the mutated gene, encoding active shorter fragment of 6- phosphofructo-1 -kinase, where phosphorylation of the protein molecule is not needed for its activation, whose monomeric molecular mass is between 30 and 55 kDa, whose enzyme activity is not significantly inhibited by citric acid or citrate salts or ATP.
  • the present invention concentrates on the mutated gene encoding shorter fragment of PFKl that is active immediately after its synthesis and is not inhibited by citric acid, or citrate salts in the range from 0 mM to 10 mM or ATP up to 1,5 ATP in the presence of fructose-2,6-bisphosphate.
  • the invention addresses the modified gene encoding the synthesis of active shorter fragment of PFKl that can be activated by some metabolites such as fructose-2,6-bisphosphate, ammonium ions and AMP.
  • the shorter fragment originates from the native enzyme with removed N- and/or C-terminal.
  • the present invention is based on observation that mutated truncated gene, encoding the active fragment of 6-phosphofructo-l -kinase that is resistant to the inhibition by citric acid and/or citrate salts and ATP, increases the rate of primary and secondary metabolite synthesis in the cells.
  • the invention concentrates on a procedure that includes the use of the mutated gene for the synthesis of the active shorter PFKl fragment, or insertion of homologous or heterologous gene into the cells for increasing the rate of primary and secondary metabolite synthesis due to increased glycolytic flux.
  • Figure 1 Specific activities of PFKl enzymes measured in homogenates of parental strain of Aspergillus niger (A645, which is a derivative of A158 strain) and two transformants (T12 and T 14) with integrated t-pflcA gene, before and after the induction of phosphorylation by azide.
  • Figure 2 Specific activities of PFKl enzymes measured in homogenates of parental strain of Aspergillus niger (A645, which is a derivative of Al 58 strain), Tl 2 transformant with integrated t-pflcA gene and An-TEGI-23 transformant with integrated mutated truncated mt- pflcA gene. No azide was added to the medium.
  • Figure 3 Citric acid accumulation in the medium by Aspergillus niger strains transformed with truncated t-pfkA gene.
  • Figure 3 a transformants originating from A645 strain (derivative of Al 58 strain).
  • Figure 3b transformants originating from A60 strain.
  • FIG. 4 Citric acid accumulation in the medium by Aspergillus niger transformants with integrated mutated truncated mt-pflcA gene.
  • Figure 5 Excretion of ⁇ -amylases by growing A. niger (Al 58 strain) and An-TEGI-23 transformant on the medium with starch as a sole carbon source. After three days of growth the remaining starch was stained by iodine solution. A clearing zone with no starch can be observed around the colony of An-TEGI-23. No clearing zone appeared around the colony of the parental strain.
  • Figure 6 Activities of extracellular ⁇ -amylases excreted by parental strain of A. niger (A 158) and An-TEGI-23 transformant detected in the filtrate of the medium with starch as a sole carbon source.
  • Figure 7 Itaconic acid accumulation in the medium by transformants of Aspergillus terreus with integrated mutated truncated mt-pflcA gene (AT-TEGIl), integrated truncated t- pflcA gene (AT-44) and parental strain Al 56.
  • AT-TEGIl integrated mutated truncated mt-pflcA gene
  • AT-414 integrated truncated t- pflcA gene
  • parental strain Al 56 AT-TEGIl
  • PFKl stands for the enzyme 6-phosphofructo-l -kinase (EC 2.7.1.11).
  • Term “shorter fragment” stands for the protein which number of amino acid residues is smaller than that of the native protein.
  • Term "shorter PFKl fragment” stands for the PFKl protein which number of amino acid residues is smaller than that of the native 6-phosphofructo-l -kinase that is normally present in genetically unmodified cells.
  • pflcA stands for the gene encoding 6-phosphofructo-l -kinase.
  • t-pflcA stands for truncated pflcA gene, which number of nucleotides is lower than that of the native pflcA gene, encoding the synthesis of shorter PFKl fragment, which number of amino acid residues is lower than that of the native PFKl enzyme.
  • Term “mutation” stands for permanent change in nucleotide sequence of a specific gene.
  • mutant pfkA gene stands for a permanent change of one or more nucleotides anywhere in the sequence ofp ⁇ cA gene encoding PFKl enzyme with change of one or more amino acid residues anywhere in the protein.
  • mutant mt-pflcA gene stands for permanent change of one or more nucleotides anywhere in the sequence of truncated t-pflcA gene encoding shorter PFKl fragment with change of one or more amino acid residues anywhere in the protein.
  • 6-phosphofructo-l -kinase stands for the enzyme, that converts fructose-6- phosphate to fructose- 1,6-bisphosphate on expense of ATP in the presence OfMg 2+ ions and is an enzyme in the process of glycolysis.
  • Term “inhibition by citric acid” stands for negative action of citric acid' or its salts, such as citrates, on the enzyme activity of 6-phosphofructo-l -kinase.
  • Term “inhibition by ATP” stands for negative action of ATP on the enzyme activity of 6- phosphofructo- 1 -kinase.
  • Term “activation” stands for increasing the activity of the enzyme above the basic level in the presence of activating components such as: cellular metabolites, for instance fructose-2,6- bisphosphate and ammonium ions and AMP.
  • Term “N- and/or C- terminal part” of the protein stands for the part of the protein from the NH 2 - group or beginning of the protein toward the central part of the protein and from the central part of the protein toward the COOH- group or the terminal part of the protein.
  • post-translational modification stands for a change in amino acid sequence of the protein by cleaving the protein by proteases or by attaching other bio-chemically functional groups to amino acid sequence, such as the addition of phosphate group by a process of phosphorylation catalysed by protein kinase. Post-translational modifications are described in the scientific literature.
  • Term “metabolites” stands for the products of cellular metabolism.
  • Term “originating or the native enzyme or the gene” stands for the enzyme of 6- phosphofructo-1 -kinase and the gene encoding the enzyme, that is present in the cells.
  • Term “recombinant origin” stands for the gene or protein that is modified by the laboratory techniques known to the experts form the field.
  • Synthetic origin stands for the synthetically made gene or protein that is prepared by the techniques known to the experts form the field. Synthetic protein could be represented by the combination of animal and microbial protein.
  • Term “restriction at 5' and/or 3' part of the native gene” stands for the removal of the gene from 5' part toward the central part and/or removal from the central part toward the 3' part of the gene. Removal is conducted by techniques known to the experts from the field and can be done by specific endonucleases, un-specific cleavage or by multiplying the gene by the method of Polymerase Chain Reaction by the use of oligo-nucleotide primers, that are complementary to the gene at 5' and 3' end.
  • mutated homologous recombinant gene stands for the mutated gene encoding shorter fragment, prepared by the recombinant techniques and is introduced into the cells of the same species as the native gene comes from.
  • mutated recombinant gene stands for the mutated gene encoding shorter fragment, prepared by the recombinant techniques and is introduced into the cells of other species as the native gene comes from.
  • the invention deals with the gene encoding the shorter, genetically modified fragment of 6-phosphofructo-l -kinase that is active immediately after the synthesis, therefore no phosphoryltion of protein molecule is needed for its activation; and in the presence of citric acid and/or citric acid salts up to concentration of 15 mM and ATP up to concentration 1,5 mM its activity is reduced for less than 30%; and can be activated by fructose-2,6-bisphosphate, ammonium ions and AMP; and is encoding a protein that differs for at least one amino acid residue of the original amino acid sequence of shorter fragments and which genes are present in the genomes of microbial, animal or plant origin, preferably fungi, preferably from the species Aspergillus, Trichoderma, Penicillium, Pichia, Saccharomyces, Schizosaccharomyces, Candida, Kluyveromyces, Neurospora, preferably Aspergillus niger.
  • the gene encodes a shorter, genetically modified fragment of PFKl with molecular mass higher than 30 kDa and lower than 55 kDa, which has no N- and/or C- terminal part of the native 6-phosphofructo-l- kinase.
  • the invention concentrates on the gene encoding the shorter, genetically modified fragment of PFKl that is active immediately after the synthesis, therefore no phosphorylation of protein molecule is needed for its activation; and in the presence of citric acid and/or citric acid salts up to concentration of 15 mM and ATP up to concentration 1,5 mM its activity is reduced for less than 30%; and can be activated by fructose-2,6-bisphosphate, ammonium ions and AMP; and is encoding a protein with amino acid residue sequence SEQ ID NO:1 or SEQ ID NO:2, that differs for at least one amino acid residue from amino acid sequence of the shorter PFKl fragment of the sequence SEQ ID NO:3, which gene sequence SEQ ID NO:4 is present in the genome of Aspergillus niger, and encodes a protein with molecular mass higher than 30 kDa and lower than 55 kDa, which has no N- and/or C- terminal part of the native 6- phosphofructo- 1 -kinas
  • the invention deals with an expression vector that carries the above mentioned gene functionally connected to controlling sequences, promoter, and other relevant DNA sequences enabling protein synthesis, which is coded by the gene and expression vector that enables expression of the gene in eukaryotic host cells or prokaryotic host cells, preferably animal tissue cultures, plant tissue cultures, filamentous fungi, yeasts, bacteria, preferably filamentous fungi, preferably from the genus Aspergillus, Trichoderma, Penicillium, and preferably yeasts, preferably from the genus Pichia, Saccharomyces, Schizosaccharomyces, and preferably bacteria, preferably from the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas, preferably in filamentous fungi of the genus Aspergillus, preferably Aspergillus niger, Aspergillus terreus, Aspergillus oryzae.
  • the inventions deals with the organisms that contain above mentioned gene and/or above mentioned expression vector and that the above mentioned expression vector that corresponds to a specific organism, is inserted into above mentioned organism by the laboratory techniques known to the experts form the field in a way that enables expression of the above mentioned gene and the organisms are of microbial origin, preferably filamentous fungi, preferably from the genus Aspergillus, Trichoderma, Penicil ⁇ ium, and yeasts preferably from the gene Pichia, Saccharomyces, Schizosaccharomyces, or filamentous fungi from the genus Aspergillus, preferably Aspergillus niger, Aspergillus terreus, Aspergillus oryzae, or bacteria preferably from the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas and of plant and animal origin, preferably tissue cultures of plant and animal origin.
  • microbial origin preferably filamentous fungi, preferably from the
