WO2005074641A2 - Variant neuronal nicotinic alpha-7 receptor and methods of use - Google Patents

Variant neuronal nicotinic alpha-7 receptor and methods of use Download PDF

Info

Publication number
WO2005074641A2
WO2005074641A2 PCT/US2005/003474 US2005003474W WO2005074641A2 WO 2005074641 A2 WO2005074641 A2 WO 2005074641A2 US 2005003474 W US2005003474 W US 2005003474W WO 2005074641 A2 WO2005074641 A2 WO 2005074641A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
variant
domain
polypeptide
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/003474
Other languages
French (fr)
Other versions
WO2005074641A3 (en
WO2005074641B1 (en
WO2005074641A8 (en
Inventor
Roger L. Papke
Andon Placzek
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Florida
Original Assignee
University of Florida
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Florida filed Critical University of Florida
Publication of WO2005074641A2 publication Critical patent/WO2005074641A2/en
Publication of WO2005074641A8 publication Critical patent/WO2005074641A8/en
Anticipated expiration legal-status Critical
Publication of WO2005074641A3 publication Critical patent/WO2005074641A3/en
Publication of WO2005074641B1 publication Critical patent/WO2005074641B1/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/94Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving narcotics or drugs or pharmaceuticals, neurotransmitters or associated receptors
    • G01N33/9406Neurotransmitters
    • G01N33/944Acetylcholine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells

Definitions

  • the subject invention was made with government support under a research project supported by National Institutes of Health Grant No. GM57481-01A2. The federal government may have certain rights in this invention.
  • Nicotinic acetylcholine receptors have long been recognized as the primary postsynaptic effector in vertebrate neuromuscular transmission, as well as having a clearly established role in ganglionic neurotransmission.
  • nicotinic receptors have also been identified as being important functional molecules in central neurons (reviewed in (McGehee, D.S. and Role, L.W., Annu. Rev. Physiol, 57:521-546, 1995; Dani, J.A., Biol. Psychiatry, 49:166-174, 2001)).
  • nAChRs There are multiple types of nAChRs in the brain associated with synaptic function, signal processing or cell survival.
  • nAChRs broadly into three major subfamilies. These are the muscle-type receptors, the neuronal beta subunit-containing receptors that bind agonist with relatively high affinity in the desensitized state, and the homomeric alpha subunit receptors, typified by oti '. Concomitant with the evolution of these diverse forms of the nAChR and the functional radiation of these receptor subtypes into various tissues where each subtype performs highly specialized functions, a large amount of sequence divergence has emerged. There is less than 40% amino acid sequence identity between the alpha subunit of muscle type receptors (c-1) and the ⁇ 7-type receptor found in the brain.
  • c ⁇ receptors have high divalent ion permeability, show inward rectifying current-voltage relationships, and have unique agonist concentration-dependent macroscopic response kinetics (Decker, E.R. and Dani, J.A. 1990, J. Neurosci., 10(10):3413-3420; Sands et al, 1993, Biophys. J, 65:2614-2621; Seguela et al, 1993, J. Neurosci., 13(2):596-604; Vernino et al, 1994, J Neurosci, 14:5514-5524).
  • nAChR neuronal degeneration receptors
  • ⁇ 7 subtype which has high permeability to the calcium ion. This receptor subtype has been implicated to have an important role in improving memory-related behaviors and slowing neuronal degeneration, as may occur in aging or dementia.
  • the activation of ⁇ 7 receptors has also been suggested as a therapeutic approach for treating schizophrenia, Alzheimer's disease, inflammation, and other pathologies. (Salamone, F. et al, MJM, 2000, 5:90-97; Cooper, E.C.
  • the present invention relates to a variant of the nicotinic acetylcholine receptor (nAChR) 7 subunit having a substitution at the 6' position of the second transmembrane domain (referred to as M2 or TM2). Specifically, a threonine has been substituted with serine. For example, in the case of the rat (Rattus norvegicus) ⁇ .7 subunit, threonine-244 has been substituted with serine.
