WO2006114312A2 - Vaccine - Google Patents

Vaccine Download PDF

Info

Publication number
WO2006114312A2
WO2006114312A2 PCT/EP2006/003918 EP2006003918W WO2006114312A2 WO 2006114312 A2 WO2006114312 A2 WO 2006114312A2 EP 2006003918 W EP2006003918 W EP 2006003918W WO 2006114312 A2 WO2006114312 A2 WO 2006114312A2
Authority
WO
WIPO (PCT)
Prior art keywords
hpv
vaccine
protein
immunogenic fragment
fragment
Prior art date
Application number
PCT/EP2006/003918
Other languages
French (fr)
Other versions
WO2006114312A3 (en
Inventor
Brigitte Desiree Alberte Colau
Original Assignee
Glaxosmithkline Biologicals S.A.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=36992675&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2006114312(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority claimed from GB0509010A external-priority patent/GB0509010D0/en
Priority claimed from PCT/EP2005/006461 external-priority patent/WO2005123125A1/en
Priority to BRPI0610032-5A priority Critical patent/BRPI0610032A2/en
Priority to JP2008508156A priority patent/JP2008539184A/en
Priority to EA200702079A priority patent/EA013326B1/en
Priority to AU2006239422A priority patent/AU2006239422A1/en
Priority to US11/912,687 priority patent/US20090181052A1/en
Application filed by Glaxosmithkline Biologicals S.A. filed Critical Glaxosmithkline Biologicals S.A.
Priority to CA002606092A priority patent/CA2606092A1/en
Priority to EP06724609A priority patent/EP1877086A2/en
Priority to MX2007013472A priority patent/MX2007013472A/en
Publication of WO2006114312A2 publication Critical patent/WO2006114312A2/en
Publication of WO2006114312A3 publication Critical patent/WO2006114312A3/en
Priority to NO20075194A priority patent/NO20075194L/en
Priority to IL186586A priority patent/IL186586A0/en

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5258Virus-like particles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20023Virus like particles [VLP]