  • the invention concentrates on the use of the above mentioned gene and/or expression vectors and/or the above mentioned organisms for the rise of metabolic flux through glycolysis to enhance anaplerotic reaction during the process of bioproducts formation, preferably cell biomass; homologous and heterologous proteins; primary metabolites, such as ethanol, acetate, lactate, organic acids, amino acids, polyols; secondary metabolites, such as antibiotics, ergot alkaloids, statins, vitamins, immuno-modulators, citostatics, insecticides, herbicides.
  • primary metabolites such as ethanol, acetate, lactate, organic acids, amino acids, polyols
  • secondary metabolites such as antibiotics, ergot alkaloids, statins, vitamins, immuno-modulators, citostatics, insecticides, herbicides.
  • the invention concentrates on the process for bio-products formation that include the use of the above mentioned gene that is inserted in the above mentioned expression vectors that is introduced into the above mentioned organisms and that the above mentioned organism is cultivated in a way to synthesise the bio-product.
  • Plasmid pGWII that was used for silencing ofpryG gene, was prepared from pGW635 plasmid (Goosen et al., 1987) carrying pyrG gene of A. niger and pBluescript II KS+ (Stratagene, La Jolla, CA).
  • Expression vector pMOJ004 originates from pBluescript II KS+ plasmid (Stratagene, La Jolla, CA) with integrated promoter region of gene encoding for gliceraldehyde-3 -phosphate dehydrogenase (gpdA) and termination region of the gene encoding for glutamine amido transferase (trpC) of the fungus Aspergillus nid ⁇ lans.
  • gpdA gliceraldehyde-3 -phosphate dehydrogenase
  • trpC glutamine amido transferase
  • Promoter gpdA was amplified by the PCR method by using pAN7-l vector (Z32698) as a template and gpdA specific oligonucleotide primers: 5'-GAGCTCGTGACCGGTGACTCTTTC-3'(SEQ ID No: 5) and 5'- TCTAGATGCATATGGGTGATGTCTGCTCAAGC-3' (SEQ ID No: 6), that simultaneously enabled the insertion of Sstl and Xbctl-Ndel restriction sites at the 5' end.
  • trpC terminator region (X023390) was amplified by using the following oligonucleotide primers: 5'- CCATGGGTCTAGACGGATCCTAGTGATTTAATAGCTCCATGTC-S' (SEQ ID NO: 7) and 5'-GAATTCAAGCTTCCGCGGCCGGGTATTGGGTG-S' (SEQ ID NO: 8) that simultaneously enabled the insertion of XbaVBam ⁇ l ⁇ mdXho ⁇ restriction sites at the 5' end.
  • Sst ⁇ and Xha ⁇ enzymes For preparing gpdA promoter PCR products were cut by Sst ⁇ and Xha ⁇ enzymes, while for trpC terminator region the restriction was made by Xbal and Xhol enzyme.
  • Nde ⁇ /Apal- ATT -Bam ⁇ l fragments of A. niger pflcA gene (EMBL Accession No. pflcA Z79690) was amplified by PCR reaction by using following primers: : 5'-CCG CGG ATG CAT ATG GCT CCC CCC CAA GC-3' (SEQ ID No: 9) and 5'-TGG ATC CTT ACC CGG GAT CAT AGT GCC GGC ACA GAC C-3' (SEQ ID No: 10) and subcloned into ⁇ coRY digest of pBluescript II KS+ ( ⁇ BS)(Stratagene, La Jolla, CA).
  • Truncated t-pflcA gene encoded a protein of 452 amino acids with molecular mass of 49,8 kDa. Protein has retained identical amino acid sequence of the N-terminal part of the native protein, however amino acid residues at position 451 and 452 were added to match the appropriate restriction site. After verifying the nucleotide sequence, the truncated t-pfkA gene was inserted into Aspergillus niger auxotrophic strain (pyrG ⁇ ).
  • Mutated t-p ⁇ A gene was designated as mt-p ⁇ A gene.
  • Table 1 Additional changes introduced into genetically modified PFKl fragment, encoded by Mt-/yftA gene.
  • Mt-pflcA gene was ligated into the pALTER-Exl plasmid under the control of tac promoter. After cloning the sequence of Mt-pflcA gene inserted into the pALTER-Exl vector was checked (MWG-Biotech, Edberg, Germany).
  • Mycelium of A. niger was harvested after 16-18 hours of submerged growth in a complex medium. Protoplast formation and transformation was conducted as reported previously (Kusters-van Someren et al., 1991), only that lytic enzyme Caylase-4 (Cayla, Toulouse, France) was used instead of Novozyme 234. As a selection marker pyrA gene located on pGW635 plasmid was used.
  • Chromosomal DNA (3 ⁇ g) of transformants was degraded overnight by 3OU of Bam ⁇ l restriction enzyme in a final volume of 200 ⁇ l.
  • DNA molecules were separated on 0,5% agarose gel (lxTris-acetate-EDTA buffer with 2 ⁇ l/ml of etidium bromide) and bloted on nylon membrane (HybondTM-N + , Amersham). Single stranded DNA was cross-linked to membrane by UV light (Biometra Ti3, Biometra, Goetingen, Germany).
  • DNA probe was prepared from Ndel/Bam ⁇ I cut of the pRCR-pflcA plasmid and labeled with BioPrime DNA Labeling System (Life Technologies) according to the instructions. Chemiluminescence detection with CDP-Star (Roche Applied Science) was done by exposure of membranes to X-Omat AR Film ( Kodak).
  • Table 3 Estimated number of truncated t-pfkA gene copies as detected after Southern analysis in total DNA isolated from various transformants.
  • Table 4 Estimated number of mutated truncated mt-pflcA gene copies as detected by Southern analysis in total DNA isolated from various rransformants.
  • Table 5 Estimated number of mutated truncated mt-p ⁇ A gene copies as detected by Southern analysis in total DNA isolated from various transformants of Aspergillus terreus.
  • Plasmid pAlter-Exl carrying Mt-pJkA gene was inserted into E.coli strain DF 1010, with deleted bacterial pflcA andpflcB genes. Effectiveness of transformation was tested by growth of bacteria on selective medium. Plasmid p ALTER-ExI contains a gene for expression of tetracycline resistance in bacterial cells. 1.4.1. Detecting the activity of shorter fragment synthesised from t-pflcA gene.
  • Transformant with integrated t-pflcA gene were grown on minimal medium for 14 hours as described under 1.1.1.
  • Sodium azide was added to the medium in final concentration of ImM and culture incubated for additional 15 minutes.
  • Azide a well known inhibitor of electron transport over cytochromes causes protons to accumulate in the cells, which results in a drop of intracellular pH.
  • Cells respond by the synthesis of a signalling molecule - cyclic AMP to the slight acidification.
  • CyclicAMP activates cAMP-dependent protein kinase that ultimately phosphorylates shorter fragment of PFKl encoded by t-pflcA gene.
  • Different PFKl kinetic parameters were detected in cell-free extracts of transformants after phosphorylation was induced, while no change in kinetics could be observed in parental strain in spite of induced phosphorylation.
  • Transformants with integrated mt-pflcA gene that enabled synthesis of modified shorter PFKl fragment were grown for 14 hours on a minimal medium as described under 1.1.1. No sodium azide was added to the medium prior to measuring PFKl kinetics in cell free extracts. The presence of active shorter fragment of PFKl has been confirmed by detection of PFKl kinetics characteristic for the shorter fragment.
  • Mycelium was collected by suction filtration and washed with cold 50 mM phosphate buffer containing 0,5mM dithioerithritol (DTE) and ImM EDTA. ;
  • PFKl activity was measured spectrophotometrically at 340 nm according to slightly modified procedure of Legisa and Mattey, 1988, using a coupled reaction system.
  • the auxiliary enzymes remained active for several weeks when stored in refrigerator.
  • the measurements have started with adding fructose-6-phosphate and 0,1 mM ATP to the system, followed by increasing the concentration of ATP to ImM and finally in the presence of 4 ⁇ M of fructose-2,6-bisphosphate.
  • Alpha-amylolytic activity was measured in the medium filtrate as described under the Example 2.2., by using commercial Kit for evaluation of ⁇ -amylolytic activity according to the Ceralpha method (Megazyme, Bray, Ireland).
  • the fungus was grown in a medium that contained the following ingredients in 1 litre: 15Og sucrose, 2,5g (NIlO 2 SO 4 , l,5g KH 2 PO 4 , 0,5g MgSO 4 x7H 2 O, 6,5 mg FeSO 4 , 1,3 mg ZnSO 4 JH 2 O with pH value adjusted to 2,5.
  • the medium of the following composition contained in 1 litre: 2Og starch, 6,Og NaNO 3 , l,5g KH 2 PO 4 , 0,5g MgSO 4 JH 2 O 5 0,5g KCl, O 5 Ig EDTA, 44 mg ZnSO 4 , lOmg MnCl 2 .4H 2 0, 3,2 mg CoCl 2 .6 H 2 O, 3,2 mg CuSO 4 .5 H 2 0, 2,2 mg (NH 4 ) 6 Mo 7 O 24 .4 H 2 0, 14,7 mg CaCl 2 .2H 2 O, 10 mg FeSO 4 JH 2 O, agar 1,5% (m/v).
  • Agar plates containing the medium were inoculated with 5 ⁇ l of spore suspension of both A. niger strain A158 and transformant An-TEGI23. After three days of incubation at 3O 0 C the plates were poured with iodine solution (J 2 0,4M/KJ 0,4M) and the clearing zones measured around the colonies (Figure 5).
  • Transformant with integrated mt-pflcA genes grew faster and the colony diameter reached 26mm, while the parental strain diameter was smaller - 22mm. After staining with the iodine solution a clearing zone could be observed around the colony of transformant, while no starch was degraded around the colony but only beneath the mycelium of the parental strain.
  • Alpha-amylolytic activity of the parental A. niger strain (Al 58) and transformant with integrated mt-pfkA genes (An-TEGI23) was detected during the submerged growth in the medium as described above, without agar added.
  • the activity was determined in the filtrate of fermentation broths according to Ceralpha method. Data are means of three independent experiments and are shown in Figure 6.
  • the strains of Aspergillus terreus were grown in productive medium as described previously (Riscaldati et al., 2000) and contained in 1 litre: 15Og glucose, 2,36 g (NH 4 ) 2 SO 4 , 0,1 Ig KH 2 PO 4 , 208 mg MgSO 4 x7H 2 0, 130 mg KCl, 74 mg NaCl, 0,2 mg CuSO 4 .5H 2 O, 5,5 mg FeSO 4 JH 2 O, 0,7 mg MnCl 2 .4H 2 0, 1,3 mg ZnSO 4 JH 2 O, pH adjusted to 3,4.
  • the amount of itaconic acid was determined by ionic chromatography by using CIM discs and itaconate as a standard. The data are means of five independent experiments inoculated with the same strain/transformant.
  • Figure 6 shows the amount of accumulated itaconate by parental strain and transformant At-TEGI-I . In transformant carrying higher number of integrated vat-pflcA genes, the yields of itaconic acid were increased up to 40%.
  • E. coli Parental strains and double transformants of the bacterium E. coli were grown on minimal medium in the presence of the following carbon-hydrates as sole carbon sources: glucose, fructose, mannose and manitol. IPTG was added to the medium that promoted constitutive expression of Mt-pflcA gene. Apart from E. coli strain carrying Mt-pfkA gene the following E. coli strains were tested. BL21 strain, DF 1020 strain, DF 1020 strain with integrated native pflcA gene of Aspergillus niger, DF 1020 strain with integrated t-pflcA gene. After the incubation at 37 0 C for several days, growth of individual colonies was observed. Growth rates of colonies have been evaluated and are shown in Table 6.
  • Table 6 Growth of E. coli transformants on the minimal medium with various carbon sources. More pulses indicate higher specific growth rate. Negative sign represents no growth.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The invention deals with mutated truncated mX-pfkA gene encoding shorter fragment of 6- phosphofructo-1 -kinase (PFKl), with no need for phosphorylation of the protein molecule for activation, that is not significantly inhibited by citric acid and/or its salts and ATP molecules. Active 49 -52 kDa fragment encoded by mt-pfltk gene, retains positive regulatory properties of the native protein and is activated in the presence of specific activators, while citric acid and ATP, important metabolites that function as feed back inhibitors in higher organisms do not reduce its activity. The invention deals with the use of modified shorter fragment in biotechnological processes for fabricating primary and secondary metabolites.