  • nAChR nicotinic acetylcholine receptor
  • the variant is referred to herein as the T6'S mutant or T6'S variant (because the point mutation T ⁇ S is in the sixth amino acid position of the TM2 domain).
  • the nucleotide sequence encoding the T6'S variant differs from the coding sequence of the wild-type rat ⁇ 7 subunit in containing a codon (sequence of three nucleotides) encoding serine, instead of threonine, at nucleotides 799 to 781 of the coding sequence (nucleotides 733-735 excluding signal sequence).
  • the T6'S variant of the subject invention exhibits pharmacological and electrophysiological characteristics that are very similar to the wild-type ⁇ 7 subunit. However, unexpectedly, the T6'S variant exhibits much slower desensitization in comparison to the wild-type ⁇ 7 subunit and is, therefore, a "gain of function" mutant. In fact, the T6'S variant of the present invention substantially eliminates the fast desensitization rate observed in the wild-type ⁇ 7 subunit. This distinguishing feature, combined with the variant's similarities to the wild-type ⁇ 7 subunit, makes the T6'S variant particularly useful for drug screening purposes.
  • one aspect of the present invention is an isolated polynucleotide comprising a nucleotide sequence that encodes a variant of the nAChR TM2 domain of the ⁇ 7 subunit, wherein the variant of the nAChR TM2 domain comprises the amino acid sequence of SEQ ID NO:2, or a functional fragment or homologue thereof, wherein the functional fragment or homologue contains the T ⁇ S substitution at the T6'S position.
  • the polynucleotide comprises the nucleic acid sequence of SEQ ID NO: 18.
  • the polynucleotide comprises the nucleic acid sequence of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, or SEQ ID NO:25, each of which are degenerate variants of SEQ ID NO: 18.
  • the present invention further includes an isolated polynucleotide comprising a nucleotide sequence that encodes a variant of the wild-type nAChR ⁇ 7 subunit.
  • the polynucleotide comprises the nucleic acid sequence of SEQ ID NO:4 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:4.
  • the polynucleotide is a degenerate variant of SEQ ID NO:4 .
  • the degenerate variant can comprise the nucleic acid sequence of SEQ ID NO:26 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:26; or SEQ ID NO:27 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:27; or SEQ ID NO:28 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:28; or SEQ JJD NO:29 or nucleotides 67 to 1509 of SEQ ID NO:29;or SEQ ID NO:30 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:30.
  • the present invention includes an isolated polypeptide that is a variant of the wild-type TM2 domain of the ⁇ 7 subunit (SEQ ID NO:l), wherein the variant domain comprises the amino acid sequence of SEQ ID NO:2.
  • the present invention further includes isolated polypeptides that are variants of the wild-type nAChR ⁇ 7 subunits of rat (amino acids 23 to 502 of SEQ ID NO:5), human (amino acids 23 to 502 of SEQ ID NO: 7), mouse (amino acids 23 to 502 of SEQ ID NO: 9) monkey (amino acids 23 to 502 of SEQ ID NO: 11), cow (amino acids 23 to 502 of SEQ ID NO: 13), chicken (amino acids 23 to 502 of SEQ ID NO: 13), zebra fish (amino acids 23 to 502 of SEQ ID NO: 15) wherein the variants of the wild-type nAChR ⁇ 7 subunit comprise the contiguous amino acids 23 to 502 of SEQ ID NO
  • the present invention concerns an isolated nAChR (also referred to herein as the T6'S variant nAChR) comprising the T6'S variant TM2 domain (SEQ ID NO:2) or a T6'S variant c l subunit (such as the contiguous amino acids 23 to 502 of SEQ JJD NO:20), and an isolated polynucleotide encoding the T6'S variant nAChR or cfJ subunit.
  • the isolated nAChR may comprise other wild-type nAChR subunits and/or nAChR variant subunits, in addition to the T6'S variant ⁇ 7 subunit of the present invention.