Definitions

  • the present invention relates to human papillomavirus (HPV) vaccines.
  • Papillomaviruses are small DNA tumour viruses, which are highly species specific. So far, over 100 individual human papillomavirus (HPV) genotypes have been described. HPVs are generally specific either for the skin (e.g. HPV-I and -2) or mucosal surfaces (e.g. HPV-6 and -11) and usually cause benign tumours (warts) that persist for several months or years. Such benign tumours may be distressing for the individuals concerned but tend not to be life threatening, with a few exceptions.
  • HPVs human papillomavirus
  • HPVs are also associated with cancers, known as oncogenic HPV types.
  • the strongest positive association between an HPV and human cancer is that which exists between HPV- 16 and HPV-18 and cervical carcinoma. Cervical cancer is the most common malignancy in developing countries, with about 500,000 new cases occurring in the world each year.
  • HPV types which can cause cancer are types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68.
  • Types 16 and 18 are those which have the highest association with cervical cancer.
  • Types 31 and 45 are the types with the next highest association with a cancer risk (Munoz N, Bosch FX, de Sanjose S et al. International Agency for Research on Cancer Multicenter Cervical Cancer Study Group. N EnglJMed 2003; 348: 518-27.)
  • VLPs HPV virus like particles
  • WO2004/056389 discloses that an HPV 16, 18 VLP vaccine can provide cross protection against infection by HPV types other than 16 and 18. Statistically significant protection was observed against certain groups of HPV types . There is still a need for a vaccine that protects against multiple HPV types.
  • the present invention relates to a vaccination schedule for protection against HPV infection and/or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable interval.
  • the present invention further relates to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type.
  • the invention further relates to a method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable time interval.
  • the invention also relates to a method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV types.
  • the invention also relates to vaccine compositions of the invention per se.
  • the invention also relates to kits comprising the first and second vaccine compositions of the invention.
  • the invention relates to use of an HPV Ll protein or immunogenic fragment thereof from one first HPV type in the preparation of a medicament for boosting the immune response generated by an HPV Ll protein or immunogenic fragment thereof from a second, different HPV type.
  • the Ll protein or fragment thereof from the second HPV type is in the form of a virus like particle and is used to boost the response generated by the Ll protein or fragment thereof from the first HPV type also in the form of a virus like particle.
  • the invention also relates to the use of HPV Ll, preferably in the form of VLPs, from HPV strains which are not HPV 16, in boosting the response to HPV 16.
  • the invention also relates to the use of Ll, preferably in the form of VLPs, from HPV strains which are not HPV 18, in boosting the response to HPV 18.
  • the strains for boosting the immune response are those for which some level of cross protection is observed in Example 1, such as HPV 31, HPV 45 and HPV
  • FIGS 1 and 5 illustrate the antibodies generated to HPV 16 with different prime and boost regimes.
  • Figure 2 and 6 illustrate the antibodies generated to HPV 18 with different prime and boost regimes.
  • Figure 3 and 7 illustrate the antibodies generated to HPV 31 with different prime and boost regimes.
  • Figure 4 and 8 illustrate the antibodies generated to HPV 45 with different prime and boost regimes.
  • Fig 9 illustrates a summary of the antibody responses in Figs 1-8.
  • Fig 10 and 14 illustrates the % HPV 16 Ll specific T cells in the CD4+ population with different prime and boost regimes.
  • Fig 11 and 15 illustrates the % HPV 18 Ll specific T cells in the CD4+ population with different prime and boost regimes.
  • Fig 12 and 16 illustrates the % HPV31 Ll specific T cells in the CD4+ population with different prime and boost regimes.
  • Fig 13 and 17 illustrates the % HPV45 Ll specific T cells in the CD4+ population with different prime and boost regimes.
  • Fig 18 illustrates a summary of the CMI data in Figures 10-13.
  • Cross protection may be considered as the protection afforded by a vaccine containing one HPV type against infection (incident or persistent) and/or disease caused by a different HPV type.
  • Cross protection may be assessed by considering the vaccine efficacy (V. E.), wherein the V.E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group for a given type.
  • Infection may be incident or persistent infection.
  • Disease may be abnormal cytology, ASCUS, CINl, CIN2, CIN3 or cervical cancer related to HPV infection.
  • Infection may be assessed by PCR, for example.
  • Disease may be assessed by histological examination or analysis of biomarkers such as pl ⁇ .
  • Some level of cross protection is considered to be present when the cross protection is statistically significantly higher than that given by a placebo.
  • the level of cross protection is greater than 0% and up to 20%, up to 40%, up to 60%, up to 70%, up to 80%, or greater than 80%, as measured by the vaccine efficacy of an HPV vaccine against infection or disease caused by an HPV type not present in the vaccine, when compared to a placebo.
  • types for which cross protection is observed might be used as a prime or boost for one another, after a suitable interval, as well as providing homologous protection, and may allow the number of vaccinations for any given HPV type to be reduced.
  • the present invention relates to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable interval.
  • a suitable interval may be 7 days, 2 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4, months, 5 months, 6 months, 1 year.
  • Vaccination schedules might then be 0, 1 months, or 0, 2 months, or 0, 4 months or 0, 6 months, for example.
  • a suitable interval is one in which the boosting effect of the vaccine delivered second can be observed, for example by measurement of antibody titres or cell mediated immunity.
  • a suitable interval is one in which the primary immune response has been provoked by delivery of a vaccine, as measured by serum antibody titres for example, before delivery of a second vaccine.
  • a suitable interval is shortly after the peak of the primary response, typically the antibody response.
  • this interval is from 2 - 26 weeks after the initial vaccination, suitably 2 - 22 weeks, 2-18 weeks, 2-14 weeks, 2-12 weeks, 2 - 10 weeks, 2- 8 weeks, 2-6 weeks, and in one aspect 1 month after the initial vaccination.
  • Oncogenic HPV types include HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68.
  • the first vaccine suitably comprises an Ll protein or immunogenic fragment thereof from HPV 16 and HPV 18 and the second vaccine suitably comprises an Ll protein or immunogenic fragment thereof from HPV 31 , or HPV 45 or HPV 52.
  • a first vaccine comprises Ll protein or immunogenic fragment thereof from HPV 16 and HPV 18.
  • the first vaccine includes Ll protein or immunogenic fragment thereof from additional HPV types, such as one or more of HPV types 31,33,35,39,45,51,52,56,58,59,66,68.
  • the HPV type is HPV 33.
  • the second vaccine excludes at least the HPV 16 and 18 antigens from the first vaccine and comprises an Ll protein or immunogenic fragment thereof from an HPV type shown to have a cross protective interaction with HPV 16 and/or HPV 18 herein, suitably HPV 31 and/or 45 and/or 52.
  • the second vaccine may include additional types such as one or more of HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, 68.
  • the second vaccine comprises Ll protein or immunogenic fragment thereof from HPV 31 , and/or HPV 45.
  • the second vaccine includes Ll protein or immunogenic fragment thereof from type 52.
  • the second vaccine includes Ll protein or immunogenic fragment thereof from type 58.
  • the invention thus relates to a vaccine composition
  • a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 31 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
  • the invention also relates to a vaccine composition
  • a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 45 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
  • the invention also relates to a vaccine composition
  • a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 52 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
  • the second vaccine excludes all the HPV Ll containing antigens from the first vaccine.
  • the first and second vaccines share no identical Ll proteins or identical complete protein fragments.
  • use of identical antigens, the antigen being either whole Ll or a fragment thereof, in both the first and second vaccine is not preferred in this aspect.
  • first and second vaccines do not share an HPV Ll protein or immunogenic fragment thereof from the same HPV type.
  • the components of the first vaccine contain HPV species which are phylogenetically not closely related, such as HPV 16 and HPV 18.
  • the components of the second vaccine contain HPV species which are phylogenetically not closely related, such as HPV 31 and HPV 45.
  • HPV 16 and/or HPV 18 components in the first vaccine component protect against HPV infection and/or disease caused by at least one HPV type in the second vaccine.
  • first and second vaccines of the invention comprise HPV Ll VLPs from the following HPV types: first vaccine a combination of HPV 16, HPV 18 and HPV 33.
  • the first vaccine may contain additionally HPV 58.
  • second vaccine a combination of HPV 31 , HPV 45 and optionally HPV 52 and /or HPV 58.
  • the vaccine delivered second boosts the immune response against at least one component in the vaccine delivered first.
  • Boosting can suitably be measured by, for example, antibody titres, using methods standard in the art such as ELISA.
  • an HPV Ll protein or immunogenic fragment thereof is used for boosting cross reactive antibodies previously raised to a different HPV type.
  • the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a second, different HPV type.
  • the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a homologous HPV type.
  • the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a second, different HPV type, wherein the second type is phylogenetically related to the first type.
  • Phylogenetic relationships between HPV types are well known in the art (see e.g. de Villers et al. Virology. 2004 Jun 20;324(l): 17-27).
  • papillomaviruses can be seen to fall into distinct species which are phylogenetically related. For example, in species 16 are found types 16, 31, 33. In species 7 are found types 18 and 45.
  • the invention relates to use of HPV 31 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to (generated by) an HPV 16 vaccine comprising an Ll protein or fragment thereof.
  • the invention relates to use of HPV 52 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 16 vaccine comprising an Ll protein or fragment thereof.
  • the invention relates to use of HPV 45 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 18 vaccine comprising an Ll protein or fragment thereof.
  • the invention relates to use of HPV 18 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 45 vaccine comprising an Ll protein or fragment thereof.
  • the invention relates to use of HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 31 vaccine comprising an Ll protein or fragment thereof.
  • the invention relates to use of HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 52 vaccine comprising an Ll protein or fragment thereof.
  • the present relates in one aspect to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type.
  • the components of the first and second vaccines as defined above can be delivered in reverse order.
  • the first HPV to be delivered might comprise HPV 31 and HPV 45 antigens
  • the second vaccine to be delivered comprises HPV 16 and HPV 18 antigens.
  • the vaccines of the invention can additionally comprise, within the constraints of the invention, antigens from other HPV types, such as other antigenic oncogenic types (e.g. HPV 31,33,35,39,45,51,52,56,58,59,66,68.) , skin types (e.g. types 5, 8) and genital warts types (6, 11).
  • HPV 31,33,35,39,45,51,52,56,58,59,66,68. e.g. HPV 31,33,35,39,45,51,52,56,58,59,66,68.
  • skin types e.g. types 5, 8
  • genital warts types 6, 11).
  • each vaccine is capable of protection against persistent infection for HPV types present in the vaccine.
  • each vaccine is capable of protection against incident infection for HPV types present in the vaccine.
  • Example 1 Incident and persistent cervical infection are defined in Example 1.
  • each vaccine is capable of protection against cyto logical abnormalities related to HPV infection (e.g. ASCUS, CIN 1, CIN2, CM3, cervical cancer), suitably cuased by types not present in the vaccine, such as HPV 31, 45 or 52.
  • HPV infection e.g. ASCUS, CIN 1, CIN2, CM3, cervical cancer
  • Ll proteins or protein fragments from additional HPV types can be included in the vaccine of the invention, such as skin types (in particular HPV 5 and 8) and types associated with genital warts, such as HPV 6 and 11. Types 6 and 11 are not considered oncogenic types herein.
  • the vaccine can comprise HPV Ll protein components, preferably as virus like particles, in different amounts.
  • HPV 16 and HPV 18 VLPs may be provided at a higher dose than other oncogenic types, such as HPV 33 or 58.
  • HPV 16 and HPV 18 Ll only VLPs are provided at 20 ⁇ g per dose for human use.
  • Other HPV VLPs may be used at a lower dose, such as 15 or lO ⁇ g per dose for human use.
  • the vaccine may include an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 or E8.
  • the vaccine may lack an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 or E8.
  • a vaccine component of the invention is trivalent (contains an HPV Ll or fragment thereof from 3 different oncogenic HPV types).
  • the vaccine is tetravalent.
  • the vaccine is pentavalent.
  • the vaccine is hexavalent.
  • the vaccine is heptavalent.
  • the vaccine is octavalent. Higher order valancies are also contemplated herein.
  • the vaccine is at least tetravalent, or at least pentavalent, or at least hexavalent, or at least heptavalent or at least octavalent with respect to the oncogenic HPV types.
  • the combined vaccines of the invention comprise between them Ll protein or immunogenic fragments thereof from 4, 5, 6, 7, 8, 9 or 10 different HPV types.
  • the combination of HPV components within the vaccine does not significantly impact the immunogenicity of any one HPV component.
  • there is no biologically relevant interference between HPV antigens in the combination of the invention such that the combined vaccine of the invention is able to offer effective protection against infection by each HPV genotype represented in the vaccine.
  • the immune response against a given HPV type in the combination is at least 50 % of the immune response of that same HPV type when measured individually, preferably 100% or substantially 100%.
  • the combined vaccine of the invention preferably stimulates an immune response which is at least 50% of that provided by a combined HPV 16 / HPV 18 vaccine.
  • the immune response generated by the vaccine of the invention is at a level in which the protective effect of each HPV type is still seen.
  • the immune response may suitably be measured, for example, by antibody responses, in either preclinical or human experiments. Measurement of antibody responses is well known in the art, and disclosed in (for example) WO03/077942.
  • suitable immunogenic fragments of HPV Ll include truncations, deletions, substitution, or insertion mutants of Ll .
  • Such immunogenic fragments are suitably capable of raising an immune response (if necessary, when adjuvanted), said immune response being capable of recognising an Ll protein such as a virus like particle, from the HPV type from which the Ll protein was derived.
  • a suitable immunogenic fragment of HPV 16 is capable of cross protection against at least one of HPV 31 and HPV 52, and in an aspect of the invention, capable of cross protection against both.
  • a suitable immunogenic fragment of HPV 18 is capable of cross protection against HPV 45.
  • Cross protection obtainable by immunogenic fragments of HPV 16 and/or HPV 18 can be assessed by trials in humans, for example as outlined in Example 1.
  • vaccines according to the present invention can be tested using standard techniques, for example as in Example 1, or in standard preclinical models, to confirm that the vaccine is immunogenic.
  • Suitable immunogenic Ll fragments include truncated Ll proteins.
  • the truncation removes a nuclear localisation signal.
  • the truncation is a C terminal truncation.
  • the C terminal truncation removes fewer than 50 amino acids, such as fewer than 40 amino acids.
  • the Ll is from HPV 16 then in another aspect the C terminal truncation removes 34 amino acids from HPV 16 Ll.
  • the Ll is from HPV 18 then in a further aspect the C terminal truncation removes 35 amino acids from HPV 18 Ll.
  • HPV 16 sequence is the following sequence: (SEQ ID NO: 1)
  • the invention relates to virus like particles consisting only of HPV 16 Ll having the amino sequence above, and to compositions containing such VLPs.
  • HPV 16 sequence may also be that disclosed in WO9405792 or US6649167, for example, suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
  • HPV 18 sequence is the following sequence: (SEQ ID NO: 2)
  • the invention relates to virus like particles consisting only of HPV 18 Ll having the amino sequence above, and to compositions containing such VLPs.
  • HPV 18 sequence is disclosed in WO9629413, which may be suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
  • HPV 16 and HPV 18 sequences are well known in the art and may be suitable for use in the present invention.
  • C terminal truncations corresponding to those made for HPV 16 and HPV 18 may be used, based upon DNA or protein sequence alignments. Suitable truncations of, for example, HPV 31, HPV 45, HPV 52, HPV 58, HPV 33 may also be made, in one aspect removing equivalent C terminal portions of the Ll protein to those described above, as assessed by sequence alignment.
  • the invention relates to virus like particles consisting only of HPV 31 Ll having the amino sequence encoded by the sequence above, and to compositions containing such VLPs.
  • the invention relates to virus like particles consisting only of HPV 45 Ll having the amino sequence encoded by the sequence above, and to compositions containing such VLPs.
  • the Ll protein or fragment of the invention may optionally be in the form of a fusion protein, such as the fusion of the Ll protein with L2 or an early protein.
  • HPV Ll protein is suitably in the form of a capsomer or virus like particle (VLP).
  • VLPs may be used in the present invention.
  • HPV VLPs and methods for the production of VLPs are well known in the art.
  • VLPs typically are constructed from the Ll and optionally L2 structural proteins of the virus, see for example WO9420137, US5985610, W09611272, US6599508B1, US6361778B1, EP 595935.
  • Any suitable HPV VLP may be used in the present invention which provides cross protection, such as an Ll or Ll + L2 VLP.
  • the VLP is an Ll -only VLP.
  • VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
  • the VLP may comprise full length Ll protein.
  • the Ll protein used to form the VLP is a truncated Ll protein, as described above.
  • VLPs may be made in any suitable cell substrate such as yeast cells or insect cells e.g. baculovirus cells, and techniques for preparation of VLPs are well known in the art, such as WO9913056, US 6416945B1 , US 6261765B1 and US6245568, and references therein, the entire contents of which are hereby incorporated by reference.
  • VLPS are suitably made by disassembly and reassembly techniques, which can provide for more stable and/or homogeneous papillomavirus VLPs.
  • disassembly and reassembly techniques which can provide for more stable and/or homogeneous papillomavirus VLPs.
  • McCarthy et al, 1998 “Quantitative Disassembly and Reassembly of Human Papillomavirus Type 11 Virus like Particles in Vitro" J. Virology 72(1):33-41, describes the disassembly and reassembly of recombinant Ll HPV 11 VLPs purified from insect cells in order to obtain a homogeneous preparation of VLP's.
  • WO9913056 and US6245568 also describe disassembly/reassembly processes for making HPV VLPs.
  • HPV VLPS are made as described WO9913056 or US6245568
  • HPV Ll the invention may be combined with an adjuvant or imunostimulant such as, but not limited to, detoxified lipid A from any source and non-toxic derivatives of lipid A, saponins and other reagents capable of stimulating a THl type response.
  • an adjuvant or imunostimulant such as, but not limited to, detoxified lipid A from any source and non-toxic derivatives of lipid A, saponins and other reagents capable of stimulating a THl type response.
  • enterobacterial lipopolysaccharide is a potent stimulator of the immune system, although its use in adjuvants has been curtailed by its toxic effects.
  • LPS enterobacterial lipopolysaccharide
  • MPL monophosphoryl lipid A