Description

MUTATED TRUNCATED mX-pflcA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE
The subject of the invention is mutated truncated mt-pflcA gene encoding the synthesis of an active shorter fragment of 6-phosphofructo-l -kinase (PFKl), with no posttranslational modification needed to induce the activity. The subject of the invention is the use of mutated truncated gene and its protein product for enhancing the rate of cell biomass synthesis and excretion of extracellular enzymes, as well as increasing the productivity of primary and secondary metabolites.
The invention is in the field of microbial biotechnology and biochemistry.
At biotechnological processes a crucial determinant for the final price of the product is the velocity of the product formation. By optimising the processes the final goal is to change micro-organisms, as well as growth conditions to get higher amounts of substrate transformed into the final product per time unit. hi commercial micro-organisms that are capable of excreting specific biotechnological products with increased productivity and yield, anaplerotic reactions are of crucial importance. Such reactions lead to increased concentrations of tricarboxylic cycle (TCA) intermediates, which are precursors for a number of biosynthetic pathways, since TCA cycle presents the crucial link between catabolic and anabolic reactions in the cells. By increasing the level of TCA cycle intermediates due to increased anaplerotic reactions, the synthesis of the key cellular building blocks, such as lipids, amino acids, porfirins etc. is enhanced, and consequently the rate of synthesis of primary and secondary metabolites of biotechnological value increased.
Several specific metabolic reactions belong to anaplerotic reactions, however uninterrupted metabolic flow through glycolysis seems to be of utmost importance. The enzyme with the key role in regulating glycolysis is 6-phosphofructo-l -kinase (PFKl). In eukaryotic organisms the enzyme is regulated by the feed back mechanism, by citrate and ATP inhibition. In other words its activity decreases when citric acid level, as an important intermediate of TCA cycle and ATP, as the final product of oxidative phosphorylation, increase over a certain level (Voet and Voet, 1995). In fact negative regulation of the enzyme activity diminishes the effectiveness of anapletoric reactions and consequently reduces the rate of synthesis of the final products. A significant increase in the rate of product formation could be achieved by having undisturbed metabolic flow through glycolysis, which could be done by inserting a modified gene encoding PFKl enzyme that would be resistant to citrate inhibition but sensitive to activation with specific effectors.
In past several attempts were described to increase metabolic flow through glycolysis with the final goal to stimulate the synthesis of the final products, however no success was recorded. In order to enhance the glycolysis, three genes coding for the key regulatory enzymes of the pathway were isolated from the fungus Aspergillus niger including thepflcA gene coding for 6-phosphofructo-l -kinase. The genes were re-introduced into A. niger strain in a higher copy number with the ultimate goal to increase the concentration of the key enzymes and increase the flow of metabolites through the glycolysis. However, the detailed analyses of the transformants have not confirmed the expected results. It was concluded that other complex regulatory mechanisms compensated increased concentration of the key enzymes (Ruijter et al., 1996). In another attempt to improve the properties of PFKl, Aspergillus niger cells were subjected to mutations in order to make the enzyme resistant to citrate inhibition. A mutant was isolated that showed reduced inhibition by citrate, however the enzyme retained only 20% of its maximal velocity when inhibitor was present at slightly increased concentration of 10 mM. A partially increased resistance toward the citrate inhibition had no positive effect on elevating the rate of product formation (Schreferl et al., 1986). In another attempt reduced inhibition by citrate of PFKl was obtained by cleaving 8 amino acid residues from the C-terminal part of the enzyme, isolated from the rabbit muscle. Modified enzyme has lost its activity only when 10 mM of citrate was present in the system, while the original enzyme was completely inactivated at 2.5 mM of inhibitor (Valaitis et al., 1987).
The PFKl isolated from Aspergillus niger cells showed more resistance toward the citrate inhibition in comparison to the enzymes from other organisms, yet 1OmM of citrate almost prevented its catalytic activity. Physiological concentration of citric acid in normal cells is in mM values, however in A. niger cells the citrate concentration can reach up to 10 mM (Legisa and Kidric, 1989). PFKl enzyme isolated from the fungus Aspergillus niger was in past often a subject of investigation (Habison et al., 1979; Habison et al., 1983; Schreferel et al. 1986; Arst et al., 1987), moreover a gene coding for PFKl has been cloned and sequenced. By analysing the pflcA gene (EMBL accession number pfkA Z79690) it could be concluded that the protein has a molecular mass of 85 kDa, while by studying enzyme kinetics on a partially purified protein, whose molecular weight was not determined, confirmed that AMP, fructose-2,6- bisphosphate and ammonium ions act as positive effectors (Habison et al., 1983). It was also suggested the ammonium ions decrease the inhibition of PFKl by citrate to a certain extent (Habison et al., 1983; Arst et al., 1987). In authors lab a shorter form of PFKl isolated from the Aspergillus niger was described with molecular mass of about 48 kDa, which initially showed no activity, but became active after phopshorylation of the protein molecule. (Legisa and Bencina, 1994a). CP. Kubicek, who led investigations of kinetic measurements on the enzyme isolated form A. niger (Habison et al., 1979; Habison et al., 1983; Schreferel et al. 1986; Arst et al., 1987) categorically denied that in his lab a protein of 48 kDa showing the PFKl activity was ever measured (Legisa and Bencina, 1994b). In two diploma projects conducted in authors' labs, the procedure for isolation of 48 kDa fragment was described (Smerkolj, 2000) and post- translational modification of the native protein proposed as a mechanism of fragmented enzyme formation (Mesojednik, 2003). Recently the molecular weight of the active shorter fragment was determined to be 49 kDa, as well as posttranslational modification and kinetic parameters of the shorter fragment were described (Mesojednik and Legisa, 2005). By an in vitro experiment it has been shown, that the shorter fragment was inactive immediately after the proteolytic cleavage of the native protein and regained its activity only after the phosphorylation of the protein molecule, mediated by cAMP-dependent protein kinase. Measurements of kinetic parameters revealed that the shorter fragment was resistant to citrate inhibition (Mlakar, diploma work), while the negative effect of ATP was suppressed in the presence of fructose-2,6-bisphosphate (Mesojednik and Legisa, 2005).
In literature there is no description of any eukaryotic posttranslationally modified PFKl enzyme with retained ability to be up regulated by specific effectors and lost negative regulation. It seems that the shorter fragment of PFKl enzyme from A. niger cells is the most efficient form of PFKl enzyme described so far.
In order to avoid complicated posttranslational modification, the shorter PFKl fragment was prepared from a truncated pflcA gene. A number of genes shortened at 3' end of the leading strain were prepared and transferred into A. niger cells. After induced phosphorylation, PFKl activity characteristic for the shorter fragment was detected in homogenate of transformants carrying t-pflcA gene of specific length (Capuder, 2004). Intracellular phosphorylation was induced by the addition of sodium azide, a well known inhibitor of electron transport at cytochrome oxidase aa.3 site, which interrupts the synthesis of ATP which decreases the activity of trans-membrane proton pumps (H+-ATPaSeS). Protons that accumulate in cells cause a decrease in intracellular pH value. It is well known that a drop of intracellular pH triggers cAMP synthesis in fungal cells, which induces the activity of cAMP-dependent protein kinase that finally phosphorylates and activates the shorter fragment of PFKl enzyme.
Although the shorter fragment might be synthesised in vivo from a truncated gene, the enzyme is initially inactive. It is activated only after the phosphorylation of the protein molecule by cAMP-dependent protein kinase that is induced by an increase of cAMP level in the cells. During Aspergillus niger growth cyclic AMP is synthesised after specific changes that spontaneously appear in the medium or it might be triggered artificially by adding specific inhibitors, like azide, to the medium. According to our knowledge spontaneous drop of intracellular pH occurs only in one strain of A. niger (A60), where the shorter fragment could be spontaneously activated as well. In another A. niger strain (Al 58) more powerful H+- ATPases are present that prevent intracellular acidification and also synthesis of cAMP (Jernejc and Legisa, 2004). In some micro-organisms mechanisms are know, that trigger cAMP formation and activation of kinases that might activate the shorter fragment of PFKl, however such environmental conditions are often contradictory to optimal conditions needed for the synthesis of biotechnological products.
By introducing specific mutations into the truncated t-pflcA gene, the need for phosphorylation of the protein molecule would be omitted.
By literature search some papers were found that describe changed kinetic parameters of PFKl enzyme after induced changes in nucleotide sequences. However, in those publications authors used site-directed mutagenesis for determination of allosteric binding sites for various effectors. For example a paper of Li et al., 1999, summarises studies of citrate binding sites that were determined on rabbit muscle PFKl enzyme, while in review paper of Kemp and Gunasekera, 2002 the evolution of allosteric sites on eukaryotic PFKl enzymes is presented. No mutations were introduced to change phosphorylation sites on PFKl enzyme so far. Regulation of the enzyme activity was studied more in detail on 6-phosphofructo-2- kinase/fructose-2,6-bisphosphatase (Kurland et al., 1992; Kurland and Pilkis, 1995), however this enzyme is not directly involved in glycolysis.