  • the present invention concerns a recombinant vector comprising a polynucleotide of the invention, such as a vector comprising a nucleotide sequence encoding the T6'S variant, or encoding a variant o-7 nAChR subunit having the T6'S variant TM2 domain, or encoding a variant nAChR comprising a variant o ⁇ subunit having the T6'S variant TM2 domain.
  • the present invention concerns genetically modified host cells that have been transformed or transfected with vectors comprising a polynucleotide of the invention, including genetically modified progeny of such cells.
  • the present invention concerns methods of producing recombinant polypeptides for the treatment of neurological conditions (e.g., neurodegenerative processes), enzymatic function, affective disorders, and immunofunction, using such genetically modified cells.
  • the present invention concerns methods of treating pathologic conditions, such as neurological disorders, by administering to a subject a polynucleotide encoding a T6'S variant of the present invention, or a genetically modified cell of the invention that comprises and expresses the polynucleotide in vivo, or a polypeptide of the invention comprising the T6'S variant TM2 domain.
  • the present invention concerns agents (e.g., antisense polynucleotides, compounds), such as antagonists, which are useful in treating conditions such as neurological conditions (e.g., neurodegenerative processes), enzymatic function, affective disorders, and immunofunction. Methods of treating patients using these antisense polynucleotides and compounds are also provided.
  • the present invention pertains to methods and reagents for detecting the T6'S variant in a sample in vitro, or in vivo.
  • the present invention is directed to a method of expressing a polynucleotide of the subject invention in a cell.
  • a polynucleotide encoding the T6'S variant is expressed in the cell.
  • a polynucleotide encoding a variant al nAChR subunit having the T6'S variant TM2 domain is expressed in the cell.
  • a polynucleotide encoding an nAChR comprising the T6'S variant subunit is expressed in the cell.
  • the present invention is directed to a method of identifying agents that modulate the activity of the T6'S variant and receptors containing the variant subunit, and to a method of identifying cytoprotective or other therapeutic agents, using recombinant cells of the present invention.
  • Figure 1 shows a rendering of the nicotinic acetylcholine receptor (nAChR) accompanied by a hydrophobicity plot of the ⁇ 7 nAChR subunit.
  • Figure 2 shows the amino acid sequences of the wild-type ⁇ 7 TM2 domain, wild- type ⁇ 2 TM2 domain, wild-type ⁇ A TM2 domain, wild-type ⁇ l TM2 domain, and two ⁇ 7 TM2 mutants having amino acid substitutions at the sixth and tenth amino acid positions of the TM2 domain.
  • the numbering of specific residues of the second membrane spanning region is in accordance with that proposed by Miller et al. (Neuron, 2:1195- 1205, 1989).
  • Figure 3 shows acetylcholine (ACh) evoked responses from oocytes expressing wild-type 7 (300 ⁇ M ACh), rat 7 TM2 T6'F (3 ⁇ M ACh), rat ⁇ 7 TM2 T6'S (100 ⁇ M ACh).
  • the inset represents the same current traces normalized to one another for the purpose of comparison.
  • Figures 4A-4C show ACh evoked normalized responses from oocytes expressing wild-type ⁇ 7, rat ⁇ 7 TM2 T6'S, and rat ⁇ 7 TM2 T6'F, respectively, at the ACh concentrations indicated.
  • Figures 5A-5C show electrophysiological characterization of wild-type and mutant ⁇ 7.
  • Figures 5A and 5B demonstrate that the T6'F mutant receptor shows a nearly total loss of permeability to barium.
  • Figure 5C demonstrates that the T6'S mutant exhibits a confounding biphasic current that occurs near the chloride reversal potential.
  • Figures 6A-6D show electrophysiological traces demonstrating that substitution of the muscle ⁇ l subunit phenylalanine at the TM2 6' position confers the predicted sensitivity to succinylcholine, whereas the T6'S mutant is similar to wild-type ⁇ 7.
  • Figure 7 shows the concentration-response relationships for wild-type ⁇ 7 and TM2 6' mutants showing selectivity of succinylcholine (SuCh) for the T6'F mutant.