  • a further detoxified version of MPL results from the removal of the acyl chain from the 3-position of the disaccharide backbone, and is called 3-O-Deacylated monophosphoryl lipid A (3D-MPL). It can be purified and prepared by the methods taught in GB 2122204B, which reference also discloses the preparation of diphosphoryl lipid A, and 3-O-deacylated variants thereof.
  • a suitable form of 3D-MPL is in the form of an emulsion having a small particle size less than 0.2 ⁇ m in diameter, and its method of manufacture is disclosed in WO 94/21292.
  • Aqueous formulations comprising monophosphoryl lipid A and a surfactant have been described in WO9843670A2.
  • the bacterial lipopolysaccharide derived adjuvants to be formulated in the compositions of the present invention may be purified and processed from bacterial sources, or alternatively they may be synthetic.
  • purified monophosphoryl lipid A is described in Ribi et al 1986 (supra)
  • 3-O-Deacylated monophosphoryl or diphosphoryl lipid A derived from Salmonella sp. is described in GB 2220211 and US 4912094.
  • Other purified and synthetic lipopolysaccharides have been described (Hilgers et al., 1986, Int. Arch. Allergy.
  • the bacterial lipopolysaccharide adjuvant is 3D-MPL.
  • the LPS derivatives that may be used in the present invention are those immunostimulants that are similar in structure to that of LPS or MPL or 3D-MPL.
  • the LPS derivatives may be an acylated monosaccharide, which is a sub-portion to the above structure of MPL.
  • Saponins are taught in: Lacaille-Dubois, M and Wagner H. (1996. A review of the biological and pharmacological activities of saponins. Phytomedicine vol 2 pp 363- 386). Saponins are steroid or triterpene glycosides widely distributed in the plant and marine animal kingdoms. Saponins are noted for forming colloidal solutions in water which foam on shaking, and for precipitating cholesterol. When saponins are near cell membranes they create pore-like structures in the membrane which cause the membrane to burst. Haemolysis of erythrocytes is an example of this phenomenon, which is a property of certain, but not all, saponins.
  • Saponins are known as adjuvants in vaccines for systemic administration.
  • the adjuvant and haemolytic activity of individual saponins has been extensively studied in the art (Lacaille-Dubois and Wagner, supra).
  • Quil A derived from the bark of the South American tree Quillaja Saponaria Molina
  • Serrev Ther Drug Carrier Sy st 1996, 12 (l-2):l-55
  • EP 0 362 279 Bl are known as adjuvants in vaccines for systemic administration.
  • IDS Immune Stimulating Complexes
  • Quil A fractions of Quil A are haemolytic and have been used in the manufacture of vaccines (Morein, B., EP 0 109 942 Bl; WO 96/11711; WO 96/33739).
  • the haemolytic saponins QS21 and QS 17 HPLC purified fractions of Quil A have been described as potent systemic adjuvants, and the method of their production is disclosed in US Patent No.5,057,540 and EP 0 362 279 Bl.
  • Other saponins which have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al., Vaccine, 10(9):572-577, 1992).
  • An enhanced system involves the combination of a non-toxic lipid A derivative and a saponin derivative particularly the combination of QS21 and 3D-MPL as disclosed in WO 94/00153, or a less reactogenic composition where the QS21 is quenched with cholesterol as disclosed in WO 96/33739.
  • a vaccine adjuvanted with detoxified lipid A or a non-toxic derivative of lipid A more suitably adjuvanted with a monophosphoryl lipid A or derivative thereof.
  • the vaccine additionally comprises a saponin, for example QS21.
  • the formulation additionally comprises an oil in water emulsion.
  • the present invention also provides a method for producing a vaccine formulation comprising mixing an L2 peptide of the present invention together with a pharmaceutically acceptable excipient, such as 3D-MPL.
  • a formulation comprises 3D-MPL, Triton X-IOO, Tween 80 and sodium deoxycholate, which may be combined with an L2 antigen preparation to provide a suitable vaccine.
  • the vaccine comprises a vesicular adjuvant formulation comprising cholesterol, a saponin and an LPS derivative.
  • the adjuvant formulation suitably comprises a unilamellar vesicle comprising cholesterol, having a lipid bilayer suitably comprising dioleoyl phosphatidyl choline, wherein the saponin and the LPS derivative are associated with, or embedded within, the lipid bilayer.
  • these adjuvant formulations comprise QS21 as the saponin, and 3D-MPL as the LPS derivative, wherein the ratio of QS21 :cholesterol is from 1 :1 to 1 :100 weight/weight, and in one aspect, a ratio of 1 :5 weight/weight.
  • Such adjuvant formulations are described in EP 0 822 831 B, the disclosure of which is incorporated herein by reference.
  • the vaccines of the invention are used in combination with aluminium, and are suitably adsorbed or partially adsorbed onto aluminium adjuvants.
  • the adjuvant is an aluminium salt, which may be in combination with 3D MPL, such as aluminium phosphate and 3D MPL. Aluminium hydroxide, optionally in combination with 3D MPL is also suitable.
  • the vaccine comprises the combination of HPV VLPs with an aluminium salt or with an aluminium salt + 3D MPL.
  • Aluminium hydroxide is suitable as the aluminium salt.
  • the vaccine may also comprise aluminium or an aluminium compound as a stabiliser.
  • the adjuvant may be a combination of an oil-in-water emulsion adjuvant and 3D MPL.
  • the oil-in-water emulsion comprises a metabolisable oil, a sterol and an emulsifying agent.
  • the vaccines of the invention may be provided by any of a variety of routes such as oral delivery (e.g. see WO9961052 A2) , topical, subcutaneous, mucosal (typically intravaginal), intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository.
  • oral delivery e.g. see WO9961052 A2
  • mucosal typically intravaginal
  • intraveneous intramuscular
  • intranasal sublingual
  • intradermal via suppository.
  • the vaccine may also be formulated or co-administered with other HPV antigens or non-HPV antigens.
  • these non-HPV antigens can provide protection against other diseases, such as sexually transmitted diseases such as herpes simplex virus, EBV, chlamydia and HFV.
  • the vaccine comprises gD or a truncate thereof from HSV. In this way the vaccine provides protection against both HPV and HSV.
  • the dosage of the vaccine components will vary with the condition, sex, age and weight of the individual, the administration route and HPV of the vaccine.
  • the quantity may also be varied with the number of VLP types.
  • the delivery is of an amount of vaccine suitable to generate an immunologically protective response.
  • each vaccine dose comprises 1-100 ⁇ g of each VLP, in one aspect 5-80 ⁇ g, in another aspect 5- 30 ⁇ g each VLP, in a further aspect 5-20 ⁇ g of each VLP, in a yet further aspect 5 ⁇ g, 6 ⁇ g, lO ⁇ g, 15 ⁇ g or 20 ⁇ g.
  • the vaccine is used for the vaccination of adolescent girls aged 10-15, such as 10-13 years. However, older girls above 15 years old and adult women may also be vaccinated.
  • the vaccine may also be administered to women following an abnormal pap smear or after surgery following removal of a lesion caused by HPV, or who are seronegative and DNA negative for HPV cancer types.
  • the vaccine of the invention is used to vaccinate males.
  • the vaccine is delivered in a 2 dose regime, for example in a 0, 1 month regime or 0, 6 month regime respectively.
  • the vaccination regime may incorporate a booster injection after 5 to 10 years, such as 10 years.
  • the invention relates to a three dose vaccine, in which (for example) a first vaccine and second vaccine are delivered, the first and second vaccine being different, followed by a third vaccine containing one or more or all of the HPV elements of the first or second vaccines.
  • the first and second vaccines are completely different with respect to the HPV Ll components.
  • a first vaccine may comprise or consist of HPV 16 and HPV 18 Ll protein.
  • the second vaccine may consist of HPV 31 and HPV 45 Ll protein.
  • a third vaccine may comprise Ll protein from all 4 HPV types, HPV 16, 18, 31 and 45.
  • the invention in another aspect relates to a three dose vaccine, in which (for example) a first HPV vaccine and second HPV vaccine are delivered, the first and second vaccine being different, followed by a third vaccine, the third vaccine containing none of the HPV Ll components of the first or second vaccines.
  • the vaccine is a liquid vaccine formulation, although the vaccine may be lyophilised and reconstituted prior to administration.
  • the vaccines of the invention comprise certain HPV components as laid out above.
  • the vaccine consists essentially of, or consists of, said components.
  • 'vaccine' refers to a composition that comprises an immunogenic component capable of provoking an immune response in an individual, such as a human, optionally when suitably formulated or adjuvanted.
  • a vaccine suitably elicts a protective immune response against incident infection, or persistent infection, or cytological abnormality such as ASCUS, CINl, CIN2 CIN3, or cervical cancer caused by one or more HPV types.
  • the mixture comprised, per 0.5 ml dose, 20 ⁇ g of HPV- 16 Ll VLP, 20 ⁇ g of HPV- 18 Ll VLP and was adjuvanted with 500 ⁇ g of aluminum hydroxide and 50 ⁇ g of 3D MPL.
  • the placebo group was injected with 500 ⁇ g of aluminum hydroxide alone.
  • V. E. The vaccine efficacy (V. E.) against certain cancer HPV types was assessed, wherein the V. E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group.
  • Cross protection was assessed by detecting the presence of nucleic acid specific for various oncogenic types in the vaccinees and control group. Detection was carried out using techniques as described in WO03014402, and references therein, particularly for non-specific amplification of HPV DNA and subsequent detection of DNA types using a LiPA system as described in WO 99/14377, and in Kleter et al, [Journal of Clinical Microbiology (1999), 37 (8): 2508-2517], the whole contents of which are herein specifically incorporated by reference.
  • Any suitable method can, however, be used for the detection of HPV DNA in a sample, such as type specific PCR using primers specific for each HPV type of interest.
  • Suitable primers are known to the skilled person, or can be easily constructed given that the sequences of the oncogenic HPV types are known.
  • the primary objective of this study was to assess vaccine efficacy in the prevention of infection with HPV-16, HPV-18, or both (HPV-16/18), between months 6 and 18 in participants who were initially shown to be seronegative for HPV-16/18 by ELISA and negative for HPV- 16/18 DNA by PCR.
  • Women eligible for the initial phase included healthy women aged 15- 25 years, who had had no more than six sexual partners, no history of an abnormal Pap test or ablative or excisional treatment of the cervix, and no ongoing treatment for external condylomata; and who were cytologically negative, seronegative for HPV- 16 and HPV- 18 antibodies by ELISA, and HPV-DNA-negative by PCR for 14 high-risk HPV types (16, 18, 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68) no more than 90 days before study entry. Women who completed the initial phase of the study earliest, and who did not have ablative or excisional therapy of the cervix, or hysterectomy after enrolment, were eligible to participate in the extension phase of the study (months 18-27).
  • Each dose of the bivalent HPV- 16/18 virus-like particle vaccine contained 20 /*g of HPV-16 Ll virus-like particle and 20 Mg of HPV-18 Ll virus-like particle.
  • Each type of virus-like particle was produced on Spodoptera frugiperda Sf-9 and Trichoplusia ni Hi-5 cell substrate with AS04 adjuvant containing 500 ⁇ g aluminum hydroxide and 50 Pg 3-deacylated monophosphoryl lipid A (MPL, Corixa, Montana, USA) provided in a monodose vial.
  • the placebo contained 500 Pg of aluminum hydroxide per dose, and was identical in appearance to the HPV- 16/ 18 vaccine. Every study participant received a 0 5 mL dose of vaccine or placebo at 0 months, 1 month, and 6 months.
  • Protocol guidelines recommended colposcopy after two reports of ASCUS, or one report of atypical glandular cells of undetermined significance, LSIL or HSIL, squamous cell carcinoma, adenocarcinoma in situ, or adenocarcinoma. These guidelines also recommended biopsy for any suspected lesions.
  • the central histology laboratory made an initial diagnosis from the formalin-fixed tissue specimens for clinical management.
  • a panel of three pathologists made a subsequent consensus diagnosis for HPV- 16 and HPV- 18 associated lesions with the CIN system. This consensus diagnosis also included review of the sections taken at the time of microdissection for PCR detection of lesional HPV DNA.
  • HPV DNA isolated from the cytology specimen MagneticNaPure Total Nucleic Acid system, Roche Diagnostics, Almere, Netherlands
  • cervical biopsy specimen proteinase K extraction
  • SPFlO broad-spectrum primers that amplify a 65 bp region of the Ll gene.
  • a line probe assay (LiPA Kit HPV DSfNO LiPA HPV genotyping assay, SPF-IO system version 1, Inno genetics, Gent, Belgium, manufactured by Labo Bio-medical Products, Rijswijk, Netherlands) detected 25 HPV genotypes (6, 11, 16, 18, 31, 33, 34, 35, 39, 40, 42, 43, 44, 45, 51, 52, 53, 56, 58, 59, 66, 68, 70, and 74).
  • HPV- 16 and HPV- 18 PCR Any specimen that was positive by DNA enzyme immunoassay was tested by type-specific HPV- 16 and HPV- 18 PCR.
  • HPV- 16 type-specific PCR primers amplified a 92 bp segment of the E6/E7 gene and HPV- 18 type-specific PCR primers amplified a 126 bp segment of the Ll gene.
  • MF Baay, WG Quint, J Koudstaal et al Comprehensive study of several general and type- specific primer pairs for detection of human papillomavirus DNA by PCR in paraffin- embedded cervical carcinomas. J Clin Microbiol 34 (1996), pp. 745—747]
  • HPV-DNA test results were concealed from investigators during the study and cytological and histological diagnoses were only revealed for clinical management purposes. Analyses included HPV- 16/18 DNA results for cervical specimens and combined cervical and self-obtained cervicovaginal specimens.
  • Stratified, block randomisation according to validated algorithms was centralised with an internet randomisation system. Stratification was according to age (15-17, 18-21, and 22-25 years) and region (North America and Brazil). Each vaccine dose was attributed a randomly chosen number based on specific participant information entered into the computerised randomisation system by study personnel. Treatment allocation remains concealed from investigators and the women participating in a long-term follow-up study.
  • the intention-to-treat and according-to-protocol cohorts are shown in the figure, in which the reasons for exclusion from analyses are listed in rank order; women who met more than one exclusion criterion were only counted once according to the highest ranking criterion.
  • the cohort for safety analysis included all enrolled women who received at least one dose of vaccine or placebo and complied with specified, minimal protocol requirements (see figure below:)
  • Immunogenicity was assessed in a subset of the according-to-protocol safety cohort, which included women with serology results at months 0, 7, and 18, who received all three doses of study vaccine or placebo according to schedule, complied with the blood sampling schedule, and did not become positive for HPV-16/18-DNA during the trial. Seropositivity rates between the vaccine and placebo groups were compared with Fisher's exact test (p ⁇ O001 judged significant). Geometric mean titres were compared with ANOVA and Kruskal-Wallis test.
  • Tables B and C relate to the "ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial.
  • Table B is a midpoint analysis with data taken from all patients at the timepoint at which at least 50% of the cohort were 18 months after their first vaccination.
  • Table C gives the final results, all data being from subjects at 18 months post first vaccination (month 0). hi the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months.
  • Table B demonstrates that HPV 16 and HPV 18 provide statistically significant cross protection against the group of high risk cancer types 31,33,35,39,45,51,52,56,58,59, 66 and 68.
  • Table C demonstrates that, except for the HPV- 18 related types (which show a very strong trend), there is statistically significant cross-protection against the groups of: HPV 31, 35, 58; HPV 31, 33, 35, 52, 58; and the 12 high risk (non HPV- 16/18) types evaluated.
  • Vaccine efficacy was assessed against infections and diseases related to the 12 high risk cancer types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68, HPV-16 phylogenetic-related types (the groups of; 31, 35, and 58; 31, 33, 35, 52 and 58) and HPV- 18 phylogenetic related types (45 and 59).
  • Table B vaccine efficacy after three doses in preventing incident heterologous infections.
  • N number of subjects in specific cohort n number of subjects with incident HPV infection
  • Nv number of cases and non-cases in vaccine recipients
  • np number of cases in placebo recipients
  • Np number of cases and non-cases in placebo recipients
  • HPV-16 related HPV-16 phylogenetically related types 35, 31, 58 without considering other HPV types
  • HPV-16 related* HPV-16 phylogenetically related types 35, 31 , 58, 33, 52 without considering other HPV types
  • HPV- 18 related HPV- 18 phylogenetically related types 45, 59 without considering other HPV types w HPV- 16 and/or HPV- 18 related: HP V- 16 and/or HPV- 18 phylogenetically related types 35, 31 , 58, 45, 59 without considering other HPV types
  • HPV- 16 and/or HPV-18 related* HPV-16 and/or HPV-18 phylogenetically related types 35, 31 , 58, 33, 52, 45, 59 without considering other HPV types
  • N number of subjects in specific cohort
  • % Vaccine efficacy is 1 - (A/B) x 100, adjusted for relative size of vaccine and placebo group, wherein
  • A % women in vaccine group with incident infection, persistent infection or cytological abnormality, as appropriate for the table
  • mice 10 groups of C57B1/6 mice were used, containing 24 mice per group.
  • mice were vaccinated according to the information below in a 2 dose schedule at day 0 and day 28, using intramuscular administration (1 group of mice were both primed and boosted with NaCl, not listed below).
  • Vaccination was carried out using different HPV virus like particle combinations. 4 different VLPs were used: HPV 16 Ll only VLPs, HPV 18 Ll only VLPs, HPV 31 Ll only VLPs, and HPV 45 Ll only VLPs.
  • VLPs were made and purified essentially according to the disclosure of WO2003077942A2, herein incorporated fully by reference.
  • HPV 16 VLPs were purified using the sequential steps of: anion exchange chromatography (Di methyl amino ethyl - DMAE), anion exchange chromatography (tri methyl amino ethyl - TMAE), hydroxyapatite chromatography, filtration and another anion exchange step, this time using a Di ethyl amino ethyl (DEAE) step, followed by a final filtration.
  • HPV 31 VLPs were made using the same sequence of steps.
  • HPV 18 VLPs were purified using the sequential steps of: anion exchange chromatography (Di methyl amino ethyl - DMAE), anion exchange chromatography (tri methyl amino ethyl - TMAE), hydroxyapatite chromatography, filtration and an octyl sepharose column (hydrophobic interaction chromatography), followed by a final filtration.
  • HPV 45 VLPs were made using the same sequence of steps.
  • the adjuvant used was termed AS04D, at 1/10 of the human dose, which is 5 ⁇ g 3D MPL and 50 ⁇ g aluminium hydroxide in total for each vaccine.
  • HPV virus like particles were combined with aluminium hydroxide and 3D MPL as disclosed in WO00/23105.
  • the 3D-MPL and VLPs were then mixed, and additional aluminium hydroxide added to result in 50 ⁇ g per vaccine dose.
  • Antibody titres were determined using classical ELISA techniques well known in the art at day 14 post the initial vaccination and second vaccination (post I and post II respectively). Intracellular staining (ICS, Roederer et al. 2004 Clin. Immunol. 110: 199) was carried out at 14 days post II to assess CMI responses.
  • results are given in Figures 1 - 18 below.
  • post I and post II data are measurements after vaccine dose I and II respectively.
  • the bar given as "post I booster” reflects the group in which NaCl was given first, followed by either a bivalent or tetravalent vaccine dose at day 28.
  • Figures 1-9 illustrate the antibody responses generated by different vaccination regimes.
  • Figures 10 - 18 illustrate the CMI responses generated by different vaccination regimes.
  • a heterologous booster comprised of HPV 31 and 45 Ll VLPs is effective in boosting homologous HPV 16 and 18 Ll VLP responses induced by HPV 16 and 18 Ll VLP priming.
  • a heterologous booster comprised of HPV 31 and 45 Ll VLPs is effective in boosting heterologous HPV 31 and 45 Ll VLP responses induced by HPV 16 and 18 Ll VLP priming.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Communicable Diseases (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an L1 protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 L1 components from the first vaccine, and which second vaccine comprises an L1 protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable time interval.