No patent could be found that would protect the use of PFKl enzyme with changed kinetic parameters, by the active form of enzyme synthesised only from a mutated gene. According to the state-of-art, the problem of the synthesis of an active shorter fragment of PFKl with improved en2yme characteristics is not sufficiently solved. The aim of the invention is to solve the problem by the procedure that eliminates the need for phosphorylation of the protein molecule for its activation and enables in vivo synthesis of an active protein by inserting modified mt-pβcA gene.
De-regulated glycolytic flux is of up-most importance in commercial micro-organisms for achieving high rates of specific productivity. Such conditions can be accomplished by inserting mutated, truncated mt-pflcA gene, encoding active shorter fragment of PFKl enzyme that is resistant to citrate inhibition, while other effectors increase its activity to a greater extend in respect to the native enzyme.
According to the invention the task is solved according to independent patent claims.
The present invention addresses the mutated gene, encoding active shorter fragment of 6- phosphofructo-1 -kinase, where phosphorylation of the protein molecule is not needed for its activation, whose monomeric molecular mass is between 30 and 55 kDa, whose enzyme activity is not significantly inhibited by citric acid or citrate salts or ATP. The present invention concentrates on the mutated gene encoding shorter fragment of PFKl that is active immediately after its synthesis and is not inhibited by citric acid, or citrate salts in the range from 0 mM to 10 mM or ATP up to 1,5 ATP in the presence of fructose-2,6-bisphosphate. The invention addresses the modified gene encoding the synthesis of active shorter fragment of PFKl that can be activated by some metabolites such as fructose-2,6-bisphosphate, ammonium ions and AMP. The shorter fragment originates from the native enzyme with removed N- and/or C-terminal.
The present invention is based on observation that mutated truncated gene, encoding the active fragment of 6-phosphofructo-l -kinase that is resistant to the inhibition by citric acid and/or citrate salts and ATP, increases the rate of primary and secondary metabolite synthesis in the cells.
The invention concentrates on a procedure that includes the use of the mutated gene for the synthesis of the active shorter PFKl fragment, or insertion of homologous or heterologous gene into the cells for increasing the rate of primary and secondary metabolite synthesis due to increased glycolytic flux. DESCRIPTION OF FIGURES
Figure 1: Specific activities of PFKl enzymes measured in homogenates of parental strain of Aspergillus niger (A645, which is a derivative of A158 strain) and two transformants (T12 and T 14) with integrated t-pflcA gene, before and after the induction of phosphorylation by azide.
Figure 2: Specific activities of PFKl enzymes measured in homogenates of parental strain of Aspergillus niger (A645, which is a derivative of Al 58 strain), Tl 2 transformant with integrated t-pflcA gene and An-TEGI-23 transformant with integrated mutated truncated mt- pflcA gene. No azide was added to the medium.
Figure 3: Citric acid accumulation in the medium by Aspergillus niger strains transformed with truncated t-pfkA gene. Figure 3 a: transformants originating from A645 strain (derivative of Al 58 strain). Figure 3b: transformants originating from A60 strain.
Figure 4: Citric acid accumulation in the medium by Aspergillus niger transformants with integrated mutated truncated mt-pflcA gene. As a parental strain A645 strain, derivative of Al 58 strain has been taken.
Figure 5: Excretion of α-amylases by growing A. niger (Al 58 strain) and An-TEGI-23 transformant on the medium with starch as a sole carbon source. After three days of growth the remaining starch was stained by iodine solution. A clearing zone with no starch can be observed around the colony of An-TEGI-23. No clearing zone appeared around the colony of the parental strain.
Figure 6: Activities of extracelular α-amylases excreted by parental strain of A. niger (A 158) and An-TEGI-23 transformant detected in the filtrate of the medium with starch as a sole carbon source.
Figure 7: Itaconic acid accumulation in the medium by transformants of Aspergillus terreus with integrated mutated truncated mt-pflcA gene (AT-TEGIl), integrated truncated t- pflcA gene (AT-44) and parental strain Al 56. DEFINITIONS Abbreviation PFKl stands for the enzyme 6-phosphofructo-l -kinase (EC 2.7.1.11).
Term "shorter fragment" stands for the protein which number of amino acid residues is smaller than that of the native protein.
Term "shorter PFKl fragment" stands for the PFKl protein which number of amino acid residues is smaller than that of the native 6-phosphofructo-l -kinase that is normally present in genetically unmodified cells.
Abbreviation "pflcA" stands for the gene encoding 6-phosphofructo-l -kinase.
Abbreviation "t-pflcA" stands for truncated pflcA gene, which number of nucleotides is lower than that of the native pflcA gene, encoding the synthesis of shorter PFKl fragment, which number of amino acid residues is lower than that of the native PFKl enzyme.
Term "mutation" stands for permanent change in nucleotide sequence of a specific gene.
Term "mutated pfkA gene" stands for a permanent change of one or more nucleotides anywhere in the sequence ofpβcA gene encoding PFKl enzyme with change of one or more amino acid residues anywhere in the protein.
Term "mutated mt-pflcA gene" stands for permanent change of one or more nucleotides anywhere in the sequence of truncated t-pflcA gene encoding shorter PFKl fragment with change of one or more amino acid residues anywhere in the protein.
Term "6-phosphofructo-l -kinase" stands for the enzyme, that converts fructose-6- phosphate to fructose- 1,6-bisphosphate on expense of ATP in the presence OfMg2+ ions and is an enzyme in the process of glycolysis.
Term "inhibition by citric acid" stands for negative action of citric acid' or its salts, such as citrates, on the enzyme activity of 6-phosphofructo-l -kinase.
Term "inhibition by ATP" stands for negative action of ATP on the enzyme activity of 6- phosphofructo- 1 -kinase.
Term "activation" stands for increasing the activity of the enzyme above the basic level in the presence of activating components such as: cellular metabolites, for instance fructose-2,6- bisphosphate and ammonium ions and AMP. Term "N- and/or C- terminal part" of the protein stands for the part of the protein from the NH2- group or beginning of the protein toward the central part of the protein and from the central part of the protein toward the COOH- group or the terminal part of the protein.
Term "post-translational modification" stands for a change in amino acid sequence of the protein by cleaving the protein by proteases or by attaching other bio-chemically functional groups to amino acid sequence, such as the addition of phosphate group by a process of phosphorylation catalysed by protein kinase. Post-translational modifications are described in the scientific literature.
Term "metabolites" stands for the products of cellular metabolism.
Term "originating or the native enzyme or the gene" stands for the enzyme of 6- phosphofructo-1 -kinase and the gene encoding the enzyme, that is present in the cells.
Term "recombinant origin" stands for the gene or protein that is modified by the laboratory techniques known to the experts form the field.
Term "synthetic origin" stands for the synthetically made gene or protein that is prepared by the techniques known to the experts form the field. Synthetic protein could be represented by the combination of animal and microbial protein.
Term "restriction at 5' and/or 3' part of the native gene" stands for the removal of the gene from 5' part toward the central part and/or removal from the central part toward the 3' part of the gene. Removal is conducted by techniques known to the experts from the field and can be done by specific endonucleases, un-specific cleavage or by multiplying the gene by the method of Polymerase Chain Reaction by the use of oligo-nucleotide primers, that are complementary to the gene at 5' and 3' end.
Term "mutated homologous recombinant gene" stands for the mutated gene encoding shorter fragment, prepared by the recombinant techniques and is introduced into the cells of the same species as the native gene comes from.
Term "mutated recombinant gene" stands for the mutated gene encoding shorter fragment, prepared by the recombinant techniques and is introduced into the cells of other species as the native gene comes from.
The invention deals with the gene encoding the shorter, genetically modified fragment of 6-phosphofructo-l -kinase that is active immediately after the synthesis, therefore no phosphoryltion of protein molecule is needed for its activation; and in the presence of citric acid and/or citric acid salts up to concentration of 15 mM and ATP up to concentration 1,5 mM its activity is reduced for less than 30%; and can be activated by fructose-2,6-bisphosphate, ammonium ions and AMP; and is encoding a protein that differs for at least one amino acid residue of the original amino acid sequence of shorter fragments and which genes are present in the genomes of microbial, animal or plant origin, preferably fungi, preferably from the species Aspergillus, Trichoderma, Penicillium, Pichia, Saccharomyces, Schizosaccharomyces, Candida, Kluyveromyces, Neurospora, preferably Aspergillus niger. The gene encodes a shorter, genetically modified fragment of PFKl with molecular mass higher than 30 kDa and lower than 55 kDa, which has no N- and/or C- terminal part of the native 6-phosphofructo-l- kinase.
The invention concentrates on the gene encoding the shorter, genetically modified fragment of PFKl that is active immediately after the synthesis, therefore no phosphorylation of protein molecule is needed for its activation; and in the presence of citric acid and/or citric acid salts up to concentration of 15 mM and ATP up to concentration 1,5 mM its activity is reduced for less than 30%; and can be activated by fructose-2,6-bisphosphate, ammonium ions and AMP; and is encoding a protein with amino acid residue sequence SEQ ID NO:1 or SEQ ID NO:2, that differs for at least one amino acid residue from amino acid sequence of the shorter PFKl fragment of the sequence SEQ ID NO:3, which gene sequence SEQ ID NO:4 is present in the genome of Aspergillus niger, and encodes a protein with molecular mass higher than 30 kDa and lower than 55 kDa, which has no N- and/or C- terminal part of the native 6- phosphofructo- 1 -kinase.