  • FIGS 8 A and 8B show ACh evoked responses from GH4C1 cells expressing the T6'S mutant and the wild-type ⁇ 7 receptor, respectively.
  • SEQ ID NO:l is the amino acid sequence of the TM2 domain of the wild-type ⁇ 7 subunit (the threonine in the sixth amino acid position of TM2 is underlined and bold for reference), which has 100% homology among Homo sapiens (human), Mucaca mulatto (rhesus monkey), Rattus norvegicus (rat), Mus musculus (mouse), Bos taurus (domestic cow), Gallus gallus (chicken), Danio rerio (zebrafish): ISLGITVLLSLTNFMLLVAE
  • SEQ ID ⁇ O:2 is the amino acid sequence of the T6'S variant of the second transmembrane (TM2) domain (the serine in the sixth amino acid position of TM2 is underlined and bold for reference): ISLGISNLLSLTVFMLLVAE
  • SEQ ID ⁇ O:3 is the nucleotide coding sequence of the TM2 domain of the wild-type rat ⁇ 7 subunit (the codon encoding the threonine at the sixth amino acid of TM2 is underlined and bold for reference): atctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggctgag
  • SEQ ID NO:4 is the nucleotide coding sequence of the wild-type rat ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the sixth amino acid (6') of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctggctggctggccgcggcgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tctgagtctctgcagatcatggatgt
  • SEQ ID NO:5 is the amino acid sequence of the wild-type rat ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is underlined and the 6' threonine of TM2 is bold for reference):
  • the 7 subunit protein has approximately 90% homology among rat, chick, and humans.
  • SEQ ID ⁇ O:6 is the nucleotide coding sequence of the wild-type human ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgctgctcgcgggaggcgtctggctggcgctggcgctggccgcgtcgctcctgcacgtgtccctgcaaggcgagttccagaggaaa gctttacaaggagctggtcaagaactacaatcccttggagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccc ctgagcctc
  • SEQ JJD NO:7 is the amino acid sequence of the wild-type human ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference for reference):
  • SEQ JJD ⁇ O:8 is the nucleotide coding sequence of the wild-type mouse 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggccggcggggaggcatctggctggctctggccgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tctgagcctctgcagatcatggatgtggatg
  • SEQ ID NO:9 is the amino acid sequence of the wild-type mouse ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
  • SEQ ID NO: 10 is the nucleotide coding sequence of the wild-type rhesus monkey ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgctgctcgcagggaggcgtctggctggctggctctggccgcgtcgcatgtgtccctgcaaggcgagttccagaggaa gctttacaaggagctggtcaagaactacaaccccttggagaggcccgtggccaatgactcgcaaccgctcaccgtctacttctccc ctgagcctctgcagat
  • SEQ ID NO: 11 is the amino acid sequence of the wild-type rhesus monkey ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
  • SEQ JJD NO: 12 is the nucleotide coding sequence of the wild-type domestic cow ⁇ 7 subunit, -including nucleotides 1-57 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 775-834 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgcggctcgttgtgcctggcgctggcagcgtcgatcttgcacgtgtccctgcaaggcgagttccagaggaagctctacaaa gacctggtgaagaactacaaccccttggagaggccggtggccaacgactcgctgcgctcacagtctacttctccctgagcctc ctgcagatcatggacg
  • SEQ ED NO: 13 is the amino acid sequence of the wild-type cow ⁇ 7 subunit, including amino acids 1-19 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 259-278 is also underlined for reference):
  • SEQ ID NO: 14 is the nucleotide coding sequence of the wild-type chicken ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgggcctccgggcgctgatgctgtggctgctggcggcggcggggggctcgtgcgcgagtccctgcaaggagagttccaaagga agctgtacaaggagctgctgaagaactacaaccctctggaacgaccagttgcaaatgactcccagccgctcactgtctatttcact ctcagcctcatgcagatcatggatgt
  • SEQ ID NO: 15 is the amino acid sequence of the wild-type chicken ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
  • SEQ ED NO: 16 is the nucleotide coding sequence of the wild-type zebrafish ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature ⁇ 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgggaatttgggaatatactctttatttcaccaccaccacatgctgcctatggagtgtgtcacttcagggggagcatcagaggagactc tatagagacctgatgaaagattataacccactggagagacctgtgttcaatgacacccactcactcacggtgtatttcagcatgag cctcatgcagattatggatgtggatgaaagaatcaagttcttacg