Description

Vaccine
The present invention relates to human papillomavirus (HPV) vaccines.
Background of the Invention
Papillomaviruses are small DNA tumour viruses, which are highly species specific. So far, over 100 individual human papillomavirus (HPV) genotypes have been described. HPVs are generally specific either for the skin (e.g. HPV-I and -2) or mucosal surfaces (e.g. HPV-6 and -11) and usually cause benign tumours (warts) that persist for several months or years. Such benign tumours may be distressing for the individuals concerned but tend not to be life threatening, with a few exceptions.
Some HPVs are also associated with cancers, known as oncogenic HPV types. The strongest positive association between an HPV and human cancer is that which exists between HPV- 16 and HPV-18 and cervical carcinoma. Cervical cancer is the most common malignancy in developing countries, with about 500,000 new cases occurring in the world each year.
Other HPV types which can cause cancer are types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68. Types 16 and 18 are those which have the highest association with cervical cancer. Types 31 and 45 are the types with the next highest association with a cancer risk (Munoz N, Bosch FX, de Sanjose S et al. International Agency for Research on Cancer Multicenter Cervical Cancer Study Group. N EnglJMed 2003; 348: 518-27.)
HPV virus like particles (VLPs) have been suggested as potential vaccines for treatment of HPV. Animal studies have shown that VLPs produce no cross protection against infection for other HPV types - see, for example Suzich, J. A., et al, Proc Natl Acad Sci, 92: 11553-11557, 1995, and Breitburd, Seminars in Cancer Biology, vol 9, 1999, pp 431 - 445.
WO2004/056389 discloses that an HPV 16, 18 VLP vaccine can provide cross protection against infection by HPV types other than 16 and 18. Statistically significant protection was observed against certain groups of HPV types . There is still a need for a vaccine that protects against multiple HPV types.
Statement of invention
The present invention relates to a vaccination schedule for protection against HPV infection and/or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable interval.
The present invention further relates to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type.
The invention further relates to a method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable time interval.
The invention also relates to a method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV types.
The invention also relates to vaccine compositions of the invention per se.
The invention also relates to kits comprising the first and second vaccine compositions of the invention.
In one aspect the invention relates to use of an HPV Ll protein or immunogenic fragment thereof from one first HPV type in the preparation of a medicament for boosting the immune response generated by an HPV Ll protein or immunogenic fragment thereof from a second, different HPV type. In one aspect the Ll protein or fragment thereof from the second HPV type is in the form of a virus like particle and is used to boost the response generated by the Ll protein or fragment thereof from the first HPV type also in the form of a virus like particle.
The invention also relates to the use of HPV Ll, preferably in the form of VLPs, from HPV strains which are not HPV 16, in boosting the response to HPV 16.
The invention also relates to the use of Ll, preferably in the form of VLPs, from HPV strains which are not HPV 18, in boosting the response to HPV 18.
In one aspect the strains for boosting the immune response are those for which some level of cross protection is observed in Example 1, such as HPV 31, HPV 45 and HPV
52.
Figures
Figures 1 and 5 illustrate the antibodies generated to HPV 16 with different prime and boost regimes.
Figure 2 and 6 illustrate the antibodies generated to HPV 18 with different prime and boost regimes. Figure 3 and 7 illustrate the antibodies generated to HPV 31 with different prime and boost regimes.
Figure 4 and 8 illustrate the antibodies generated to HPV 45 with different prime and boost regimes.
Fig 9 illustrates a summary of the antibody responses in Figs 1-8.
Fig 10 and 14 illustrates the % HPV 16 Ll specific T cells in the CD4+ population with different prime and boost regimes.
Fig 11 and 15 illustrates the % HPV 18 Ll specific T cells in the CD4+ population with different prime and boost regimes.
Fig 12 and 16 illustrates the % HPV31 Ll specific T cells in the CD4+ population with different prime and boost regimes.
Fig 13 and 17 illustrates the % HPV45 Ll specific T cells in the CD4+ population with different prime and boost regimes.
Fig 18 illustrates a summary of the CMI data in Figures 10-13.
Detailed description
The general existence of cross protection afforded by HPV 16 and HPV 18 against both incident and persistent infection, as assessed in relation to certain groups of HPV types, has been disclosed in WO2004/056389.
We have surprisingly discovered that the cross protection against certain (non HPV 16, HPV 18) HPV types ( as assessed by the efficacy of an HPV 16 and HPV 18 vaccine against those types), is higher than against certain other (non HPV 16, HPV 18) HPV types. Cross protection may be considered as the protection afforded by a vaccine containing one HPV type against infection (incident or persistent) and/or disease caused by a different HPV type. Cross protection may be assessed by considering the vaccine efficacy (V. E.), wherein the V.E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group for a given type.
Infection may be incident or persistent infection. Disease may be abnormal cytology, ASCUS, CINl, CIN2, CIN3 or cervical cancer related to HPV infection. Infection may be assessed by PCR, for example. Disease may be assessed by histological examination or analysis of biomarkers such as plό.
Some level of cross protection is considered to be present when the cross protection is statistically significantly higher than that given by a placebo. Suitably the level of cross protection is greater than 0% and up to 20%, up to 40%, up to 60%, up to 70%, up to 80%, or greater than 80%, as measured by the vaccine efficacy of an HPV vaccine against infection or disease caused by an HPV type not present in the vaccine, when compared to a placebo.
Such a finding has potential implications for vaccine design and the design of vaccination schedules.
For example, types for which cross protection is observed might be used as a prime or boost for one another, after a suitable interval, as well as providing homologous protection, and may allow the number of vaccinations for any given HPV type to be reduced.
The present invention relates to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable interval. A suitable interval may be 7 days, 2 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 4, months, 5 months, 6 months, 1 year. Vaccination schedules might then be 0, 1 months, or 0, 2 months, or 0, 4 months or 0, 6 months, for example. Generally a suitable interval is one in which the boosting effect of the vaccine delivered second can be observed, for example by measurement of antibody titres or cell mediated immunity. Generally a suitable interval is one in which the primary immune response has been provoked by delivery of a vaccine, as measured by serum antibody titres for example, before delivery of a second vaccine. In one aspect a suitable interval is shortly after the peak of the primary response, typically the antibody response. In one aspect this interval is from 2 - 26 weeks after the initial vaccination, suitably 2 - 22 weeks, 2-18 weeks, 2-14 weeks, 2-12 weeks, 2 - 10 weeks, 2- 8 weeks, 2-6 weeks, and in one aspect 1 month after the initial vaccination.
Oncogenic HPV types include HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68.
Suitably cross protection is observed between at least one component of the first vaccine and one component of the second vaccine. As such, the first vaccine suitably comprises an Ll protein or immunogenic fragment thereof from HPV 16 and HPV 18 and the second vaccine suitably comprises an Ll protein or immunogenic fragment thereof from HPV 31 , or HPV 45 or HPV 52.
In one aspect a first vaccine comprises Ll protein or immunogenic fragment thereof from HPV 16 and HPV 18. In a further aspect the first vaccine includes Ll protein or immunogenic fragment thereof from additional HPV types, such as one or more of HPV types 31,33,35,39,45,51,52,56,58,59,66,68. In one aspect the HPV type is HPV 33.
In another aspect the second vaccine excludes at least the HPV 16 and 18 antigens from the first vaccine and comprises an Ll protein or immunogenic fragment thereof from an HPV type shown to have a cross protective interaction with HPV 16 and/or HPV 18 herein, suitably HPV 31 and/or 45 and/or 52. The second vaccine may include additional types such as one or more of HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, 68. In one aspect the second vaccine comprises Ll protein or immunogenic fragment thereof from HPV 31 , and/or HPV 45. In a further aspect the second vaccine includes Ll protein or immunogenic fragment thereof from type 52.
In a further aspect the second vaccine includes Ll protein or immunogenic fragment thereof from type 58.
The invention thus relates to a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 31 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
The invention also relates to a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 45 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
The invention also relates to a vaccine composition comprising an Ll protein or immunogenic fragment thereof from HPV 52 but excluding an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18.
In another aspect the second vaccine excludes all the HPV Ll containing antigens from the first vaccine. Suitably the first and second vaccines share no identical Ll proteins or identical complete protein fragments. For the avoidance of doubt, there may be regions within the Ll proteins or Ll fragments used in the first and second vaccine that are similar or identical. However use of identical antigens, the antigen being either whole Ll or a fragment thereof, in both the first and second vaccine is not preferred in this aspect.
In one aspect the first and second vaccines do not share an HPV Ll protein or immunogenic fragment thereof from the same HPV type.
In one aspect the components of the first vaccine contain HPV species which are phylogenetically not closely related, such as HPV 16 and HPV 18. In one aspect the components of the second vaccine contain HPV species which are phylogenetically not closely related, such as HPV 31 and HPV 45.
Phylogenetically not closely related types are in different species groups as assessed by de Villiers et al. Virology. 2004 Jun 20;324(l): 17-27.
Suitably the HPV 16 and/or HPV 18 components in the first vaccine component protect against HPV infection and/or disease caused by at least one HPV type in the second vaccine.
Suitably the first and second vaccines of the invention comprise HPV Ll VLPs from the following HPV types: first vaccine a combination of HPV 16, HPV 18 and HPV 33. The first vaccine may contain additionally HPV 58. second vaccine a combination of HPV 31 , HPV 45 and optionally HPV 52 and /or HPV 58.
Suitably the vaccine delivered second boosts the immune response against at least one component in the vaccine delivered first. Boosting can suitably be measured by, for example, antibody titres, using methods standard in the art such as ELISA.
hi one aspect an HPV Ll protein or immunogenic fragment thereof is used for boosting cross reactive antibodies previously raised to a different HPV type.
In one aspect the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a second, different HPV type.
In one aspect the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a homologous HPV type.
In one aspect the invention relates to use of Ll protein or immunogenic fragment thereof from one HPV type in boosting the immune response against a second, different HPV type, wherein the second type is phylogenetically related to the first type. Phylogenetic relationships between HPV types are well known in the art (see e.g. de Villers et al. Virology. 2004 Jun 20;324(l): 17-27). In this publication papillomaviruses can be seen to fall into distinct species which are phylogenetically related. For example, in species 16 are found types 16, 31, 33. In species 7 are found types 18 and 45.
hi another aspect the invention relates to use of HPV 31 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to (generated by) an HPV 16 vaccine comprising an Ll protein or fragment thereof.
In another aspect the invention relates to use of HPV 52 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 16 vaccine comprising an Ll protein or fragment thereof.
In another aspect the invention relates to use of HPV 45 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 18 vaccine comprising an Ll protein or fragment thereof.
In another aspect the invention relates to use of HPV 18 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 45 vaccine comprising an Ll protein or fragment thereof.
In another aspect the invention relates to use of HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 31 vaccine comprising an Ll protein or fragment thereof.
In another aspect the invention relates to use of HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 52 vaccine comprising an Ll protein or fragment thereof.
The present relates in one aspect to a vaccination schedule for protection against HPV infection or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and after a suitable interval a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type. In this aspect of the invention the components of the first and second vaccines as defined above can be delivered in reverse order. By way of example, the first HPV to be delivered might comprise HPV 31 and HPV 45 antigens, while the second vaccine to be delivered comprises HPV 16 and HPV 18 antigens.
The vaccines of the invention can additionally comprise, within the constraints of the invention, antigens from other HPV types, such as other antigenic oncogenic types (e.g. HPV 31,33,35,39,45,51,52,56,58,59,66,68.) , skin types (e.g. types 5, 8) and genital warts types (6, 11).
Suitably each vaccine is capable of protection against persistent infection for HPV types present in the vaccine.
Suitably each vaccine is capable of protection against incident infection for HPV types present in the vaccine.
Incident and persistent cervical infection are defined in Example 1.
Suitably each vaccine is capable of protection against cyto logical abnormalities related to HPV infection (e.g. ASCUS, CIN 1, CIN2, CM3, cervical cancer), suitably cuased by types not present in the vaccine, such as HPV 31, 45 or 52.
Ll proteins or protein fragments from additional HPV types can be included in the vaccine of the invention, such as skin types (in particular HPV 5 and 8) and types associated with genital warts, such as HPV 6 and 11. Types 6 and 11 are not considered oncogenic types herein.
In one aspect the vaccine can comprise HPV Ll protein components, preferably as virus like particles, in different amounts. In one aspect, HPV 16 and HPV 18 VLPs may be provided at a higher dose than other oncogenic types, such as HPV 33 or 58. In one aspect HPV 16 and HPV 18 Ll only VLPs are provided at 20μg per dose for human use. Other HPV VLPs may be used at a lower dose, such as 15 or lOμg per dose for human use.
In one aspect of the invention the vaccine may include an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 or E8. In an alternative aspect the vaccine may lack an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 or E8.
In one aspect a vaccine component of the invention is trivalent (contains an HPV Ll or fragment thereof from 3 different oncogenic HPV types). In a further aspect the vaccine is tetravalent. In a further aspect the vaccine is pentavalent. In a further aspect the vaccine is hexavalent. In a further aspect the vaccine is heptavalent. In a further aspect the vaccine is octavalent. Higher order valancies are also contemplated herein. In further aspects the vaccine is at least tetravalent, or at least pentavalent, or at least hexavalent, or at least heptavalent or at least octavalent with respect to the oncogenic HPV types. In a further aspect the combined vaccines of the invention comprise between them Ll protein or immunogenic fragments thereof from 4, 5, 6, 7, 8, 9 or 10 different HPV types.
Preferably the combination of HPV components within the vaccine does not significantly impact the immunogenicity of any one HPV component. In particular it is preferred that there is no biologically relevant interference between HPV antigens in the combination of the invention, such that the combined vaccine of the invention is able to offer effective protection against infection by each HPV genotype represented in the vaccine. Suitably the immune response against a given HPV type in the combination is at least 50 % of the immune response of that same HPV type when measured individually, preferably 100% or substantially 100%. For responses to the HPV 16 and HPV 18, the combined vaccine of the invention preferably stimulates an immune response which is at least 50% of that provided by a combined HPV 16 / HPV 18 vaccine. Suitably the immune response generated by the vaccine of the invention is at a level in which the protective effect of each HPV type is still seen. The immune response may suitably be measured, for example, by antibody responses, in either preclinical or human experiments. Measurement of antibody responses is well known in the art, and disclosed in (for example) WO03/077942.