The invention deals with an expression vector that carries the above mentioned gene functionally connected to controlling sequences, promoter, and other relevant DNA sequences enabling protein synthesis, which is coded by the gene and expression vector that enables expression of the gene in eukaryotic host cells or prokaryotic host cells, preferably animal tissue cultures, plant tissue cultures, filamentous fungi, yeasts, bacteria, preferably filamentous fungi, preferably from the genus Aspergillus, Trichoderma, Penicillium, and preferably yeasts, preferably from the genus Pichia, Saccharomyces, Schizosaccharomyces, and preferably bacteria, preferably from the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas, preferably in filamentous fungi of the genus Aspergillus, preferably Aspergillus niger, Aspergillus terreus, Aspergillus oryzae. The inventions deals with the organisms that contain above mentioned gene and/or above mentioned expression vector and that the above mentioned expression vector that corresponds to a specific organism, is inserted into above mentioned organism by the laboratory techniques known to the experts form the field in a way that enables expression of the above mentioned gene and the organisms are of microbial origin, preferably filamentous fungi, preferably from the genus Aspergillus, Trichoderma, Penicilϊium, and yeasts preferably from the gene Pichia, Saccharomyces, Schizosaccharomyces, or filamentous fungi from the genus Aspergillus, preferably Aspergillus niger, Aspergillus terreus, Aspergillus oryzae, or bacteria preferably from the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas and of plant and animal origin, preferably tissue cultures of plant and animal origin.
The invention concentrates on the use of the above mentioned gene and/or expression vectors and/or the above mentioned organisms for the rise of metabolic flux through glycolysis to enhance anaplerotic reaction during the process of bioproducts formation, preferably cell biomass; homologous and heterologous proteins; primary metabolites, such as ethanol, acetate, lactate, organic acids, amino acids, polyols; secondary metabolites, such as antibiotics, ergot alkaloids, statins, vitamins, immuno-modulators, citostatics, insecticides, herbicides.
The invention concentrates on the process for bio-products formation that include the use of the above mentioned gene that is inserted in the above mentioned expression vectors that is introduced into the above mentioned organisms and that the above mentioned organism is cultivated in a way to synthesise the bio-product.
The description of methods in the following text is merely of informative nature and serves for explanation of the invention. For the procedures other relevant materials and methods can be used know to the experts from the field.
1. DESIGNING AND TESTING TRUNCATED GENE wt-pβA
1.1.1. Growth of fungus Aspergillus niger
Spores of the fungus Aspergillus niger, strain A60 (MZKI, Microbiological Collection of the National Institute of Chemistry, Ljubljana, Slovenia), that developed on the wort agar slant after 7 days of incubation at 3O0C were suspended in 25 ml of sterile Tween 80 solution (0,1%, w/v). Final concentration of spores was about 107 spores per ml. For rapid growth of biomass, complex medium was inoculated by spores' that contained in 1 litre: 2g glucose, 0,5g yeast extract, 0,2g casein acid hydrolysate, 6g NaNO3, l,5g KH2PO4, 0,5g MgSO4x7H2O, 0,5g KCl, 10 ml trace metal solution (Vishniac and Santer, 1957), ρH=6,0.
For enzyme kinetic determination the mycelium of parental strain and transformants was grown in the medium that contained in 1 litre: 2Og glucose, 5g NH4(SOzJ)2, 5g KH2PO4, Ig MgSO4x7H2O, 0,5g NaCl, lOmg MnCl2, 10 mg peptone, pH=6,0.
AU media (100 ml) in 500 ml baffled Erlenmeyer flasks were inoculated by 5 ml of spore inoculum and incubated on a rotary shaker at 100 rpm and 3O0C.
1.1.2. Preparing pyrG' auxotrophic mutants
Single auxotrophic mutants of Aspergillus niger suitable for homologous transformation were prepared after the disruption of the pyrG gene in Al 58 strain (MZKI, Microbiological Collection of the National Institute of Chemistry, Ljubljana, Slovenia) by one step replacement method as described previously (Rothstein, 1983). Plasmid pGWII that was used for silencing ofpryG gene, was prepared from pGW635 plasmid (Goosen et al., 1987) carrying pyrG gene of A. niger and pBluescript II KS+ (Stratagene, La Jolla, CA). From a 3.9 kbp long KpnVXbal digest of pGW635 a 0.8 kbp Bgfll/BamHI fragment of the pyrG gene was excised, while the remaining flanking regions (Kpnl/BgUl of 1,3 kbp and BarήΑVXbal of 1.8 kbp) were ligated and inserted into pBS vector. After transformation with pGWII plasmid, protoplasts were regenerated on the minimal medium in the presence of uridine (5mM) and 5-fluoro-orotic acid (lmg/ml). Recovered colonies were checked for auxotrophy. Auxotrophic pyrG" mutant prepared from Al 58 strain was designated as A645.
1.1.3. Preparing pMO J004 plasmid
Expression vector pMOJ004 originates from pBluescript II KS+ plasmid (Stratagene, La Jolla, CA) with integrated promoter region of gene encoding for gliceraldehyde-3 -phosphate dehydrogenase (gpdA) and termination region of the gene encoding for glutamine amido transferase (trpC) of the fungus Aspergillus nidύlans. Promoter gpdA (Z32524) was amplified by the PCR method by using pAN7-l vector (Z32698) as a template and gpdA specific oligonucleotide primers: 5'-GAGCTCGTGACCGGTGACTCTTTC-3'(SEQ ID No: 5) and 5'- TCTAGATGCATATGGGTGATGTCTGCTCAAGC-3' (SEQ ID No: 6), that simultaneously enabled the insertion of Sstl and Xbctl-Ndel restriction sites at the 5' end. Similarly trpC terminator region (X023390) was amplified by using the following oligonucleotide primers: 5'- CCATGGGTCTAGACGGATCCTAGTGATTTAATAGCTCCATGTC-S' (SEQ ID NO: 7) and 5'-GAATTCAAGCTTCCGCGGCCGGGTATTGGGTG-S' (SEQ ID NO: 8) that simultaneously enabled the insertion of XbaVBamΑl εmdXhoϊ restriction sites at the 5' end. For preparing gpdA promoter PCR products were cut by Sstϊ and Xha\ enzymes, while for trpC terminator region the restriction was made by Xbal and Xhol enzyme. By using QIAquick GEL Extraction Kit (Qiagen) 0,9 and 1,5 kbp long fragments were isolated from the agarose gel. Finally PCR products were ligated into opened pBluescript II KS+ by the aid of T4DNA polimerase (New England Biolabs, Promega) and the newly formed plasmid was designated as pMOJ004 expression vector.
1.1.4. Construction of truncated t-pβA gene
Ndeϊ/Apal- ATT -BamΑl fragments of A. niger pflcA gene (EMBL Accession No. pflcA Z79690) was amplified by PCR reaction by using following primers: : 5'-CCG CGG ATG CAT ATG GCT CCC CCC CAA GC-3' (SEQ ID No: 9) and 5'-TGG ATC CTT ACC CGG GAT CAT AGT GCC GGC ACA GAC C-3' (SEQ ID No: 10) and subcloned into ΕcoRY digest of pBluescript II KS+ (ρBS)(Stratagene, La Jolla, CA). After amplification of the pBS-t-pβA plasmid in E.coli DH5α and the isolation of the plasmid by GeneElute Plasmid Mini Prep kit (Sigma), the t-pfkA sequence was determined by MWG-Biotech AG (Ebersberg, Germany) in positively oriented plasmids to exclude the appearance of any mutations. NdeVBamHI digest of pBS-t-/?/ftA was finally ligated into pET3a plasmid for expression in bacteria and/or pMOJ004 for expression in filamentous fungi.
Truncated t-pflcA gene encoded a protein of 452 amino acids with molecular mass of 49,8 kDa. Protein has retained identical amino acid sequence of the N-terminal part of the native protein, however amino acid residues at position 451 and 452 were added to match the appropriate restriction site. After verifying the nucleotide sequence, the truncated t-pfkA gene was inserted into Aspergillus niger auxotrophic strain (pyrG~).
1.2.1. Introducing site directed mutations into t-pflcA gene
By studying three dimensional structure of PFKl enzyme and by predicting phosphorylation sites of the amino acid residues of the enzyme using NetPhos 2,0 computer programme, the threonine residue at site 89 of the N-terminal part of the enzyme seemed to be the most likely candidate for phosphorylation and activation of the shorter PFKl fragment. By site directed mutagenesis nucleotide triplets were changed on t-pflcA gene to substitute specific amino acid residues with analogous residues found on PFKl enzyme of E. coll Mutagenesis was conducted by QuikChange II XL Site-Directed Mutagenesis Kit (Stratagene, La Jolla, CA) by using the following oligonucleotide primers: for changing T89Ε, 5' -CC GCC CGC TGC ATG GAG TTC CGT GAG CGC CC-3' (SEQ ID No: 11) and 5'-GG GCG CTC ACG GAA CTC CAT GCA GCG GGC GG-31 (SEQ ID No: 12); for changing G95I, 5'-C CGC TGC ATG GAG TTC CGT GAG CGC CCC ATC CGT CTG CGG G-31 (SEQ ID No: 13) and 5'-C CCG CAG ACG GAT GGG GCG CTC ACG GAA CTC CAT GCA GCG G-31 (SEQ ID No: 14). After amplification of pET3a plasmid carrying mutated t-pfkA gene, the sequence of mutated t- pflcA gene has been verified (MWG-Biotech, Eberberg, Germany), in order to confirm the accuracy of the genetic change. Mutated t-pβA gene was designated as mt-pβA gene.
By using QuikChange II XL Site-Directed Mutagenesis Kit (Stratagene, La Jolla, CA) nucleotides of two codons were changed that enable replacement of two amino acid residues: threonine (T) at site 89 with glutamic acid (E) and glycin (G) at site 95 with isoleucine (I). After verifying the sequence of mutated truncated gene the construct was inserted into A. niger cells.
1.2.2. Insertion of additional mutations into mt-pfkA gene. Construction of Mt-pflcA gene.
Additional mutations were inserted into mt-pflcA gene encoding modified shorter PFKl fragment of fungus Aspergillus niger to give a protein with 14 amino acid residues around the initial phosphorylation site of A. niger protein to be identical to E. coli protein. Nucleotide triplets for the synthesis of five more amino acid residues had to be changed as shown in Table 1.
Figure imgf000015_0001
Table 1: Additional changes introduced into genetically modified PFKl fragment, encoded by Mt-/yftA gene.
Additional mutations in mt-pflcA gene were conducted by PCR method of two overlapping fragments with 297 and 1128 bases that formed 23 complementary bases. For amplification of both fragments, pMOJ004-mt-g/ftA has been taken as a template. To enable insertion of MT-pflcA gene into pALTER-Exl plasmid (Promega), BamBI restriction site had to be replaced with JSaI restriction site at the 3' end of Mt-pfltA gene. Mt-pflcA gene was finally constructed by PCR ligation of both fragments. The oligonucleotide primers used are shown in Table 2.
Figure imgf000015_0002
Table 2: Oligonucleotide primers used for the construction of Mt-pβA gene. Mt-pflcA gene was ligated into the pALTER-Exl plasmid under the control of tac promoter. After cloning the sequence of Mt-pflcA gene inserted into the pALTER-Exl vector was checked (MWG-Biotech, Edberg, Germany).