Where the vaccine or composition of the invention comprises an immunogenic fragment of Ll, then suitable immunogenic fragments of HPV Ll include truncations, deletions, substitution, or insertion mutants of Ll . Such immunogenic fragments are suitably capable of raising an immune response (if necessary, when adjuvanted), said immune response being capable of recognising an Ll protein such as a virus like particle, from the HPV type from which the Ll protein was derived.
In one aspect a suitable immunogenic fragment of HPV 16 is capable of cross protection against at least one of HPV 31 and HPV 52, and in an aspect of the invention, capable of cross protection against both.
In another aspect a suitable immunogenic fragment of HPV 18 is capable of cross protection against HPV 45.
Cross protection obtainable by immunogenic fragments of HPV 16 and/or HPV 18 can be assessed by trials in humans, for example as outlined in Example 1.
Similarly, different vaccines according to the present invention can be tested using standard techniques, for example as in Example 1, or in standard preclinical models, to confirm that the vaccine is immunogenic.
Suitable immunogenic Ll fragments include truncated Ll proteins. In one aspect the truncation removes a nuclear localisation signal. In another aspect the truncation is a C terminal truncation. In a further aspect the C terminal truncation removes fewer than 50 amino acids, such as fewer than 40 amino acids. Where the Ll is from HPV 16 then in another aspect the C terminal truncation removes 34 amino acids from HPV 16 Ll. Where the Ll is from HPV 18 then in a further aspect the C terminal truncation removes 35 amino acids from HPV 18 Ll.
In one aspect the HPV 16 sequence is the following sequence: (SEQ ID NO: 1)
MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKI 60 LVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGVGISGH 120
PLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAV 180
NPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICKYPDYIKMVSE 240
PYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMV 300
TSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNF 360
KEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRF 420
VTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQ 471
In another aspect the invention relates to virus like particles consisting only of HPV 16 Ll having the amino sequence above, and to compositions containing such VLPs.
The HPV 16 sequence may also be that disclosed in WO9405792 or US6649167, for example, suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
In one aspect the HPV 18 sequence is the following sequence: (SEQ ID NO: 2)
MALWRPSDNTVYLPPPSVARVVNTDDYVTRTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQ 60
DIPKVSAYQYRVFR VQLPDPNKFGLPDNSIYNPETQRL VW ACVGVEIGRGQP LGVGLSGH 120
PFYNKLDDTESSHAATSNVSED VRDNVSVDYKQTQLCILGCAP AIGEHWAKGTACKSRPL 180
SQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSAD 240
PYGDSMFFCLRREQLF ARHFWNRAGTMGDTVPPSLYIKGTGMRASPGSCVYSPSPSGSIV 300
TSDSQLFNKP YWLHKAQGHNNG VCWHNQLF VTV VDTTRSTNLTIC ASTQSP VPGQ YD ATK 360
FKQYSRHVEEYDLQFIFQLCTITLT ADVMSYIHSMNSSILEDWNFGVPPPPTTSL VDTYR 420
FVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQ 472
In another aspect the invention relates to virus like particles consisting only of HPV 18 Ll having the amino sequence above, and to compositions containing such VLPs.
An alternative HPV 18 sequence is disclosed in WO9629413, which may be suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
Other HPV 16 and HPV 18 sequences are well known in the art and may be suitable for use in the present invention.
Where the Ll protein is from another HPV type then C terminal truncations corresponding to those made for HPV 16 and HPV 18 may be used, based upon DNA or protein sequence alignments. Suitable truncations of, for example, HPV 31, HPV 45, HPV 52, HPV 58, HPV 33 may also be made, in one aspect removing equivalent C terminal portions of the Ll protein to those described above, as assessed by sequence alignment.
Nucleotidic Sequence of Truncated Ll from serotype 31(SEO ID NO: 5)
ATGTCTCTGTGGCGGCCTAGCGAGGCTACTGTCTACTTACCACCTGTCCCAGTGTCTAAAGTTGTAAGCA 70 CGGATGAATATGTAACACGAACCAACATATATTATCACGCAGGCAGTGCTAGGCTGCTTACAGTAGGCCA 140
CTGAAACTCAACGCTTAGTTTGGGCCTGTGTTGGTTTAGAGGTAGGTCGCGGGCAGCCATTAGGTGTAGG 350 TATTAGTGGTCATCCATTATTAAATAAATTTGATGACACTGAAAACTCTAATAGATATGCCGGTGGTCCT 420
Figure imgf000015_0001
TTTACTGCTTTACAAGACACTAAAAGTAATGTTCCTTTGGACATTTGTAATTCTATTTGTAAATATCCAG 700 ATTATCTTAAAATGGTTGCTGAGCCATATGGCGATACATTATTTTTTTATTTACGTAGGGAACAAATGTT 770 TGTAAGGCATTTTTTTAATAGATCAGGCACGGTTGGTGAATCGGTCCCTACTGACTTATATATTAAAGGC 840 TCCGGTTCAACAGCTACTTTAGCTAACAGTACATACTTTCCTACACCTAGCGGCTCCATGGTTACTTCAG 910 ATGCACAAATTTTTAATAAACCATATTGGATGCAACGTGCTCAGGGACACAATAATGGTATTTGTTGGGG 980 CAATCAGTTATTTGTTACTGTGGTAGATACCACACGTAGTACCAATATGTCTGTTTGTGCTGCAATTGCA 1050 AACAGTGATACTACATTTAAAAGTAGTAATTTTAAAGAGTATTTAAGACATGGTGAGGAATTTGATTTAC 1120
TGCTATTTTGGAAGATTGGAATTTTGGATTGACCACACCTCCCTCAGGTTCTTTGGAGGATACCTATAGG 1260
ATTATGTATTTTGGGAGGTTAATTTAAAAGAAAAGTTTTCTGCAGATTTAGATCAGTTTCCACTGGGTCG 1400 CAAATTTTTATTACAGTAA 1419
In another aspect the invention relates to virus like particles consisting only of HPV 31 Ll having the amino sequence encoded by the sequence above, and to compositions containing such VLPs.
Nucleotidic Sequence of Truncated Ll from serotype 45(SEO ID NO: 6)
Figure imgf000015_0002
TATAGGGTGTTTAGAGTAGCTTTACCCGATCCTAATAAATTTGGATTACCTGATTCTACTATATATAATC 280 CTGAAACACAACGTTTGGTTTGGGCATGTGTAGGTATGGAAATTGGTCGTGGGCAGCCTTTAGGTATTGG 350 CCTAAGTGGCCATCCATTTTATAATAAATTGGATGATACAGAAAGTGCTCATGCGGCTACGGCTGTTGTT 420
490 CTGCTATTGGTGAGCACTGGGCCAAGGGCACACTTTGTAAACCTGCACAATTGCAGCCTGGTGACTGTCC 560
TCCTTTGGAACTTAAAAACACCATTATTGAGGATGGTGATATGGTGGATACAGGTTATGGGGCAATGGAT 630
TTTAGTACATTGCAGGATACAAAGTGCGAGGTTCCATTAGACATTTGTCAATCCATCTGTAAATATCCAG 700
ATTATTTGCAAATGTCTGCTGATCCCTATGGGGATTCTATGTTTTTTTGCCTACGCCGTGAACAACTGTT 770
TGCAAGACATTTTTGGAATAGGGCAGGTGTTATGGGTGACACAGTACCTACAGACCTATATATTAAAGGC 840
ACTAGCGCTAATATGCGTGAAACCCCTGGCAGTTGTGTGTATTCCCCTTCTCCCAGTGGCTCTATTATTA 910
TTGGCATAATCAGTTGTTTGTTACTGTAGTGGACACTACCCGCAGTACTAATTTAACATTATGTGCCTCT 1050
ACACAAAATCCTGTGCCAGGTACATATGATCCTACTAAGTTTAAGCACTATAGTAGACATGTGGAGGAAT 1120
ATGATTTACAGTTTATTTTTCAGTTGTGCACTATTACTTTAACTGCAGAGGTTATGTCATATATCCATAG 1190
ACATATCGTTTTGTGCAATCAGTTGCTGTTACCTGTCAAAAGGATACTACACCTCCAGAAAAGCAGGATC 1330
CATATGATAAATTAAAGTTTTGGACTGTTGACCTAAAGGAAAAATTTTCCTCCGATTTGGATCAATATCC 1400 CCTTGGTCGAAAGTTTTTAGTTCAGTAA
In another aspect the invention relates to virus like particles consisting only of HPV 45 Ll having the amino sequence encoded by the sequence above, and to compositions containing such VLPs.
The Ll protein or fragment of the invention may optionally be in the form of a fusion protein, such as the fusion of the Ll protein with L2 or an early protein.
The HPV Ll protein is suitably in the form of a capsomer or virus like particle (VLP). In one aspect HPV VLPs may be used in the present invention. HPV VLPs and methods for the production of VLPs are well known in the art. VLPs typically are constructed from the Ll and optionally L2 structural proteins of the virus, see for example WO9420137, US5985610, W09611272, US6599508B1, US6361778B1, EP 595935. Any suitable HPV VLP may be used in the present invention which provides cross protection, such as an Ll or Ll + L2 VLP.
Suitably the VLP is an Ll -only VLP.
VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
The VLP may comprise full length Ll protein. In one aspect the Ll protein used to form the VLP is a truncated Ll protein, as described above. VLPs may be made in any suitable cell substrate such as yeast cells or insect cells e.g. baculovirus cells, and techniques for preparation of VLPs are well known in the art, such as WO9913056, US 6416945B1 , US 6261765B1 and US6245568, and references therein, the entire contents of which are hereby incorporated by reference.
VLPS are suitably made by disassembly and reassembly techniques, which can provide for more stable and/or homogeneous papillomavirus VLPs. For example, McCarthy et al, 1998 "Quantitative Disassembly and Reassembly of Human Papillomavirus Type 11 Virus like Particles in Vitro" J. Virology 72(1):33-41, describes the disassembly and reassembly of recombinant Ll HPV 11 VLPs purified from insect cells in order to obtain a homogeneous preparation of VLP's. WO9913056 and US6245568 also describe disassembly/reassembly processes for making HPV VLPs.
In one aspect HPV VLPS are made as described WO9913056 or US6245568
The HPV Ll the invention may be combined with an adjuvant or imunostimulant such as, but not limited to, detoxified lipid A from any source and non-toxic derivatives of lipid A, saponins and other reagents capable of stimulating a THl type response.
It has long been known that enterobacterial lipopolysaccharide (LPS) is a potent stimulator of the immune system, although its use in adjuvants has been curtailed by its toxic effects. A non-toxic derivative of LPS, monophosphoryl lipid A (MPL), produced by removal of the core carbohydrate group and the phosphate from the reducing-end glucosamine, has been described by Ribi et al (1986, Immunology and Immunopharmacology of bacterial endotoxins, Plenum Publ. Corp., NY, p407-419) and has the following structure:
Figure imgf000018_0001
A further detoxified version of MPL results from the removal of the acyl chain from the 3-position of the disaccharide backbone, and is called 3-O-Deacylated monophosphoryl lipid A (3D-MPL). It can be purified and prepared by the methods taught in GB 2122204B, which reference also discloses the preparation of diphosphoryl lipid A, and 3-O-deacylated variants thereof.
A suitable form of 3D-MPL is in the form of an emulsion having a small particle size less than 0.2μm in diameter, and its method of manufacture is disclosed in WO 94/21292. Aqueous formulations comprising monophosphoryl lipid A and a surfactant have been described in WO9843670A2.
The bacterial lipopolysaccharide derived adjuvants to be formulated in the compositions of the present invention may be purified and processed from bacterial sources, or alternatively they may be synthetic. For example, purified monophosphoryl lipid A is described in Ribi et al 1986 (supra), and 3-O-Deacylated monophosphoryl or diphosphoryl lipid A derived from Salmonella sp. is described in GB 2220211 and US 4912094. Other purified and synthetic lipopolysaccharides have been described (Hilgers et al., 1986, Int. Arch. Allergy. Immunol, 79(4):392-6; Hilgers et al, 1987, Immunology, 60(l):141-6; and EP O 549 074 Bl). In one aspect the bacterial lipopolysaccharide adjuvant is 3D-MPL.
Accordingly, the LPS derivatives that may be used in the present invention are those immunostimulants that are similar in structure to that of LPS or MPL or 3D-MPL. In another aspect of the present invention the LPS derivatives may be an acylated monosaccharide, which is a sub-portion to the above structure of MPL.
Saponins are taught in: Lacaille-Dubois, M and Wagner H. (1996. A review of the biological and pharmacological activities of saponins. Phytomedicine vol 2 pp 363- 386). Saponins are steroid or triterpene glycosides widely distributed in the plant and marine animal kingdoms. Saponins are noted for forming colloidal solutions in water which foam on shaking, and for precipitating cholesterol. When saponins are near cell membranes they create pore-like structures in the membrane which cause the membrane to burst. Haemolysis of erythrocytes is an example of this phenomenon, which is a property of certain, but not all, saponins.
Saponins are known as adjuvants in vaccines for systemic administration. The adjuvant and haemolytic activity of individual saponins has been extensively studied in the art (Lacaille-Dubois and Wagner, supra). For example, Quil A (derived from the bark of the South American tree Quillaja Saponaria Molina), and fractions thereof, are described in US 5,057,540 and "Saponins as vaccine adjuvants", Kensil, C. R., CritRev Ther Drug Carrier Sy st, 1996, 12 (l-2):l-55; and EP 0 362 279 Bl. Particulate structures, termed Immune Stimulating Complexes (ISCOMS), comprising fractions of Quil A are haemolytic and have been used in the manufacture of vaccines (Morein, B., EP 0 109 942 Bl; WO 96/11711; WO 96/33739). The haemolytic saponins QS21 and QS 17 (HPLC purified fractions of Quil A) have been described as potent systemic adjuvants, and the method of their production is disclosed in US Patent No.5,057,540 and EP 0 362 279 Bl. Other saponins which have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al., Vaccine, 10(9):572-577, 1992).
An enhanced system involves the combination of a non-toxic lipid A derivative and a saponin derivative particularly the combination of QS21 and 3D-MPL as disclosed in WO 94/00153, or a less reactogenic composition where the QS21 is quenched with cholesterol as disclosed in WO 96/33739.
A particularly potent adjuvant formulation involving QS21 and 3D-MPL in an oil in water emulsion is described in WO 95/17210 and use of this adjuvant forms an aspect of the invention.
Accordingly in one embodiment of the present invention there is provided a vaccine adjuvanted with detoxified lipid A or a non-toxic derivative of lipid A, more suitably adjuvanted with a monophosphoryl lipid A or derivative thereof.
In one aspect the vaccine additionally comprises a saponin, for example QS21.
In one aspect the formulation additionally comprises an oil in water emulsion. The present invention also provides a method for producing a vaccine formulation comprising mixing an L2 peptide of the present invention together with a pharmaceutically acceptable excipient, such as 3D-MPL.
Additional components that may be included present in an vaccine formulation according to the invention include non-ionic detergents such as the octoxynols and polyoxyethylene esters as described herein, particularly t-octylphenoxy polyethoxyethanol (Triton X-IOO) and polyoxyethylene sorbitan monooleate (Tween 80); and bile salts or cholic acid derivatives as described herein, in particular sodium deoxycholate or taurodeoxycholate. Thus, in one aspect of the invention a formulation comprises 3D-MPL, Triton X-IOO, Tween 80 and sodium deoxycholate, which may be combined with an L2 antigen preparation to provide a suitable vaccine.
In one embodiment of the present invention, the vaccine comprises a vesicular adjuvant formulation comprising cholesterol, a saponin and an LPS derivative. In this regard the adjuvant formulation suitably comprises a unilamellar vesicle comprising cholesterol, having a lipid bilayer suitably comprising dioleoyl phosphatidyl choline, wherein the saponin and the LPS derivative are associated with, or embedded within, the lipid bilayer. In one aspect these adjuvant formulations comprise QS21 as the saponin, and 3D-MPL as the LPS derivative, wherein the ratio of QS21 :cholesterol is from 1 :1 to 1 :100 weight/weight, and in one aspect, a ratio of 1 :5 weight/weight. Such adjuvant formulations are described in EP 0 822 831 B, the disclosure of which is incorporated herein by reference.
Suitably the vaccines of the invention are used in combination with aluminium, and are suitably adsorbed or partially adsorbed onto aluminium adjuvants. Suitably the adjuvant is an aluminium salt, which may be in combination with 3D MPL, such as aluminium phosphate and 3D MPL. Aluminium hydroxide, optionally in combination with 3D MPL is also suitable.
In another aspect of the present invention the vaccine comprises the combination of HPV VLPs with an aluminium salt or with an aluminium salt + 3D MPL. Aluminium hydroxide is suitable as the aluminium salt.
The vaccine may also comprise aluminium or an aluminium compound as a stabiliser.
hi another aspect the adjuvant may be a combination of an oil-in-water emulsion adjuvant and 3D MPL. In one aspect the oil-in-water emulsion comprises a metabolisable oil, a sterol and an emulsifying agent.
The vaccines of the invention may be provided by any of a variety of routes such as oral delivery (e.g. see WO9961052 A2) , topical, subcutaneous, mucosal (typically intravaginal), intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository.