1.3.1. Transformation of A. niger cells with pMOJ004-t-;?/fcA and pMOJ004-mt-j#A plasmid.
Mycelium of A. niger was harvested after 16-18 hours of submerged growth in a complex medium. Protoplast formation and transformation was conducted as reported previously (Kusters-van Someren et al., 1991), only that lytic enzyme Caylase-4 (Cayla, Toulouse, France) was used instead of Novozyme 234. As a selection marker pyrA gene located on pGW635 plasmid was used. Co-transformation of A645 auxotrophic strain was performed with lμg of pGW635 and 15μg of pMOJ004-t-/y%A or pMOJ004-mt-/>/ftA carrying truncated or mutated truncated gene for the synthesis of modified shorter PFKl fragment. Transformants were isolated after re-inoculation on medium without uridine.
1.3.1.1. Southern analysis
Chromosomal DNA (3μg) of transformants was degraded overnight by 3OU of BamΗl restriction enzyme in a final volume of 200 μl. DNA molecules were separated on 0,5% agarose gel (lxTris-acetate-EDTA buffer with 2μl/ml of etidium bromide) and bloted on nylon membrane (Hybond™-N+, Amersham). Single stranded DNA was cross-linked to membrane by UV light (Biometra Ti3, Biometra, Goetingen, Germany). DNA probe was prepared from Ndel/BamΗI cut of the pRCR-pflcA plasmid and labeled with BioPrime DNA Labeling System (Life Technologies) according to the instructions. Chemiluminescence detection with CDP-Star (Roche Applied Science) was done by exposure of membranes to X-Omat AR Film ( Kodak).
Seventeen transformants with integrated truncated genes enabling the synthesis of the PFKl fragment were isolated. Southern analysis showed different number of integrated plasmids in eleven transformants. Estimated number of integrated gene copies is presented in Table 3.
Figure imgf000017_0001
Table 3: Estimated number of truncated t-pfkA gene copies as detected after Southern analysis in total DNA isolated from various transformants.
After co-transformation of mutated truncated mt-pfkA gene into the auxotrophic strain of Aspergillus niger, different numbers of integrated copies were detected by Southern analysis. Estimated numbers of copies are presented in Table 4.
Figure imgf000018_0001
Table 4: Estimated number of mutated truncated mt-pflcA gene copies as detected by Southern analysis in total DNA isolated from various rransformants.
1.3.2. Transformation of Aspergillus terreus with pMOJO04-mt-/?/fcA plasmid.
Mycelium of A. terreus was harvested after 16-18 hours of submerged growth in a complex medium. Protoplast formation and transformation was conducted as reported previously (Kusters-van Someren et al., 1991), only that lytic enzyme Caylase-4 (Cayla, Toulouse, France) was used instead of Novozyme 234. A. terreus rransformants with integrated vat-pflcA genes were isolated after protoplasts were co-transformed with pMOJ004-mt-j!?/&A plasmid and pUT720 plasmid, carrying gene for phleomycin resistance. 1.3.2.1. Southern analysis
In five strains the presence of mt-pflcA was confirmed by PCR method. Southern analysis revealed different number of integrated genes in individual transformants as presented in Table 5.
Figure imgf000019_0001
Table 5: Estimated number of mutated truncated mt-pβA gene copies as detected by Southern analysis in total DNA isolated from various transformants of Aspergillus terreus.
1.3.3. Transformation of bacterium E.coli strain DF 1010 with pALTER-Exl plasmid carrying Mt-pfkA gene
Plasmid pAlter-Exl carrying Mt-pJkA gene was inserted into E.coli strain DF 1010, with deleted bacterial pflcA andpflcB genes. Effectiveness of transformation was tested by growth of bacteria on selective medium. Plasmid p ALTER-ExI contains a gene for expression of tetracycline resistance in bacterial cells. 1.4.1. Detecting the activity of shorter fragment synthesised from t-pflcA gene.
Transformant with integrated t-pflcA gene were grown on minimal medium for 14 hours as described under 1.1.1. Sodium azide was added to the medium in final concentration of ImM and culture incubated for additional 15 minutes. Azide a well known inhibitor of electron transport over cytochromes causes protons to accumulate in the cells, which results in a drop of intracellular pH. Cells respond by the synthesis of a signalling molecule - cyclic AMP to the slight acidification. CyclicAMP activates cAMP-dependent protein kinase that ultimately phosphorylates shorter fragment of PFKl encoded by t-pflcA gene. Different PFKl kinetic parameters were detected in cell-free extracts of transformants after phosphorylation was induced, while no change in kinetics could be observed in parental strain in spite of induced phosphorylation.
1.4.2. Detecting the activity of shorter fragment encoded by mt-pflcA gene.
Transformants with integrated mt-pflcA gene that enabled synthesis of modified shorter PFKl fragment were grown for 14 hours on a minimal medium as described under 1.1.1. No sodium azide was added to the medium prior to measuring PFKl kinetics in cell free extracts. The presence of active shorter fragment of PFKl has been confirmed by detection of PFKl kinetics characteristic for the shorter fragment.
1.5.1. Enzyme tests
1.5.1.1 Homogenate preparation
Mycelium was collected by suction filtration and washed with cold 50 mM phosphate buffer containing 0,5mM dithioerithritol (DTE) and ImM EDTA. ;
Approximately 5Og of wet weight of mycelium was frozen under the liquid nitrogen and disrupted for 1 minute in a glass bead disintegrator (Braun, Melsungen). After thawing the crushed cells were extracted with 5 ml of cold 50 mM phosphate buffer, pH=7,8, containing 0,5mM DTE and lOμl of protease inhibitor cocktail (Sigma). Finally the extract was centrifuged for 15 minutes at 15.000 rpm. Protein concentration in supernatant exceeded 5mg/ml.
1.5.1.2. Measuring enzyme kinetics
PFKl activity was measured spectrophotometrically at 340 nm according to slightly modified procedure of Legisa and Mattey, 1988, using a coupled reaction system. The reaction was carried out in the final volume of 1 ml and in the presence of: 50 mM Tris-HCl buffer, pH = 7.8, 0,5mM DTE, 200 mM KCl, 5 mM MgCl2, 0.2 mM NADH, 20μl of homogenate, various concentrations of fructose-6-phosphate, 0.9 U/ml aldolase (Roche Molecular Biochemicals, Indianapolis, Ind.), 2,4 U/ml triosephosphate isomerase and glycerol-3 -phosphate dehydrogenase (Sigma), 4,5 U/ml aldolase (Sigma).
In order to remove ammonium ions the auxiliary enzymes were dialysed against 50 mM Tris-HCl buffer pH=7.8, 0,5 mM DTE, 30% glycerol, overnight at 40C with one change of buffer after 8 hours. The auxiliary enzymes remained active for several weeks when stored in refrigerator.
When kinetic parameters of the shorter fragment were determined, all measurements were conducted in a buffer containing 5mg/ml of albumine, which was added to the system just before the measurements.
To differentiate between kinetics of the native enzyme and the shorter fragment, the measurements have started with adding fructose-6-phosphate and 0,1 mM ATP to the system, followed by increasing the concentration of ATP to ImM and finally in the presence of 4μM of fructose-2,6-bisphosphate.
1.5.2. Demonstrating the synthesis of the shorter fragment from t-pflcA gene
Since no active shorter fragment can be synthesised from t-pflcA gene, due to the need for phosphorylation of the protein molecule, intracellular phosphorylation must have been induced by an external stimulus. It has been achieved by adding sodium azide to the medium. Azide inhibits electron transport over cytochromes, which causes proton accumulation. Slight acidification is sensed as a stress in the cells that respond by the formation of signal molecule cAMP. Increased level of cAMP activates cAMP-dependent protein kinase that phosphorylates shorter PFKlfragment, encoded by t-pflcA gene. In cell homogenates containing inactive shorter PFKl fragment, changed enzyme kinetics was detected after induced phosphorylation (Figure 1) that was characteristic for the shorter fragment. No alternation in enzyme kinetics could be observed in homogenate of parental strains, in spite of induced phosphorylation by azide. A series of other truncated pflcA genes were tested that coded for proteins shortened at C-terminal part, with molecular masses between 40 to 52 kDa and that differed for 8 amino acid residues. However, none of other genes inserted into A. niger cells enabled synthesis of an active PFKl enzyme with modified kinetics.
1.5.3. Demonstrating the synthesis of active shorter PFKl fragment from mt-pflcA gene.
For testing mt-pfkA gene intracellular phosphorylation was not induced by adding sodium azide to the medium before mycelium was homogenised and PFKl activity measured. Parental strain, transformants with X-pflcA gene inserted and cells with τoX-pflcA gene were tested for changed PFKl activity. Enzyme kinetics characteristic for shorter PFKl fragment were detected only in extracts from transformants carrying mt-pfltA gene, while normal PFKl activity was observed in the parental strain and t-pflcA transformants.
1.5.4. Determining α-amylolytic activity in filtrate
Alpha-amylolytic activity was measured in the medium filtrate as described under the Example 2.2., by using commercial Kit for evaluation of α-amylolytic activity according to the Ceralpha method (Megazyme, Bray, Ireland).
2. Examples
2.1. Testing Aspergillus niger transformants for increased citric acid productivity
For testing citric acid accumulation by Aspergillus niger strains the fungus was grown in a medium that contained the following ingredients in 1 litre: 15Og sucrose, 2,5g (NIlO2SO4, l,5g KH2PO4, 0,5g MgSO4x7H2O, 6,5 mg FeSO4, 1,3 mg ZnSO4JH2O with pH value adjusted to 2,5.
The amount of citric acid in the medium filtrate was determined as reported previously (Legisa and Jernejc, 2002). Data are means of five independent experiments inoculated with individual strain/transformant. All transformants with inserted un-mutated truncated t-pflcA gene excreted citric acid more slowly and accumulated less acid in respect to the parental strain Al 58 (Figure 3a). In Aspergillus niger strain Al 58 potent H+-ATPaSeS were described (Jernejc and Legisa, 2004) that can maintain pH homeostasis (Hesse et al., 2002). Lack of a slight intracellular acidification prevents triggering of cAMP synthesis and activation of cAMP-dependent protein kinase, therefore no phosphorylation and activation of inactive shorter PFKl fragment can take place. In contrast to Al 58 strain, transformants of A60 strain with inserted t-pβA gene showed increased citric acid production in respect to their parental strain (Figure 3b). Less active W- ATPases were described in A60 strain (Jernejc and Legisa, 2002) that cause a drop of intracellular pH value during the growth in citric acid yielding medium, which finally induces cAMP synthesis and phosphorylation of the shorter PFKl fragment.
On the other hand the majority of transformants with inserted mutated truncated mt-pflcA genes accumulated citric acid more efficiently in respect to Al 58 strain. With some strains more than 50% increased productivity was recorded, as well as product yields at the end of fermentation were increased, in comparison to the parental strain (Figure 4). Some strains with inserted mt-pβA genes indeed produced less citric acid, however it should be noted that during transformation plasmids might induce mutations during the insertion into the chromosome. In some transformants one plasmid copy might be inserted at a site that causes negative mutation in sense of good citric acid production.
2.2. Testing Aspergillus niger transformants for increased α-amylase productivity
For testing α-amylase production the medium of the following composition was used that contained in 1 litre: 2Og starch, 6,Og NaNO3, l,5g KH2PO4, 0,5g MgSO4JH2O5 0,5g KCl, O5Ig EDTA, 44 mg ZnSO4, lOmg MnCl2.4H20, 3,2 mg CoCl2.6 H2O, 3,2 mg CuSO4.5 H20, 2,2 mg (NH4)6Mo7O24.4 H20, 14,7 mg CaCl2.2H2O, 10 mg FeSO4JH2O, agar 1,5% (m/v). Agar plates containing the medium were inoculated with 5μl of spore suspension of both A. niger strain A158 and transformant An-TEGI23. After three days of incubation at 3O0C the plates were poured with iodine solution (J2 0,4M/KJ 0,4M) and the clearing zones measured around the colonies (Figure 5).
Transformant with integrated mt-pflcA genes grew faster and the colony diameter reached 26mm, while the parental strain diameter was smaller - 22mm. After staining with the iodine solution a clearing zone could be observed around the colony of transformant, while no starch was degraded around the colony but only beneath the mycelium of the parental strain.
Alpha-amylolytic activity of the parental A. niger strain (Al 58) and transformant with integrated mt-pfkA genes (An-TEGI23) was detected during the submerged growth in the medium as described above, without agar added. The activity was determined in the filtrate of fermentation broths according to Ceralpha method. Data are means of three independent experiments and are shown in Figure 6.
2.3. Testing Aspergillus terreus transformants for increased itaconic acid productivity
For testing itaconic acid excretion, the strains of Aspergillus terreus were grown in productive medium as described previously (Riscaldati et al., 2000) and contained in 1 litre: 15Og glucose, 2,36 g (NH4)2SO4, 0,1 Ig KH2PO4, 208 mg MgSO4x7H20, 130 mg KCl, 74 mg NaCl, 0,2 mg CuSO4.5H2O, 5,5 mg FeSO4JH2O, 0,7 mg MnCl2.4H20, 1,3 mg ZnSO4JH2O, pH adjusted to 3,4.
The amount of itaconic acid was determined by ionic chromatography by using CIM discs and itaconate as a standard. The data are means of five independent experiments inoculated with the same strain/transformant. Figure 6 shows the amount of accumulated itaconate by parental strain and transformant At-TEGI-I . In transformant carrying higher number of integrated vat-pflcA genes, the yields of itaconic acid were increased up to 40%.
2.4. Testing transformants of bacterium E. coli (DF 1020) for growth on specific substrates
Parental strains and double transformants of the bacterium E. coli were grown on minimal medium in the presence of the following carbon-hydrates as sole carbon sources: glucose, fructose, mannose and manitol. IPTG was added to the medium that promoted constitutive expression of Mt-pflcA gene. Apart from E. coli strain carrying Mt-pfkA gene the following E. coli strains were tested. BL21 strain, DF 1020 strain, DF 1020 strain with integrated native pflcA gene of Aspergillus niger, DF 1020 strain with integrated t-pflcA gene. After the incubation at 370C for several days, growth of individual colonies was observed. Growth rates of colonies have been evaluated and are shown in Table 6.
Figure imgf000025_0001
Table 6: Growth of E. coli transformants on the minimal medium with various carbon sources. More pulses indicate higher specific growth rate. Negative sign represents no growth.
REFERENCES
Arts, E. et al., Gen. Microbiol., 133 (1987), p. 1195-1199.
Capuder M., Bachelor Thesis. Ljubljana. University of Ljubljana Faculty for Chemistry and Chemical Technology, Studies of Biochemistry, (2004), 77.
Habison, A. et al,. FEMS Microbiol. Lett. 5 (1979): 39-42. Habison, A. et al., Biochem. J. 209 (1983): 669-676. Hansen, T. et al., Arch. Microbiol. 177 (2002): 401-409. Hesse SJ.A. et al., Eur. J. Biochem. 269 (2002): 3485-3494. Huse. K. et al., FEBS Letts. 234 (1988): 185-188. Jernejc, KVLegisaM., J. Biotechnol. 112 (2004): 289-297. Kemp, R. G./ Gunasekera, D., Biochem. 41 (2002): 9426-9430. Kurland, IJ. et al., J. Biol. Chem. 267 (1992) 7: 4416-4423. Kusters-van Someren, M. A., J. A. et al., Curr Genet 20 (1991), 293-9.
Kurland, I.J./Pilkis, S., Protein Science 4 (1995): 1023-1037. Legisa, M./ Mattey M., Enzyme Microbiol. Technol. 10 (1988): 33-36. Legisa, M./ Bencina, M., FEMS Microbiol. Lett. 188 (1994a): 327-334. Legisa, M./ Bencina, M., FEMS Microbiol. Lett. 121 (1994b): 129. Legisa, M./ Kidric, J., Appl. Microbiol. Biotechnol. 31 (1989): 453-457. Laemmli . U.K., Nature 277 (1970): 680-685. Li, Y. Et al., Biochem. 38 (1999): 16407-16412. Mesojednik, S. Bachelor Thesis. Ljubljana. University of Ljubljana, Biotechnical Faculty, Department of Biology, (2003), 46.
Mesojednik, S./ Legisa, M., Appl. Environment. Microbiol. 71 (2005): 3, 1425-1432.
Mlakar, T. Bachelor Thesis. Ljubljana. University of Ljubljana, Faculty for Chemistry and Chemical Technology, Studies of Biochemistry, (2003), 56.
Poorman, RA. et al., Nature 309 (1984): 467-469. Riscaldati, E. et al., J. Biotechnol. 83 (2000): 3, 219-230.
Ruijter, G.J.G. et al., Biochim. Biophys.Acta 1334 (1997): 317-326. Schreferl, G. et al., J. Bacteriol. 165, 3 (1986), p. 1019-102.
Smerkolj, S. Bachelor Thesis. Ljubljana. University of Ljubljana, Biotechnical Faculty, Department of Microbiology, (2000), 32.
Valaitis, A.P. et al., J. Biol. Chem. 262, 11 (1987): 5044-5048.
Voet, D./ Voet, J. G. Biochemistry. Second edition. New York. Wiley & Sons inc., 1995, 1361.
Wang, X./Kemp, R.G. Biochemistry, 40 (2001): 3938-3942.
SEQUENCES
SEQ ID NO: 1
MAPPQAPVQPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLV
NGGDMIRQLHWEDVRGWLSRGGTLIGSARCMEFRERPIRLRAAKNMVLRGID ALVVC
GGDGSLTGADVFRSEWPGLLKELVETGELTEEQVKPYQILNIVGLVGSIDNDMSGTDA
TIGCYSSLTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWL ALMSAISTGADWLFVPE
MPPKDGWEDDMCAIITKNRKERGKRRTIVIVAEGAQDRHLNKISSSKIKDILTERLNLD
TRVTVLGHTQRGGAACAYDRWLSTLQGVEAVRAVLDMKPEAPSPVITIRENKILRMPL
MDAVQHTKTVTKHIQNKEFAEAMALRDSEFKEYHFSYINTSTPDHPKLLLPENKRMRI
GIIHVGAPAGGMNQATRAAVAYCLTRGHTPLAIHNGFPGLCRHYDPG*
SEQ IDNO: 2
MAPPQAPVQPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLV
NGGDMIRQLHWEDVRGWLSRGGTLIGSARCMEFRERPGRLRAAKNMVLRGIDALVV
CGGDGSLTGADVFRSEWPGLLKELVETGELTEEQVKPYQILNIVGL VGSIDNDMSGTD
ATIGCYSSLTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFVP
EMPPKDGWEDDMCAIITKNRKERGKRRTΓVIVAEGAQDRHLNKISSSKIKDILTERLNL
DTRVTVLGHTQRGGAACAYDRWLSTLQGVEAVRAVLDMKPEAPSPVITIRENKILRMP
LMDAVQHTKTVTKHIQNKEFAEAMALRDSEFKEYHFSYINTSTPDHPKLLLPENKRMR
IGIIHVGAPAGGMNQATRAAVAYCLTRGHTPLAIHNGFPGLCRHYDPG*
SEQ IDNO: 3
MAPPQAPVQPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLV
NGGDMIRQLHWEDVRGWLSRGGTLIGSARCMTFRERPGRLRAAKNMVLRGIDALVV
CGGDGSLTGADVFRSEWPGLLKELVETGELTEEQVKPYQILNIVGL VGSIDNDMSGTD
ATIGCYSSLTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWL ALMSAISTGADWLFVP
EMPPKDGWEDDMCAIITKNRKERGKRRTIVIVAEGAQDRHLNKISSSKIKDILTERLNL
DTRVTVLGHTQRGGAACAYDRWLSTLQGVEAVRAVLDMKPEAPSPVITIRENKILRMP
LMDAVQHTKTVTKHIQNKEFAEAMALRDSEFKEYHFSYTNTSTPDHPKLLLPENKRMR
IGIIHVGAPAGGMNQATRAAVAYCLTRGHTPLAIHNGFPGLCRHYDDTPICSVREVAW
QESDAWVNEGGSDIGTNRGLPGDDLATTAKSFKKFGFDALFWGGFEAFTAVSQLRQ
AREKYPEFKIPMTVLPATISNNVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIE TQGGKSGYIATTAGLSVGAVAVYIPEEGIDIKMLARDIDFLRDNFARDKGANRAGKIIL RNECASSTYTTQVVADMIKEEAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMATKC MLHLESYAGKSADEIAADELSASVIGIKGSQVLFSPMGGETGLEATETDWARRRPKTEF WLELQDTVNILSGRASVNNATWSCYENAPG#
SEQ ID NO: 4
ATGGCTCCCCCCCAAGCTCCCGTGCAACCGCCCAAGAGACGCCGCATCGGTGTCTT
GACCTCTGGTGGCGATGCTCCCGGTATGAACGGTGTCGTCCGGGCCGTCGTCCGGA
TGGCTATCCACTCCGACTGTGAGGCTTTCGCCGTCTACGAAGGTTACGAGGGTCTC
GTCAATGGCGGCGACATGATCCGTCAGCTTCACTGGGAGGATGTTCGCGGCTGGTT
GTCCCGTGGTGGTACCTTGATCGGTTCCGCCCGCTGCATGACCTTCCGTGAGCGCCC
CGGTCGTCTGCGGGCTGCCAAGAACATGGTCCTCCGTGGCATTGACGCCCTTGTCG
TCTGTGGTGGTGATGGCAGTTTGACTGGTGCCGACGTTTTTCGTTCCGAGTGGCCCG
GTCTGTTGAAGGAATTGGTCGAGACGGGCGAGTTGACCGAAGAGCAGGTCAAGCC
ATACCAGATTCTGAACATCGTCGGTTTGGTGGGTTCGATCGATAACGACATGTCCG
GCACCGACGCCACCATCGGTTGCTACTCCTCCCTCACTCGCATCTGTGACGCCGTCG
ACGACGTCTTCGATACTGCCTTTTCCCACCAGCGTGGATTCGTCATTGAGGTCATGG
GTCGTCACTGCGGTTGGCTGGCCTTGATGTCTGCTATCAGTACCGGTGCCGACTGGC
TGTTCGTGCCCGAGATGCCGCCCAAGGACGGATGGGAGGATGACATGTGCGCTATC
ATTACCAAGGTGGGTTGATCGGAACTTGGTGGAGAGAACTCAGAGGCATCACTAA
CTCCCCGCAGAACAGAAAGGAGCGTGGAAAGCGTAGGACGATCGTCATCGTGGCC
GAGGGTGCCCAGGATCGCCATCTCAACAAGATCTCGAGTTCGAAGATCAAGGATAT
TTTGACGGAGCGGTTGAACCTGGATACCCGTGTGACTGTGTTGGGTCACACTCAGA
GAGGTGGAGCCGCCTGTGCGTACGACCGCTGGCTGTCCACACTGCAGGGTGTCGAG
GCTGTCCGCGCGGTGCTGGACATGAAGCCCGAAGCCCCGTCCCCGGTCATCACCAT
CCGTGAGAACAAGATCTTGCGCATGCCGTTGATGGACGCCGTGCAGCACACCAAG
ACTGTCACCAAGCACATTCAGAACAAGGAGTTCGCCGAAGCCATGGCCCTCCGCGA
CTCGGAATTCAAAGAGTACCACTTTTCCTACATCAACACTTCCACGCCCGACCACC
CGAAGCTGCTCCTCCCAGAGAACAAGGTTTGTCGCCACAGTAGCTGCTTCGGTGCT
GAGCTAACAAAAGGCAGAGAATGCGCATCGGTATTATTCACGTTGGCGCCCCCGCT
GGTGGTATGAACCAGGCTACCCGCGCGGCCGTTGCCTACTGCCTGACTCGTGGCCA
CACCCCCCTGGCCATTCACAACGGTTTCCCCGGTCTGTGCCGGCACTATGATGACA
CCCCGATCTGCTCTGTGCGCGAGGTGGCATGGCAGGAATCGGACGCCTGGGTCAAC GAGGGTGGTTCGGATATCGGTACCAACCGTGGTCTGCCCGGCGATGACCTCGCGAC
CACGGCGAAGAGCTTCAAGAAGTTCGGATTCGATGCGTTGTTCGTCGTGGGTGGAT
TTGAGGCGTTCACCGCCGTCAGCCAGCTTCGCCAGGCGCGCGAGAAGTACCCCGAA
TTCAAGATTCCCATGACCGTGCTGCCGGCGACCATTTCCAACAACGTGCCGGGCAC
AGAATACTCTCTGGGTAGCGACACCTGCCTTAACACCTTGATCGACTTCTGCGACG
CCATCCGCCAGTCGGCCTCGTCCTCTCGTCGCCGTGTGTTCGTCATCGAGACGCAGG
GTGGCAAGTCGGGTTACATCGCCACGACGGCTGGTCTGTCGGTGGGCGCGGTAGCC
GTGTACATTCCCGAGGAGGGCATCGACATTAAGATGCTGGCCCGCGACATTGACTT
CCTGCGTGACAACTTTGCGCGCGACAAGGGAGCGAACCGCGCCGGTAAGATCATC
CTGCGTAACGAGTGCGCGTCCAGCACGTACACGACACAGGTGGTGGCCGACATGA
TCAAGGAGGAAGCCAAGGGACGTTTCGAGAGTCGTGCGGCGGTGCCGGGACACTT
CCAGCAGGGTGGCAAGCCGTCGCCGATGGACCGTATCCGGGCGTTGCGGATGGCC
ACCAAGTGTATGCTGCACCTGGAGAGCTATGCGGGCAAGTCGGCGGATGAGATTG
CGGCCGATGAGCTGTCTGCGTCGGTCATTGGTATCAAGGGCTCGCAGGTGTTGTTC
TCGCCGATGGGTGGAGAGACCGGCCTGGAGGCGACCGAGACGGACTGGGCGCGCC
GTCGACCCAAGACGGAGTTCTGGCTGGAGCTGCAGGACACGGTGAACATTCTGTCG
GGACGGGCGAGCGTGAACAACGCGACGTGGAGTTGCTATGAGAATGCTCCCGGGT
AA