Optionally the vaccine may also be formulated or co-administered with other HPV antigens or non-HPV antigens. Suitably these non-HPV antigens can provide protection against other diseases, such as sexually transmitted diseases such as herpes simplex virus, EBV, chlamydia and HFV. We particularly prefer that the vaccine comprises gD or a truncate thereof from HSV. In this way the vaccine provides protection against both HPV and HSV. The dosage of the vaccine components will vary with the condition, sex, age and weight of the individual, the administration route and HPV of the vaccine. The quantity may also be varied with the number of VLP types. Suitably the delivery is of an amount of vaccine suitable to generate an immunologically protective response. Suitably each vaccine dose comprises 1-100 μg of each VLP, in one aspect 5-80μg, in another aspect 5- 30 μg each VLP, in a further aspect 5-20 μg of each VLP, in a yet further aspect 5μg, 6μg, lOμg, 15 μg or 20μg.
For all vaccines of the invention, in one aspect the vaccine is used for the vaccination of adolescent girls aged 10-15, such as 10-13 years. However, older girls above 15 years old and adult women may also be vaccinated. The vaccine may also be administered to women following an abnormal pap smear or after surgery following removal of a lesion caused by HPV, or who are seronegative and DNA negative for HPV cancer types.
In one aspect the vaccine of the invention is used to vaccinate males.
In one aspect the vaccine is delivered in a 2 dose regime, for example in a 0, 1 month regime or 0, 6 month regime respectively. The vaccination regime may incorporate a booster injection after 5 to 10 years, such as 10 years.
In one aspect the invention relates to a three dose vaccine, in which (for example) a first vaccine and second vaccine are delivered, the first and second vaccine being different, followed by a third vaccine containing one or more or all of the HPV elements of the first or second vaccines. In one aspect the first and second vaccines are completely different with respect to the HPV Ll components.
For example, a first vaccine may comprise or consist of HPV 16 and HPV 18 Ll protein. The second vaccine may consist of HPV 31 and HPV 45 Ll protein. A third vaccine may comprise Ll protein from all 4 HPV types, HPV 16, 18, 31 and 45.
In another aspect the invention relates to a three dose vaccine, in which (for example) a first HPV vaccine and second HPV vaccine are delivered, the first and second vaccine being different, followed by a third vaccine, the third vaccine containing none of the HPV Ll components of the first or second vaccines.
In one aspect the vaccine is a liquid vaccine formulation, although the vaccine may be lyophilised and reconstituted prior to administration.
The teaching of all references in the present application, including patent applications and granted patents, are herein fully incorporated by reference.
The vaccines of the invention comprise certain HPV components as laid out above. In a further aspect of the invention the vaccine consists essentially of, or consists of, said components.
The term 'vaccine', as used in the present invention, refers to a composition that comprises an immunogenic component capable of provoking an immune response in an individual, such as a human, optionally when suitably formulated or adjuvanted. A vaccine suitably elicts a protective immune response against incident infection, or persistent infection, or cytological abnormality such as ASCUS, CINl, CIN2 CIN3, or cervical cancer caused by one or more HPV types.
The present invention is now described with respect to the following examples which serve to illustrate the invention.
Example 1
Precise details of the experiment carried out are provided in Harper et al, the Lancet. 2004 Nov 13;364(9447):1757-65. In summary, healthy women between the ages of 15 and 25 years were immunised with a mixture of HPV 16 and HPV 18 Ll VLPs. The women at enrolment were: 1) seronegative for HPV- 16 and HPV-18; 2) negative for high risk HPV infection of the cervix (detected by HPV PCR); 3) had 6 or fewer lifetime sexual partners and 4) had normal PAP smears.
The mixture comprised, per 0.5 ml dose, 20 μg of HPV- 16 Ll VLP, 20 μg of HPV- 18 Ll VLP and was adjuvanted with 500 μg of aluminum hydroxide and 50 μg of 3D MPL. The placebo group was injected with 500 μg of aluminum hydroxide alone.
The vaccine efficacy (V. E.) against certain cancer HPV types was assessed, wherein the V. E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group.
Cross protection was assessed by detecting the presence of nucleic acid specific for various oncogenic types in the vaccinees and control group. Detection was carried out using techniques as described in WO03014402, and references therein, particularly for non-specific amplification of HPV DNA and subsequent detection of DNA types using a LiPA system as described in WO 99/14377, and in Kleter et al, [Journal of Clinical Microbiology (1999), 37 (8): 2508-2517], the whole contents of which are herein specifically incorporated by reference.
Any suitable method can, however, be used for the detection of HPV DNA in a sample, such as type specific PCR using primers specific for each HPV type of interest. Suitable primers are known to the skilled person, or can be easily constructed given that the sequences of the oncogenic HPV types are known.
In detail, the methods section of the Lancet paper is reproduced here, for completeness:
The primary objective of this study was to assess vaccine efficacy in the prevention of infection with HPV-16, HPV-18, or both (HPV-16/18), between months 6 and 18 in participants who were initially shown to be seronegative for HPV-16/18 by ELISA and negative for HPV- 16/18 DNA by PCR. Secondary objectives included: evaluation of vaccine efficacy in the prevention of persistent infection with HPV-16/18, and the evaluation of vaccine efficacy in the prevention of cytologically confirmed low-grade squamous intraepithelial lesions (LSIL), high-grade squamous intraepithelial lesions (HSIL), and histologically confirmed LSIL (CIN 1), HSIL (CIN 2 or 3) squamous cell cancer, or adenocarcinoma associated with HPV-16/18 infection between months 6 and 18, and months 6 and 27. The prevention of atypical squamous cells of undetermined significance (ASCUS) cytology associated with HPV-16/18 infection was added post-hoc to the outcome analyses.
We also did an exploratory analysis of the histopathological endpoints CIN 1 and 2 associated with HPV-16/18 DNA detected by PCR in lesional tissue. Other objectives included the assessment of vaccine immunogenicity, safety, and tolerability.
Investigators in North America (Canada and the USA) and Brazil recruited women for this efficacy study through advertisements or previous participation in an HPV cross- sectional epidemiology study that took place between July and December, 2000.
For each of the 32 study sites, an institutional review board approved the protocol, consent forms, and amendments. Women signed separate written consents for study participation and colposcopy. For those under 18 years, parental consent and assent from the participant were obligatory.
There were two study phases: an initial phase for vaccination and follow-up that concluded at month 18; and a blinded follow-up extension phase that concluded at month 27.
Women eligible for the initial phase (months 0-18) included healthy women aged 15- 25 years, who had had no more than six sexual partners, no history of an abnormal Pap test or ablative or excisional treatment of the cervix, and no ongoing treatment for external condylomata; and who were cytologically negative, seronegative for HPV- 16 and HPV- 18 antibodies by ELISA, and HPV-DNA-negative by PCR for 14 high-risk HPV types (16, 18, 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68) no more than 90 days before study entry. Women who completed the initial phase of the study earliest, and who did not have ablative or excisional therapy of the cervix, or hysterectomy after enrolment, were eligible to participate in the extension phase of the study (months 18-27).
Procedures
Each dose of the bivalent HPV- 16/18 virus-like particle vaccine (GlaxoSmithKline Biologicals, Rixensart, Belgium) contained 20 /*g of HPV-16 Ll virus-like particle and 20 Mg of HPV-18 Ll virus-like particle. Each type of virus-like particle was produced on Spodoptera frugiperda Sf-9 and Trichoplusia ni Hi-5 cell substrate with AS04 adjuvant containing 500 ^g aluminum hydroxide and 50 Pg 3-deacylated monophosphoryl lipid A (MPL, Corixa, Montana, USA) provided in a monodose vial. The placebo contained 500 Pg of aluminum hydroxide per dose, and was identical in appearance to the HPV- 16/ 18 vaccine. Every study participant received a 0 5 mL dose of vaccine or placebo at 0 months, 1 month, and 6 months.
Health-care providers obtained cervical specimens with a cervical brush and spatula (washed in PreservCyt, Cytyc Corporation, Boxborough, MA, USA) for cytology and HPV DNA testing at screening and months 6, 12, and 18. At months 0 and 6, and subsequently every 3 months, women self-obtained cervicovaginal samples with two sequential swabs (placed in PreservCyt) for HPV DNA testing. [ DM Harper, WW Noll, DR Belloni and BF. Cole, Randomized clinical trial of PCR-determined human papillomavirus detection methods: self-sampling versus clinician-directed — biologic concordance and women's preferences. Am J Obstet Gynecol 186 (2002), pp. 365- 373] A central laboratory (Quest Diagnostics, Teterboro, NJ, USA) reported cytology results (ThinPrep, Cytyc Corporation) by use of the 1991 Bethesda classification system.
Protocol guidelines recommended colposcopy after two reports of ASCUS, or one report of atypical glandular cells of undetermined significance, LSIL or HSIL, squamous cell carcinoma, adenocarcinoma in situ, or adenocarcinoma. These guidelines also recommended biopsy for any suspected lesions.
The central histology laboratory made an initial diagnosis from the formalin-fixed tissue specimens for clinical management. A panel of three pathologists made a subsequent consensus diagnosis for HPV- 16 and HPV- 18 associated lesions with the CIN system. This consensus diagnosis also included review of the sections taken at the time of microdissection for PCR detection of lesional HPV DNA.
HPV DNA isolated from the cytology specimen (MagNaPure Total Nucleic Acid system, Roche Diagnostics, Almere, Netherlands) and from the cervical biopsy specimen (proteinase K extraction) was amplified from an aliquot of purified total DNA with the SPFlO broad-spectrum primers that amplify a 65 bp region of the Ll gene.[ B Kleter, LJ van Doom, J ter Schegget et al, Novel short-fragment PCR assay for highly sensitive broad-spectrum detection of anogenital human papillomaviruses. Am J Pathol 153 (1998), pp. 1731-1739: LJ van Doom, W Quint, B Kleter et al, Genotyping of human papillomavirus in liquid cytology cervical specimens by the PGMY line blot assay and the SPF(IO) line probe assay. J Clin Microbiol 40 (2002), pp. 979-983 and WG Quint, G Scholte, LJ van Doom, B Kleter, PH Smits and J. Lindeman, Comparative analysis of human papillomavirus infections in cervical scrapes and biopsy specimens by general SPF(IO) PCR and HPV genotyping. J Pathol 194 (2001), pp. 51-58] The amplification products were detected by a DNA enzyme immunoassay. A line probe assay (LiPA Kit HPV DSfNO LiPA HPV genotyping assay, SPF-IO system version 1, Inno genetics, Gent, Belgium, manufactured by Labo Bio-medical Products, Rijswijk, Netherlands) detected 25 HPV genotypes (6, 11, 16, 18, 31, 33, 34, 35, 39, 40, 42, 43, 44, 45, 51, 52, 53, 56, 58, 59, 66, 68, 70, and 74). [B Kleter, LJ van Doom, L Schrauwen et al, Development and clinical evaluation of a highly sensitive PCR-reverse hybridization line probe assay for detection and identification of anogenital human papillomavirus. J Clin Microbiol 37 (1999), pp. 2508-2517] Any specimen that was positive by DNA enzyme immunoassay was tested by type-specific HPV- 16 and HPV- 18 PCR. HPV- 16 type-specific PCR primers amplified a 92 bp segment of the E6/E7 gene and HPV- 18 type-specific PCR primers amplified a 126 bp segment of the Ll gene. [MF Baay, WG Quint, J Koudstaal et al, Comprehensive study of several general and type- specific primer pairs for detection of human papillomavirus DNA by PCR in paraffin- embedded cervical carcinomas. J Clin Microbiol 34 (1996), pp. 745—747]
We defined incident cervical infection with HPV- 16/ 18 as at least one positive PCR result for HPV-16 or HPV-18 during the trial, and persistent infection with HPV- 16/18 as at least two positive HPV-DNA PCR assays for the same viral genotype separated by at least 6 months. [ H Richardson, G Kelsall, P Tellier et ai, The natural history of type-specific human papillomavirus infections in female university students. Cancer Epidemiol Biomarkers Prev 12 (2003), pp. 485^90 and AB Moscicki, JH Ellenberg, S Farhat and J. Xu, Persistence of human papillomavirus infection in HIV- infected and -uninfected adolescent girls: risk factors and differences, by phylogenetic type. J Infect Dis 190 (2004), pp. 37-45] HPV-DNA test results were concealed from investigators during the study and cytological and histological diagnoses were only revealed for clinical management purposes. Analyses included HPV- 16/18 DNA results for cervical specimens and combined cervical and self-obtained cervicovaginal specimens.
We collected serum from study participants at months 0, 1, 6, 7, 12, and 18 for assessment of immunogenicity. Serological testing for antibodies to HPV- 16 and HPV-18 virus-like particles was by ELISA. Recombinant HPV-16 or HPV-18 virus- like particles were used as coating antigens for antibody detection (see webappendix http://image.thelancet.com/extras/04artl0103webappendix.pdf). Seropositivity was defined as a titre greater than or equal to the assay cut-off titre established at 8 ELISA units/mL for HPV-16 and 7 ELISA units/mL for HPV-18. Typical natural titres were determined by use of blood samples obtained from women in the preceding epidemiology study who were found to be seropositive for HPV-16 or HPV-18 by ELISA.
Women recorded symptoms experienced during the first 7 days after vaccination on diary cards with a three-grade scale of symptom intensity. Additionally, they reported to study personnel by interview all adverse events within the first 30 days after vaccination. Information on serious adverse events and pregnancies was collected throughout the study.
Statistical methods
Assuming a 6% cumulative incidence rate of both HPV-16 and HPV-18 type infections over 12 months, we estimated that 500 women per treatment group would provide 80% power to assess a lower limit of the 95% CI of the vaccine efficacy above zero. We assumed an 80% retention rate over 18 months. Interim analyses for efficacy, safety, and imniunogenicity were done for future study planning purposes only; the O'Brien and Fleming method was used to adjust the αevalue for the final analysis after interim analyses occurred (overall
Figure imgf000029_0001
two-sided test).[ PC O'Brien and TR. Fleming, A multiple testing procedure for clinical trials. Biometrics 35 (1979), pp. 549-556]
Stratified, block randomisation according to validated algorithms was centralised with an internet randomisation system. Stratification was according to age (15-17, 18-21, and 22-25 years) and region (North America and Brazil). Each vaccine dose was attributed a randomly chosen number based on specific participant information entered into the computerised randomisation system by study personnel. Treatment allocation remains concealed from investigators and the women participating in a long-term follow-up study.
The intention-to-treat and according-to-protocol cohorts are shown in the figure, in which the reasons for exclusion from analyses are listed in rank order; women who met more than one exclusion criterion were only counted once according to the highest ranking criterion. We refer to the sets of participants entered in the intention- to-treat and according-to-protocol analyses as cohorts, although the information used to restrict subject inclusion in the according-to-protocol was only known after follow- up.
We did both according-to-protocol and intention-to-treat analyses for efficacy. Calculation of vaccine efficacy in the according-to-protocol 18-month analysis was based on the proportion of participants with HPV- 16/18 infection in the vaccinated versus placebo groups. Vaccine efficacy was defined as 1 minus the ratio between these two proportions; 95% CIs measured the precision of the efficacy estimates, p values were calculated with the two-sided Fisher's exact test. Corresponding rates were expressed as the numbers of cases with the outcome divided by the numbers of participants at risk. The according-to-protocol 18-month cohort included enrolled women who received three scheduled doses of vaccine and complied with the protocol as described in the figure. Calculation of vaccine efficacy in the intention-to-treat and according-to-protocol 27- month analyses was based on the Cox proportional hazard model using the time-to- occurrence of cases with HPV- 16/ 18 infection in the vaccinated versus placebo groups. This allowed controlling for the accrued person-time data in each group. Vaccine efficacy was calculated using 1 minus the hazard ratio and p values calculated using the log rank test. Corresponding rates were expressed as the number of cases divided by the total person-time. All enrolled women who received at least one dose of vaccine or placebo, were negative for high-risk HPV-DNA at month 0, and had any data available for outcome measurement were included in the intention- to-treat cohort. The according-to-protocol 27-month cohort included outcome results from the according-to-protocol 18-month cohort and results that occurred during the extension phase (from 18 months to 27 months).