Claims

PATENT CLAIMS
1. Gene encoding short genetically modified fragment of 6-phosphofructo-l- kinase, with no phosphorylation of the protein molecule needed for activation, that losses less than 30% of enzyme activity in the presence of citric acid and/or salts of citric acid in concentration up to 15mM and ATP in concentration up to 1,5 mM, that is activated by fructose-2,6-bisphosphate, ammonium ions and AMP5 that is encoding a protein which differs for at least one amino acid residue of a protein of the shorter PFKl fragment, which gene is present in genomes of microbial, animal and plant origin.
2. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to claim I3 wherein the molecular mass of the encoding protein is higher than 30 kDa and lower than 55 kDa.
5. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to claim 1, wherein protein of the shorter fragment contains no N- and/or C- terminal part of the native 6-phosphofructo-l -kinase.
4. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to any claim from 1 to 3, wherein encoding protein that differs for at least one amino acid residue of the amino acid sequence of the shorter PFKl fragment, which gene is present in genomes of microbial, animal, or plant origin.
5. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to claim 4, wherein encoding protein that differs for at least one amino acid residue of the amino acid sequence of the shorter PFKl fragment, which gene is present in genomes of microbial origin, preferably fungi and yeasts.
6. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to claim 4, wherein encoding protein that differs for at least one amino acid residue of the amino acid sequence of the shorter PFKl fragment, which gene is present in genomes of fungal origin, preferably filamentous fungi and yeasts.
7. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to claim 4, wherein encoding protein that differs for at least one amino acid residue of the amino acid sequence of the shorter PFKl fragment, which gene is present in genomes of filamentous fungi, yeasts, preferably in the genus Aspergillus, Trichoderma, Penicillium, Pichia, Saccharomyces, Schizosaccharomyces, Candida, Kluyveromyces, Neurospora.
8. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to any claim from 1 to 3, wherein encoding protein that differs for at least one amino acid residue of the amino acid sequence of the shorter PFKl fragment, which gene is present in genome of filamentous fungi, preferably in Aspergillus niger.
9. Gene encoding short genetically modified PFKl fragment, with no phosphorylation of the protein molecule needed for activation, according to any claim from 1 to 3 or 8, wherein encoding a protein with amino acid residue sequence SEQ ID NO:1 or SEQ ID NO:2, that differs for at least one amino acid residue from the amino acid sequence of the shorter PFKl fragment of the sequence SEQ ID NO:3, which gene sequence SEQ ID NO:4 is present in the genome of fungus Aspergillus niger.
10. Expression vector, carrying gene according to any claim from 1 to 9 that is functionally connected to controlling sequences, promoter and other relevant DNA sequences, enabling gene expression according to any claim from 1 to 9.
11. Expression vector according to claim 10 wherein enables igene expression according to any claim from 1 to 9 in eukaryotic host cells or prokaryotic host cells.
12. Expression vector according to any claim from 10 to 11, wherein enables gene expression according to any claim from 1 to 9 in eukaryotic host cells, preferably in filamentous fungi and yeasts.
13. Expression vector according to any claim from 10 to 12, wherein enables gene expression according to any claim from 1 to 9 in filamentous fungi, preferably in the genus Aspergillus, Trichoderma, Penicillium; yeasts, preferably in the genus Pichia, Saccharomyces, and bacteria in the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas.
14. Expression vector according to any claim from 10 to 13, wherein enables gene expression according to any claim from 1 to 9 in filamentous fungi of the genus Aspergillus, preferably in Aspergillus niger, Aspergillus terreus, Aspergillus oryzae.
15. Organisms with gene, encoding shorter genetically modified . PFKl fragment, according to any claim from 1 to 9 and/or expression vector according to any claim from 10 to 14, wherein gene and/or expression vector that, corresponds to a specific organism, is inserted into a specific organism with appropriate techniques known to the experts from the field, enables expression of the gene according to any claim from 1 to9.
16. Organisms according to claim 15 wherein of microbial, animal or plant origin.
17. Organisms according to any claim from 15 to 16 wherein of microbial origin.
18. Organisms according to any claim from 15 to 16 wherein of tissue culture of plant origin.
19. Organisms according to any claim from 15 to 16 wherein of tissue culture of animal origin.
20. Organisms according to any claim from 15 to 17 wherein filamentous fungi, yeasts and bacteria.
21. Organisms according to any claim from 15 to 17 wherein filamentous fungi, preferably from the genus Aspergillus, Trichoderma, Penicillium; yeasts preferably from the genus Pichia, Saccharomyces, Schizosaccharomyces and bacteria from the genus Acetobacter, Escherichia, Bacillus, Streptomyces, Zymomonas.
22. Organisms according to any claim from 15 to 17 wherein filamentous fungi, preferably from the genus Aspergillus, preferably Aspergillus niger, Aspergillus terreus, Aspergillus oryzae.
23. The use of gene encoding short genetically modified PFKl fragment according to any claim from 1 to 9 and/or expression vector according to any claim from 10 to 14 and/or organism according to any claim from 15 to 22 for increasing metabolic flux through glycolysis for enhancing anaplerotic reaction during the processes of bio-product formation.
24. The use according to claim 23 wherein bio-products are preferably cell biomass; homologous and heterologous proteins; primary metabolites such as ethanol, acetate, lactate, organic acids, amino acids, polyols; secondary metabolites such as: antibiotics, ergot alkaloids, statins, vitamins, imrnuno modulators, citostatics, insecticides, herbicides.
25. Procedure for bio-product formation that includes the use of the gene according to any claim from 1 to 9, that is inserted into the expression vector according to any claim from 10 to 14 and transferred into the organism according to any claim from 15 to 22 and that the organism is grown in a way, that enables the synthesis of bio-products.
PCT/SI2007/000007 2006-04-26 2007-02-27 MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE Ceased WO2007123498A2 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
BRPI0710863-0A BRPI0710863A2 (en) 2006-04-26 2007-02-27 gene encoding the short genetically modified 6-phosphofruct-1-kinase fragment without phosphorylation of the protein molecule required for activation, expression vector, organisms, use of said gene as well as procedure for bioproduct formation
US12/298,269 US7807404B2 (en) 2006-04-26 2007-02-27 Mutated truncated mt-pfkA gene for the synthesis of active shorter fragment of 6-phosphofructo-1-kinase
EP07709552.9A EP2010651B1 (en) 2006-04-26 2007-02-27 MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
SI200600107A SI22256A (en) 2006-04-26 2006-04-26 Mutated shortened mt-pfka gene for the synthesis of an active shorter6-phosphofructo-1-kinase fragment
SIP-200600107 2006-04-26

Publications (3)

Publication Number Publication Date
WO2007123498A2 true WO2007123498A2 (en) 2007-11-01
WO2007123498A3 WO2007123498A3 (en) 2007-12-21
WO2007123498A8 WO2007123498A8 (en) 2009-07-23

Family

ID=38476863

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/SI2007/000007 Ceased WO2007123498A2 (en) 2006-04-26 2007-02-27 MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE

Country Status (5)

Country Link
US (1) US7807404B2 (en)
EP (1) EP2010651B1 (en)
BR (1) BRPI0710863A2 (en)
SI (1) SI22256A (en)
WO (1) WO2007123498A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014142647A1 (en) * 2013-03-14 2014-09-18 Wageningen Universiteit Fungals strains with improved citric acid and itaconic acid production
WO2016153437A3 (en) * 2015-03-25 2016-11-24 Kemijski Institut Modified 6-phosphofructo-1 -kinases, which enable frementative growth of recombinant yeast saccharomyces cerevisiae cells on pentose sugars

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SI21617A (en) * 2003-09-09 2005-04-30 Kemijski inštitut Shorter fragment of 6-phosphofructo-1-kinase

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
None

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014142647A1 (en) * 2013-03-14 2014-09-18 Wageningen Universiteit Fungals strains with improved citric acid and itaconic acid production
WO2016153437A3 (en) * 2015-03-25 2016-11-24 Kemijski Institut Modified 6-phosphofructo-1 -kinases, which enable frementative growth of recombinant yeast saccharomyces cerevisiae cells on pentose sugars

Also Published As

Publication number Publication date
WO2007123498A8 (en) 2009-07-23
WO2007123498A3 (en) 2007-12-21
US7807404B2 (en) 2010-10-05
SI22256A (en) 2007-10-31
EP2010651A2 (en) 2009-01-07
BRPI0710863A2 (en) 2011-06-21
US20090098605A1 (en) 2009-04-16
EP2010651B1 (en) 2013-05-08

Similar Documents

Publication Publication Date Title
US8697416B2 (en) Recombinant polynucleotide, host cells containing the same and a process for producing a protein having aldolase activity
KR102136353B1 (en) Cell-free expression system with novel inorganic polyphosphate-based energy regeneration
CN109609475B (en) Glufosinate-ammonium dehydrogenase mutant and application thereof in synthesizing L-glufosinate-ammonium
KR101993939B1 (en) Filamentous fungi having an altered viscosity phenotype
JP2022025108A (en) Fungal production of fdca
KR20130101030A (en) Improved glycolic acid fermentative production with a modified microorganism
CN112789353A (en) Recombinant acid-resistant yeast inhibiting ethanol production and method for preparing lactic acid using same
Capuder et al. Highly active, citrate inhibition resistant form of Aspergillus niger 6-phosphofructo-1-kinase encoded by a modified pfkA gene
US20070141687A1 (en) Increase in stress tolerance with ascorbic acid during fermentation
KR102149044B1 (en) Method of producing 2-hydroxy gamma butyrolactone or 2,4-dihydroxybutanoic acid
EP2010651B1 (en) MUTATED TRUNCATED MT-PFKA GENE FOR THE SYNTHESIS OF ACTIVE SHORTER FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE
KR101628856B1 (en) Mutifunctional beta-Xylosidases
KR101541034B1 (en) Escherichia coli for high production of d―galactonate and use thereof
Zhou et al. Molecular genetic characterization of the thermostable L-lactate dehydrogenase gene (ldhL) of Thermoanaerobacter ethanolicus JW200 and biochemical characterization of the enzyme
Huang et al. Disruption of the peroxisomal citrate synthase CshA affects cell growth and multicellular development in Dictyostelium discoideum
US7527953B2 (en) Genes from Propionibacterium freudenreichii encoding enzymes involved in vitamin B12 biosynthesis
US7198932B1 (en) Gdp-4-keto-6-deoxy-d-mannose-3,5-epimerase-4-reductase gene derived from arabidopsis thaliana
KR101243903B1 (en) Ethanol―Tolerant Yeast Strains and Genes Thereof
TWI509072B (en) Isopropyl alcohol-producing escherichia coli and method for producing isopropyl alcohol
JP4415247B2 (en) Novel glycerol kinase, gene and method for producing glycerol kinase using the gene
KR20210120027A (en) ABC transporter for high-efficiency production of rebaudioside
JP2007189905A (en) DNA containing an alkalophilic cyclodextran synthase gene, recombinant DNA, and method for producing an alkalophilic cyclodextran synthase
ZUR et al. FRAGMENT OF 6-PHOSPHOFRUCTO-l-KINASE
KR20210076915A (en) Stevia rebaudiana kaurenoic acid hydroxylase variant for high-efficiency production of rebaudioside
JP5858463B2 (en) Lactic acid producing bacteria

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07709552

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2007709552

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 12298269

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0710863

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20081028