Calculation of p values for the safety analysis was performed using Fisher's exact test comparisons. The cohort for safety analysis included all enrolled women who received at least one dose of vaccine or placebo and complied with specified, minimal protocol requirements (see figure below:)
Figure imgf000031_0001
Immunogenicity was assessed in a subset of the according-to-protocol safety cohort, which included women with serology results at months 0, 7, and 18, who received all three doses of study vaccine or placebo according to schedule, complied with the blood sampling schedule, and did not become positive for HPV-16/18-DNA during the trial. Seropositivity rates between the vaccine and placebo groups were compared with Fisher's exact test (p<O001 judged significant). Geometric mean titres were compared with ANOVA and Kruskal-Wallis test.
Block randomisation and statistical analyses were done with SAS version 8.2 (SAS Institute, Cary, North Carolina).
Initial analysis and results
Results of the initial analysis on cross protection are presented in patent application WO2004/056389, the whole contents of which herein incorporated by reference.
An initial analysis was carried out on an "ITT" (Intention To Treat cohort, representing all individuals who received at least one dose of vaccine). This data is shown in Table A.
The results presented in Tables B and C relate to the "ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial. Table B is a midpoint analysis with data taken from all patients at the timepoint at which at least 50% of the cohort were 18 months after their first vaccination. Table C gives the final results, all data being from subjects at 18 months post first vaccination (month 0). hi the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months.
As demonstrated by the data presented in table A, immunization with a mixture of HPV 16 and HPV 18 VLPs provided apparent cross-protection against other HPV types. At this point the sample sizes are too small to provide for a rigorous statistical analysis, however the data demonstrate a positive trend and suggest that immunization with HPV 16 and HPV 18 VLPs will be efficacious against infection with other HPV types.
This was confirmed as the study progressed.
Table B demonstrates that HPV 16 and HPV 18 provide statistically significant cross protection against the group of high risk cancer types 31,33,35,39,45,51,52,56,58,59, 66 and 68.
Table C demonstrates that, except for the HPV- 18 related types (which show a very strong trend), there is statistically significant cross-protection against the groups of: HPV 31, 35, 58; HPV 31, 33, 35, 52, 58; and the 12 high risk (non HPV- 16/18) types evaluated.
Further analysis was carried out on the specific cross protection against specific types.
Vaccine efficacy was assessed against infections and diseases related to the 12 high risk cancer types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68, HPV-16 phylogenetic-related types (the groups of; 31, 35, and 58; 31, 33, 35, 52 and 58) and HPV- 18 phylogenetic related types (45 and 59).
An analysis was carried out on an" ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial. In the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months.
Results
As demonstrated by the data presented in Table 1, immunization with a mixture of HPV 16 and HPV 18 VLPs provided statistically significant cross protection against incident infection by HPV types 31, 52 and 45 compared to the control.
Statistically significant cross protection against incident infection was also observed against the group of all HPV 16 related types (HPV-31, 33, 35, 52 and 58) and the group of all high risk types, excluding 16 and 18 (HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68).
Statistically significant cross protection against persistent infection was also observed against types 31 and 52 and was also observed against the group of all HPV 16 related types (see Table 2).
Statistically significant cross protection was observed against cytological abnormalities associated with HPV 52 and was also observed against cytological abnormalities associated with the group of all HPV 16 related types (HPV-31, 33, 35, 52, and 58) and the group of all high risk types, excluding 16 and 18 (31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68).
VB61381
Table A
Figure imgf000035_0001
Samples were taken at 9, 12, 15 and 18 months from patients and tested for HPV infection by the types specified above.
VB61381
Table B - vaccine efficacy after three doses in preventing incident heterologous infections.
: Vaccine efficacy against infection with HPV- 16 phylogenetically related types, HPV- 18 phylogenetically related types, HPV- 16 and/or HPV- 18 phylogenetically related types and all high-risk types exclusive of HPV- 16 and HPV- 18 - ATP cohort (month 6-18)
Infection Type Attack rate Vaccine efficacy
Vaccine Placebo
N n AR N n AR % 95°/c , CI p-value
HPV- 16 related 433 12 2.8 438 24 5.5 49.4 0.2 74.4 0.060
HP V- 16 related* 423 29 6.9 423 46 10.9 37.0 1.6 59.6 0.052
Ul HPV- 18 related 442 9 2.0 449 16 3.6 42.9 -27.9 74.5 0.223
HPV-16/18 related 433 21 4.9 438 41 9.4 48.2 13.8 68.9 0.012
HPV-16/18 423 34 8.0 423 56 13.2 39.3 9.0 59.5 0.019 related*
High-risk** 385 53 13.8 386 88 22.8 39.6 17.7 55.7 0.001
N number of subjects in specific cohort n = number of subjects with incident HPV infection
AR Attack rate = n / N
95% CI = 95% confidence interval lower limit = 1- exp ( log (arv / arp) + 1.96 * sqrt (1/nv - 1/Nv + 1/np - 1/Np)-) upper limit = 1- exp ( log (arv / arp) - 1.96 * sqrt (1/nv - 1/Nv + 1/np - 1/Np)) when number of cases in vaccine = 0 :
VB61381
lower limit* = 1- exp ( log (arv* / arp*) + 1.96 * sqrt (l/(nv+0.5) - l/(Nv+0.5) ± l/(np+0.5) - l/(Np+0.5))) uuppppeerr lliimmiitt** == 11-- eexxpp (( lloogg ((aarrvv** // aairp*) - 1.96 * sqrt (l/(nv+0.5) - l/(Nv+0.5) + l/(np+0.5) - l/(Np+0.5))) with: arv = attack rate in vaccine recipients arp = attack rate in placebo recipients nv = number of cases in vaccine recipients
Nv = number of cases and non-cases in vaccine recipients np = number of cases in placebo recipients
Np = number of cases and non-cases in placebo recipients
HPV-16 related: HPV-16 phylogenetically related types 35, 31, 58 without considering other HPV types HPV-16 related*: HPV-16 phylogenetically related types 35, 31 , 58, 33, 52 without considering other HPV types HPV- 18 related: HPV- 18 phylogenetically related types 45, 59 without considering other HPV types w HPV- 16 and/or HPV- 18 related: HP V- 16 and/or HPV- 18 phylogenetically related types 35, 31 , 58, 45, 59 without considering other HPV types
^ HPV- 16 and/or HPV-18 related*: HPV-16 and/or HPV-18 phylogenetically related types 35, 31 , 58, 33, 52, 45, 59 without considering other HPV types
** = High-risk types exclusive of HPV- 16 and HPV- 18
VB61381
Table C
-4
Figure imgf000038_0001
Samples were taken at 18 months from patients and tested for HPV infection by the types specified above.
VB61381
Table 1
Figure imgf000039_0001
VB61381
Table 2
Figure imgf000040_0001
VB61381
Table 3
O
Figure imgf000041_0001
VB61381
In tables 1, 2 and 3,
N = number of subjects in specific cohort
AR = Attack rate = n (number of subjects with HPV either incident infection, persistent infection or cytological abnormality, as appropriate for the table) / N
% Vaccine efficacy is 1 - (A/B) x 100, adjusted for relative size of vaccine and placebo group, wherein
A = % women in vaccine group with incident infection, persistent infection or cytological abnormality, as appropriate for the table
B = % women in placebo group with incident infection, persistent infection or cytological abnormality, as appropriate for the table
Example 2
10 groups of C57B1/6 mice were used, containing 24 mice per group.
Mice were vaccinated according to the information below in a 2 dose schedule at day 0 and day 28, using intramuscular administration (1 group of mice were both primed and boosted with NaCl, not listed below).
Vaccination was carried out using different HPV virus like particle combinations. 4 different VLPs were used: HPV 16 Ll only VLPs, HPV 18 Ll only VLPs, HPV 31 Ll only VLPs, and HPV 45 Ll only VLPs.
The VLPs were made and purified essentially according to the disclosure of WO2003077942A2, herein incorporated fully by reference.
In more detail, HPV 16 VLPs were purified using the sequential steps of: anion exchange chromatography (Di methyl amino ethyl - DMAE), anion exchange chromatography (tri methyl amino ethyl - TMAE), hydroxyapatite chromatography, filtration and another anion exchange step, this time using a Di ethyl amino ethyl (DEAE) step, followed by a final filtration. HPV 31 VLPs were made using the same sequence of steps.
HPV 18 VLPs were purified using the sequential steps of: anion exchange chromatography (Di methyl amino ethyl - DMAE), anion exchange chromatography (tri methyl amino ethyl - TMAE), hydroxyapatite chromatography, filtration and an octyl sepharose column (hydrophobic interaction chromatography), followed by a final filtration. HPV 45 VLPs were made using the same sequence of steps.
The following Ll sequences were used to make VLPs for this experiment:
Nucleotidic Sequence of Truncated Ll from serotype 16 (SEQ ID NO: 3)
70 CGGATGAATATGTTGCACGCACAAACATATATTATCATGCAGGAACATCCAGACTACTTGCAGTTGGACA 140 TCCCTATTTTCCTATTAAAAAACCTAACAATAACAAAATATTAGTTCCTAAAGTATCAGGATTACAATAC 210
AGGGTATTTAGAATACATTTACCTGACCCCAATAAGTTTGGTTTTCCTGACACCTCATTTTATAATCCAG 280
ATACACAGCGGCTGGTTTGGGCCTGTGTAGGTGTTGAGGTAGGTCGTGGTCAGCCATTAGGTGTGGGCAT 350
TAGTGGCCATCCTTTATTAAATAAATTGGATGACACAGAAAATGCTAGTGCTTATGCAGCAAATGCAGGT 420
GTGGATAATAGAGAATGTATATCTATGGATTACAAACAAACACAATTGTGTTTAATTGGTTGCAAACCAC 490
CTATAGGGGAACACTGGGGCAAAGGATCCCCATGTACCAATGTTGCAGTAAATCCAGGTGATTGTCCACC 560
ATTAGAGTTAATAAACACAGTTATTCAGGATGGTGATATGGTTGATACTGGCTTTGGTGCTATGGACTTT 630
ACTACATTACAGGCTAACAAAAGTGAAGTTCCACTGGATATTTGTACATCTATTTGCAAATATCCAGATT 700
ATATTAAAATGGTGTCAGAACCATATGGCGACAGCTTATTTTTTTATTTACGAAGGGAACAAATGTTTGT 770
GGGTCTACTGCAAATTTAGCCAGTTCAAATTATTTTCCTACACCTAGTGGTTCTATGGTTACCTCTGATG 910
CCCAAATATTCAATAAACCTTATTGGTTACAACGAGCACAGGGCCACAATAATGGCATTTGTTGGGGTAA 980
CCAACTATTTGTTACTGTTGTTGATACTACACGCAGTACAAATATGTCATTATGTGCTGCCATATCTACT 1050
TCAGAAACTACATATAAAAATACTAACTTTAAGGAGTACCTACGACATGGGGAGGAATATGATTTACAGT 1120
TTATTTTTCAACTGTGCAAAATAACCTTAACTGCAGACGTTATGACATACATACATTCTATGAATTCCAC 1190
TATTTTGGAGGACTGGAATTTTGGTCTACAACCTCCCCCAGGAGGCACACTAGAAGATACTTATAGGTTT 1260
ACACTTTTTGGGAAGTAAATTTAAAGGAAAAGTTTTCTGCAGACCTAGATCAGTTTCCTTTAGGACGCAA 1400
ATTTTTACTACAATAA 1416
Nucleotidic Sequence of Truncated Ll from serotype 18 (SEQ ID NO: 4)
ATGGCTTTGTGGCGGCCTAGTGACAATACCGTATATCTTCCACCTCCTTCTGTGGCAAGAGTTGTAAATA 70
CCGATGATTATGTGACTCGCACAAGCATATTTTATCATGCTGGCAGCTCTAGATTATTAACTGTTGGTAA 140
TCCATATTTTAGGGTTCCTGCAGGTGGTGGCAATAAGCAGGATATTCCTAAGGTTTCTGCATACCAATAT 210
280 350
TAGTGGGCATCCATTTTATAATAAATTAGATGACACTGAAAGTTCCCATGCCGCCACGTCTAATGTTTCT 420
GAGGACGTTAGGGACAATGTGTCTGTAGATTATAAGCAGACACAGTTATGTATTTTGGGCTGTGCCCCTG 490
CTATTGGGGAACACTGGGCTAAAGGCACTGCTTGTAAATCGCGTCCTTTATCACAGGGCGATTGCCCCCC 560
TTTAGAACTTAAAAACACAGTTTTGGAAGATGGTGATATGGTAGATACTGGATATGGTGCCATGGACTTT 630
ATTTACAAATGTCTGCAGATCCTTATGGGGATTCCATGTTTTTTTGCTTACGGCGTGAGCAGCTTTTTGC 770
TAGGCATTTTTGGAATAGGGCAGGTACTATGGGTGACACTGTGCCTCCATCCTTATATATTAAAGGCACA 840
GGTATGCGTGCTTCACCTGGCAGCTGTGTGTATTCTCCCTCTCCAAGTGGCTCTATTGTTACCTCTGACT 910
CCCAGTTGTTTAATAAACCATATTGGTTACATAAGGCACAGGGTCATAACAATGGTGTTTGCTGGCATAA 980
TCAATTATTTGTTACTGTGGTAGATACCACTCGCAGTACCAATTTAACAATATGTGCTTCTACACAGTCT 1050
CCTGTACCTGGGCAATATGATGCTACCAAATTTAAGCAGTATAGCAGACATGTTGAGGAATATGATTTGC 1120
AGTTTATTTTTCAGTTGTGTACTATTACTTTAACTGCAGATGTTATGTCCTATATTCATAGTATGAATAG 1190
CAGTATTTTAGAGGATTGGAACTTTGGTGTTCCCCCCCCGCCAACTACTAGTTTGGTGGATACATATCGT 1260
TTTGTACAATCTGTTGCTATTACCTGTCAAAAGGATGCTGCACCGGCTGAAAATAAGGATCCCTATGATA 1330
AGTTAAAGTTTTGGAATGTGGATTTAAAGGAAAAGTTTTCTTTAGACTTAGATCAATATCCCCTTGGACG 1400
TAAATTTTTGGTTCAGTAA 1419
Nucleotidic Sequence of Truncated Ll from serotype 31(SEQ ID NO: 5)
ATGTCTCTGTGGCGGCCTAGCGAGGCTACTGTCTACTTACCACCTGTCCCAGTGTCTAAAGTTGTAAGCA 70 CGGATGAATATGTAACACGAACCAACATATATTATCACGCAGGCAGTGCTAGGCTGCTTACAGTAGGCCA 140
TCCATATTATTCCATACCTAAATCTGACAATCCTAAAAAAATAGTTGTACCAAAGGTGTCAGGATTACAA 210
TATAGGGTATTTAGGGTTCGTTTACCAGATCCAAACAAATTTGGATTTCCTGATACATCTTTTTATAATC 280
CTGAAACTCAACGCTTAGTTTGGGCCTGTGTTGGTTTAGAGGTAGGTCGCGGGCAGCCATTAGGTGTAGG 350
TATTAGTGGTCATCCATTATTAAATAAATTTGATGACACTGAAAACTCTAATAGATATGCCGGTGGTCCT 420
GGCACTGATAATAGGGAATGTATATCAATGGATTATAAACAAACACAACTGTGTTTACTTGGTTGCAAAC 490
CACCTATTGGAGAGCATTGGGGTAAAGGTAGTCCTTGTAGTAACAATGCTATTACCCCTGGTGATTGTCC 560
TCCATTAGAATTAAAAAATTCAGTTATACAAGATGGGGATATGGTTGATACAGGCTTTGGAGCTATGGAT 630
TTTACTGCTTTACAAGACACTAAAAGTAATGTTCCTTTGGACATTTGTAATTCTATTTGTAAATATCCAG 700
ATTATCTTAAAATGGTTGCTGAGCCATATGGCGATACATTATTTTTTTATTTACGTAGGGAACAAATGTT 770
TGTAAGGCATTTTTTTAATAGATCAGGCACGGTTGGTGAATCGGTCCCTACTGACTTATATATTAAAGGC 840
TCCGGTTCAACAGCTACTTTAGCTAACAGTACATACTTTCCTACACCTAGCGGCTCCATGGTTACTTCAG 910
ATGCACAAATTTTTAATAAACCATATTGGATGCAACGTGCTCAGGGACACAATAATGGTATTTGTTGGGG 980
CAATCAGTTATTTGTTACTGTGGTAGATACCACACGTAGTACCAATATGTCTGTTTGTGCTGCAATTGCA 1050
AATTTATATTTCAGTTATGCAAAATAACATTATCTGCAGACATAATGACATATATTCACAGTATGAATCC 1190
TGCTATTTTGGAAGATTGGAATTTTGGATTGACCACACCTCCCTCAGGTTCTTTGGAGGATACCTATAGG 1260
TTTGTCACCTCACAGGCCATTACATGTCAAAAAACTGCCCCCCAAAAGCCCAAGGAAGATCCATTTAAAG 1330
ATTATGTATTTTGGGAGGTTAATTTAAAAGAAAAGTTTTCTGCAGATTTAGATCAGTTTCCACTGGGTCG 1400
CAAATTTTTATTACAGTAA 1419
Nucleotidic Sequence of Truncated Ll from serotype 45(SEO ID NO: 6)
ATGGCTTTGTGGCGGCCTAGTGACAGTACGGTATATCTTCCACCACCTTCTGTGGCCAGAGTTGTCAACA 70 CTGATGATTATGTGTCTCGCACAAGCATATTTTACCATGCAGGCAGTTCCCGATTATTAACTGTAGGCAA 140
210
TATAGGGTGTTTAGAGTAGCTTTACCCGATCCTAATAAATTTGGATTACCTGATTCTACTATATATAATC 280
350
CCTAAGTGGCCATCCATTTTATAATAAATTGGATGATACAGAAAGTGCTCATGCGGCTACGGCTGTTGTT 420 ACGCAGGATGTTAGGGATAATGTGTCAGTTGATTATAAGCAAACACAGCTGTGTATTTTAGGTTGTGTAC 490 CTGCTATTGGTGAGCACTGGGCCAAGGGCACACTTTGTAAACCTGCACAATTGCAGCCTGGTGACTGTCC 560 TCCTTTGGAACTTAAAAACACCATTATTGAGGATGGTGATATGGTGGATACAGGTTATGGGGCAATGGAT 630
700
ATTATTTGCAAATGTCTGCTGATCCCTATGGGGATTCTATGTTTTTTTGCCTACGCCGTGAACAACTGTT 770 TGCAAGACATTTTTGGAATAGGGCAGGTGTTATGGGTGACACAGTACCTACAGACCTATATATTAAAGGC 840 ACTAGCGCTAATATGCGTGAAACCCCTGGCAGTTGTGTGTATTCCCCTTCTCCCAGTGGCTCTATTATTA 910 CTTCTGATTCTCAATTATTTAATAAGCCATATTGGTTACATAAGGCCCAGGGCCATAACAATGGTATTTG 980 TTGGCATAATCAGTTGTTTGTTACTGTAGTGGACACTACCCGCAGTACTAATTTAACATTATGTGCCTCT 1050 ACACAAAATCCTGTGCCAGGTACATATGATCCTACTAAGTTTAAGCACTATAGTAGACATGTGGAGGAAT 1120 ATGATTTACAGTTTATTTTTCAGTTGTGCACTATTACTTTAACTGCAGAGGTTATGTCATATATCCATAG 1190 TATGAATAGTAGTATATTGGAAAATTGGAATTTTGGTGTACCTCCACCACCTACTACAAGTTTAGTGGAT 1260 ACATATCGTTTTGTGCAATCAGTTGCTGTTACCTGTCAAAAGGATACTACACCTCCAGAAAAGCAGGATC 1330 CATATGATAAATTAAAGTTTTGGACTGTTGACCTAAAGGAAAAATTTTCCTCCGATTTGGATCAATATCC 1400 CCTTGGTCGAAAGTTTTTAGTTCAGTAA 1428 Each antigen was used at a dose of 2μg. HPV 16, 18 and 45 VLPS were adsorbed onto
The adjuvant used was termed AS04D, at 1/10 of the human dose, which is 5μg 3D MPL and 50μg aluminium hydroxide in total for each vaccine.
HPV virus like particles were combined with aluminium hydroxide and 3D MPL as disclosed in WO00/23105.
For example, in the tetravalent 16, 18, 31, 45 vaccine, 2μg of each of HPV 16 VLPs was adsorbed onto 5μg aluminium hydroxide. For HPV 18 and HPV 45 the same was done. For HPV 31 VLPS the 2 μg VLP was adsorbed onto 2.5 μg aluminium hydroxide.
Separately 5 μg 3D-MPL was adsorbed onto 17.5μg aluminium hydroxide.
The 3D-MPL and VLPs were then mixed, and additional aluminium hydroxide added to result in 50 μg per vaccine dose.
Vaccination schedule:
First composition Second composition
VLPs 16/18 AS04D VLPs 16/18 AS04D
VLPs 16/18/31/45 AS04D VLPs 16/18/31/45 AS04D NaCl VLPs 31/45 AS04D
Read Outs
Antibody titres were determined using classical ELISA techniques well known in the art at day 14 post the initial vaccination and second vaccination (post I and post II respectively). Intracellular staining (ICS, Roederer et al. 2004 Clin. Immunol. 110: 199) was carried out at 14 days post II to assess CMI responses.
Results are given in Figures 1 - 18 below. In these figures the post I and post II data are measurements after vaccine dose I and II respectively. The bar given as "post I booster" reflects the group in which NaCl was given first, followed by either a bivalent or tetravalent vaccine dose at day 28.
Figures 1-9 illustrate the antibody responses generated by different vaccination regimes. Figures 10 - 18 illustrate the CMI responses generated by different vaccination regimes.
Conclusions
1- A heterologous booster comprised of HPV 31 and 45 Ll VLPs is effective in boosting homologous HPV 16 and 18 Ll VLP responses induced by HPV 16 and 18 Ll VLP priming.
2- A heterologous booster comprised of HPV 31 and 45 Ll VLPs is effective in boosting heterologous HPV 31 and 45 Ll VLP responses induced by HPV 16 and 18 Ll VLP priming.

Claims

Claims
1 Use of a human papillomavirus Ll protein or immunogenic fragment thereof from one first HPV type in the preparation of a medicament for boosting an immune response previously elicited by a human papillomavirus Ll protein or immunogenic fragment thereof from a different HPV type.
2 Use according to claim 1 wherein the second type is phylogenetically related to the first type.
3 Use according to claim 1 or 2 of an HPV 31 or HPV 52 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 16 vaccine comprising an Ll protein or fragment thereof.
4 Use according to claim 3 of an HPV 31 protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 16 vaccine comprising an Ll protein or fragment thereof.
5 Use according to claim 3 of an HPV 52 protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 16 vaccine comprising an Ll protein or fragment thereof.
6 Use according to claim 1 or 2 of an HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 31 or HPV 52 vaccine comprising an Ll protein or fragment thereof.
7 Use according to claim 6 of an HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 31 vaccine comprising an Ll protein or fragment thereof.
8 Use according to claim 6 of an HPV 16 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 52 vaccine comprising an Ll protein or fragment thereof. 9 Use according to claim 1 or 2 of an HPV 45 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 18 vaccine comprising an Ll protein or fragment thereof.
10 Use according to claim 1 or 2 of an HPV 18 Ll protein or immunogenic fragment thereof in the preparation of a medicament for boosting an immune response to an HPV 45 vaccine comprising an Ll protein or fragment thereof.
11 A vaccination schedule for protection against HPV infection and/or disease, the schedule comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable interval.
12 A method for prevention of HPV infection and/or disease, the method comprising delivery of a first HPV vaccine comprising an Ll protein or immunogenic fragment thereof from at least HPV 16 and HPV 18, and a second HPV vaccine which does not comprise the HPV 16 and HPV 18 Ll components from the first vaccine, and which second vaccine comprises an Ll protein or immunogenic fragment thereof from at least one other oncogenic HPV type, wherein the first and second vaccines may be delivered in either order and delivery is separated by a suitable time interval.
13 A method or schedule according to claims 11 or 12, wherein the first vaccine comprises Ll protein or immunogenic fragment thereof from HPV 16, HPV 18 and optionally HPV 33.
14 A method or schedule according to claim 13 wherein the first vaccine additionally comprises Ll protein or immunogenic fragment thereof from HPV 58. 15 A method or schedule according to any of claims 11- 13, wherein the second vaccine comprises an Ll protein or immunogenic fragment thereof from HPV 31 and/or HPV 45 and/or HPV 52.
16 A method or schedule according to claim 15, wherein the second vaccine comprises an Ll protein or immunogenic fragment thereof from HPV 31 and HPV 45.
17 A method or schedule according to claim 16, wherein the second vaccine comprises an Ll protein or immunogenic fragment thereof from HPV 31, HPV 45 and HPV 52.
18 A method or schedule according to any of claims 11- 17 wherein the first and second vaccines have no identical Ll proteins or protein fragments in common.
19 A method or schedule according to any of claims 11- 18 wherein the HPV 16 or HPV 18 component in the first vaccine protects against HPV infection and/or disease caused by at least one HPV type in the second vaccine.
20 A vaccine composition comprising a combination of an HPV 31 Ll protein or immunogenic fragment thereof and an HPV 45 Ll protein or immunogenic fragment thereof, the vaccine not containing HPV 16 or HPV 18 Ll protein or immunogenic fragments thereof.
21 A vaccine composition according to claim 20 including an HPV 52 Ll protein or immunogenic fragment thereof.
22 A kit comprising a first and second vaccine compositions according to claim 11.
23 A kit according to claim 22 wherein the first vaccine component comprises HPV 16 and HPV 18 Ll proteins, or immunogenic fragments thereof, and the second vaccine component comprises HPV 31 and HPV 45 proteins, or immunogenic fragments thereof. 24 A use, method, schedule, vaccine or kit according to any preceding claim wherein the HPV Ll protein is in the form of a virus like particle.
25 A use, method, schedule, vaccine or kit according to any preceding claim wherein the first or second vaccine or both comprises an adjuvant.
26 A use, method, schedule, vaccine or kit according to claim 25 wherein the adjuvant comprises 3D-MPL.
27 A use, method, schedule, vaccine or kit according to claim 25 wherein the adjuvant comprises an aluminium salt.
28 A use, method, schedule, vaccine or kit according to claim 26 or 27 wherein the adjuvant comprises an aluminium salt and 3D MPL.
29 A use, method, schedule, vaccine or kit according to claim 26 wherein the adjuvant comprises an oil-in-water emulsion adjuvant and 3D-MPL.
30 A use, method, schedule, vaccine or kit according to claim 29 wherein the oil- in-water emulsion comprises a metabolisable oil, a sterol and an emulsifying agent.
PCT/EP2006/003918 2005-04-26 2006-04-24 Vaccine WO2006114312A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
MX2007013472A MX2007013472A (en) 2005-04-26 2006-04-24 Vaccine.
EP06724609A EP1877086A2 (en) 2005-04-26 2006-04-24 Vaccine
CA002606092A CA2606092A1 (en) 2005-04-26 2006-04-24 Vaccine
JP2008508156A JP2008539184A (en) 2005-04-26 2006-04-24 vaccine
EA200702079A EA013326B1 (en) 2005-04-26 2006-04-24 Vaccine
AU2006239422A AU2006239422A1 (en) 2005-04-26 2006-04-24 Vaccine
US11/912,687 US20090181052A1 (en) 2005-04-26 2006-04-24 Vaccine
BRPI0610032-5A BRPI0610032A2 (en) 2005-04-26 2006-04-24 use of a human papillomavirus l1 protein or immunogenic fragment thereof from a first type of hpv, vaccination program for protection against hiv infection and / or disease, method for preventing hpv infection and / or disease, vaccine composition and kit
NO20075194A NO20075194L (en) 2005-04-26 2007-10-11 vaccine
IL186586A IL186586A0 (en) 2005-04-26 2007-10-11 Vaccine

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US67482905P 2005-04-26 2005-04-26
US60/674,829 2005-04-26
GB0509010.5 2005-05-03
GB0509010A GB0509010D0 (en) 2005-05-03 2005-05-03 Vaccine
PCT/EP2005/006461 WO2005123125A1 (en) 2004-06-16 2005-06-14 Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52
EPPCT/EP2005/006461 2005-06-14

Publications (2)

Publication Number Publication Date
WO2006114312A2 true WO2006114312A2 (en) 2006-11-02
WO2006114312A3 WO2006114312A3 (en) 2007-04-05

Family

ID=36992675

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2006/003918 WO2006114312A2 (en) 2005-04-26 2006-04-24 Vaccine

Country Status (12)

Country Link
US (1) US20090181052A1 (en)
EP (1) EP1877086A2 (en)
JP (1) JP2008539184A (en)
KR (1) KR20080005585A (en)
AR (1) AR054259A1 (en)
AU (1) AU2006239422A1 (en)
CA (1) CA2606092A1 (en)
EA (1) EA013326B1 (en)
MX (1) MX2007013472A (en)
NO (1) NO20075194L (en)
SG (1) SG159525A1 (en)
WO (1) WO2006114312A2 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2364721A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
JP2011529475A (en) * 2008-07-31 2011-12-08 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Anti-HPV vaccine
EP2444103A1 (en) * 2009-06-19 2012-04-25 Eyegene Inc. Vaccine for cervical cancer
WO2012177970A1 (en) 2011-06-24 2012-12-27 Merck Sharp & Dohme Corp. Hpv vaccine formulations comprising aluminum adjuvant and methods of producing same
WO2021163002A1 (en) 2020-02-14 2021-08-19 Merck Sharp & Dohme Corp. Hpv vaccine
WO2023014853A1 (en) 2021-08-06 2023-02-09 Merck Sharp & Dohme Llc Hpv vaccine
WO2023023152A1 (en) 2021-08-19 2023-02-23 Merck Sharp & Dohme Llc Thermostable lipid nanoparticle and methods of use thereof

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001097840A1 (en) * 2000-06-21 2001-12-27 Medimmune, Inc. Chimeric human papillomavirus (hpv) l1 molecules and uses therefor
WO2003077942A2 (en) * 2002-03-18 2003-09-25 Glaxosmithkline Biologicals Sa Virus-like particles of human papillomavirus
WO2004056389A1 (en) * 2002-12-20 2004-07-08 Glaxosmithkline Biologicals Sa Hpv-16 and -18 l1 vlp vaccine
WO2005032586A1 (en) * 2003-09-29 2005-04-14 Merck & Co., Inc. Optimized expression of hpv 45 l1 in yeast

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9921147D0 (en) * 1999-09-07 1999-11-10 Smithkline Beecham Biolog Novel composition
GB9921146D0 (en) * 1999-09-07 1999-11-10 Smithkline Beecham Biolog Novel composition
GB0105606D0 (en) * 2001-03-07 2001-04-25 Cantab Pharmaceuticals Res Ltd Immunogens and vaccines and their preparation and use

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001097840A1 (en) * 2000-06-21 2001-12-27 Medimmune, Inc. Chimeric human papillomavirus (hpv) l1 molecules and uses therefor
WO2003077942A2 (en) * 2002-03-18 2003-09-25 Glaxosmithkline Biologicals Sa Virus-like particles of human papillomavirus
WO2004056389A1 (en) * 2002-12-20 2004-07-08 Glaxosmithkline Biologicals Sa Hpv-16 and -18 l1 vlp vaccine
WO2005032586A1 (en) * 2003-09-29 2005-04-14 Merck & Co., Inc. Optimized expression of hpv 45 l1 in yeast

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
DA SILVA D M ET AL: "Heterologous boosting increases immunogenicity of chimeric papillomavirus virus-like particle vaccines" VACCINE, BUTTERWORTH SCIENTIFIC. GUILDFORD, GB, vol. 21, no. 23, 4 July 2003 (2003-07-04), pages 3219-3227, XP004429731 ISSN: 0264-410X *
DE VILLIERS E-M ET AL: "Classification of papillomaviruses" VIROLOGY, ACADEMIC PRESS,ORLANDO, US, vol. 324, no. 1, 20 June 2004 (2004-06-20), pages 17-27, XP004512668 ISSN: 0042-6822 cited in the application *
KOWALCZYK D W ET AL: "Vaccine regimen for prevention of sexually transmitted infections with human papillomavirus type 16" VACCINE, BUTTERWORTH SCIENTIFIC. GUILDFORD, GB, vol. 19, no. 25-26, 14 May 2001 (2001-05-14), pages 3583-3590, XP004238957 ISSN: 0264-410X *
QIAN JIAHUA ET AL: "Combined prophylactic and therapeutic cancer vaccine: enhancing CTL responses to HPV16 E2 using a chimeric VLP in HLA-A2 mice" INTERNATIONAL JOURNAL OF CANCER, NEW YORK, NY, US, vol. 118, no. 12, 15 June 2006 (2006-06-15), pages 3022-3029, XP002396698 ISSN: 0020-7136 *
VAN DER BURG S H ET AL: "Pre-clinical safety and efficacy of TA-CIN, a recombinant HPV16 L2E6E7 fusion protein vaccine, in homologous and heterologous prime-boost regimens" VACCINE, BUTTERWORTH SCIENTIFIC. GUILDFORD, GB, vol. 19, no. 27, 14 June 2001 (2001-06-14), pages 3652-3660, XP004241783 ISSN: 0264-410X -& WO 02/070004 A2 (XENOVA RES LTD [GB]; LEIDEN UNIVERSITY MEDICAL CT [NL]; HICKLING JULIA) 12 September 2002 (2002-09-12) *
VILLA L L ET AL: "Prophylactic quadrivalent human papillomavirus (types 6, 11, 16, and 18) L1 virus-like particle vaccine in young women: a randomised double-blind placebo-controlled multicentre phase II efficacy trial" LANCET ONCOLOGY, LANCET PUBLISHING GROUP, LONDON, GB, vol. 6, no. 5, 7 April 2005 (2005-04-07), pages 271-278, XP004870902 ISSN: 1470-2045 *

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10039823B2 (en) 2005-12-13 2018-08-07 Glaxosmithkline Biologicals, S.A. Vaccine compositions comprising a saponin adjuvant
US10143745B2 (en) 2005-12-13 2018-12-04 GlacoSmithKline Biologicals, S.A. Vaccine compositions comprising a saponin adjuvant
EP2364724A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
EP2364720A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
EP2364723A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
EP2364722A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
EP2364721A1 (en) 2005-12-13 2011-09-14 GlaxoSmithKline Biologicals S.A. Vaccine compositions comprising a saponin adjuvant
JP2011529475A (en) * 2008-07-31 2011-12-08 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Anti-HPV vaccine
EP2444103A1 (en) * 2009-06-19 2012-04-25 Eyegene Inc. Vaccine for cervical cancer
EP2444103A4 (en) * 2009-06-19 2013-12-18 Eyegene Inc Vaccine for cervical cancer
WO2012177970A1 (en) 2011-06-24 2012-12-27 Merck Sharp & Dohme Corp. Hpv vaccine formulations comprising aluminum adjuvant and methods of producing same
WO2021163002A1 (en) 2020-02-14 2021-08-19 Merck Sharp & Dohme Corp. Hpv vaccine
WO2023014853A1 (en) 2021-08-06 2023-02-09 Merck Sharp & Dohme Llc Hpv vaccine
WO2023023152A1 (en) 2021-08-19 2023-02-23 Merck Sharp & Dohme Llc Thermostable lipid nanoparticle and methods of use thereof

Also Published As

Publication number Publication date
KR20080005585A (en) 2008-01-14
EA200702079A1 (en) 2008-04-28
AU2006239422A1 (en) 2006-11-02
SG159525A1 (en) 2010-03-30
US20090181052A1 (en) 2009-07-16
EA013326B1 (en) 2010-04-30
NO20075194L (en) 2008-01-18
JP2008539184A (en) 2008-11-13
EP1877086A2 (en) 2008-01-16
MX2007013472A (en) 2008-04-02
CA2606092A1 (en) 2006-11-02
AR054259A1 (en) 2007-06-13
WO2006114312A3 (en) 2007-04-05

Similar Documents

Publication Publication Date Title
US20050287161A1 (en) Vaccine
US20090181052A1 (en) Vaccine
EP1758609B1 (en) Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52
JP2012102132A (en) Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52
US7858098B2 (en) Vaccine
US7758866B2 (en) Vaccine against HPV16 and HPV18 and at least another HPV type selected from HPV 31, 45 or 52
CN101217976A (en) Vaccine
EP1879614A2 (en) Vaccine
CN101217975A (en) Vaccine
BRPI0610032A2 (en) use of a human papillomavirus l1 protein or immunogenic fragment thereof from a first type of hpv, vaccination program for protection against hiv infection and / or disease, method for preventing hpv infection and / or disease, vaccine composition and kit
BRPI0610396A2 (en) multivalent hpv vaccine, methods to protect a patient against infection, to prevent or reduce the frequency of cytological abnormalities in a patient, to prevent the formation of histologically confirmed lesions and to manufacture the vaccine, and, uses of a composition, to a vaccine and a vaccine composition

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 186586

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 562526

Country of ref document: NZ

Ref document number: 3957/KOLNP/2007

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2006239422

Country of ref document: AU

Ref document number: 2008508156

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2606092

Country of ref document: CA

Ref document number: 12007502367

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: MX/a/2007/013472

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Ref document number: DE

WWE Wipo information: entry into national phase

Ref document number: 07114248

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2006239422

Country of ref document: AU

Date of ref document: 20060424

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2006239422

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2006724609

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: DZP2007000728

Country of ref document: DZ

NENP Non-entry into the national phase

Ref country code: RU

WWE Wipo information: entry into national phase

Ref document number: 1200702502

Country of ref document: VN

Ref document number: 1020077027497

Country of ref document: KR

WWW Wipo information: withdrawn in national office

Ref document number: RU

WWE Wipo information: entry into national phase

Ref document number: 200702079

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 200680023032.7

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 06724609

Country of ref document: EP

Kind code of ref document: A2

WWP Wipo information: published in national office

Ref document number: 2006724609

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 11912687

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0610032

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20071026