  • SEQ ID NO: 17 is the amino acid sequence of the wild-type zebra fish ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
  • SEQ ID NO: 19 is a nucleotide coding sequence of the T6'S variant ⁇ 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tctgagtctctgcagatcatggatgtggatgaga
  • SEQ ED NO:20 is an amino acid sequence of the T6'S variant ⁇ 7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
  • SEQ ID NO:21 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tcc-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatatccgtcttactttctctgactgtcttcatgctgcttgtggctgag
  • SEQ ID NO:22 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ TD NO:2), containing a degenerate codon (-tca-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatatcagtcttactttctctgactgtcttcatgctgcttgtggctgag
  • SEQ ID NO:23 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-tcg-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatateggtcttactttctctgactgtcttcatgctgcttgtggctgag
  • SEQ ID NO:24 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaataagtgtcttactttctctgactgtcttcatgctgcttgtggctgag
  • SEQ ID NO:25 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agc-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaataagcgtcttactttctctgactgtcttcatgctgcttgtggctgag SEQ ID NO:26 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agc-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaataag
  • TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tctgagtctcctgcagatcatggatgtggatgagaagaaccaagtttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgtgt
  • SEQ ID NO:28 is an example of a degenerate variant of the nucleotide sequence (SEQ ID NO:28).
  • TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tctgagtctcctgcagatcatggatgtggatgagaagaaccaagtttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgtgt
  • SEQ ID NO:29 is an example of a degenerate variant of the nucleotide sequence (SEQ ID NO: 19) encoding a T6'S mutant ⁇ 7 subunit (SEQ ID NO:20), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtactgcagc
  • SEQ ID NO:30 is an example of a degenerate variant of the nucleotide sequence (SEQ ED).
  • SEQ ID NO:31 is a nucleotide coding sequence of the T6'S variant of the human second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atttccctggggatatctgtcttactctctcttaccgtcttcatgctgctcgtggctgag
  • SEQ ED NO:32 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatocgtcttactctctcttaccgtcttcatgct
  • SEQ ED NO:33 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctgggga fortunegtcttactctctcttaccgtcttcatgctgctcgtggctgag
  • SEQ ID NO:34 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatoggtcttactctctctttaccgtcttcatgctgctcgtggctgag
  • SEQ DD NO:35 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagtgtcttactctctctttaccgtcttcatgctgctcgtggctgag
  • SEQ ED NO:36 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagcgtcttactctctctttaccgtcttcatgctgctcgtggctgag SEQ DD NO:37 is a nucleotide coding sequence of the T6'S variant of the rhesus monkey second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atttccctggggatatetgtcttactctctctcactgtc
  • SEQ DD NO:38 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatocgtcttactctctctcactgtcttcatgctgctcgtggctgag
  • SEQ DD NO:39 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO: 37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctgggga fortunegtcttactctctctcactgtcttcatgctgctcgtggctgag
  • SEQ DD NO:40 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatateggtcttactctctctcactgtcttcatgctgctcgtggctgag
  • SEQ DD NO:41 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagtgtcttactctctctcactgtcttcatgctgctcgtggctgag
  • SEQ DD NO:42 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagcgtcttactctctctcactgtcttcatgctgctcgtggctgag
  • SEQ ED NO:43 is a nucleotide coding sequence of the T6'S variant of the cow second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctccctgggaatctetgttttactctccctcaccgtcttcatgctgctggtagctgag
  • SEQ ID NO:44 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctecgttttactctccctcaccgtcttcatgctgctggtagctgag
  • SEQ DD NO:45 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctcagttttactctccctcaccgtcttcatgctgctggtagctgag
  • SEQ DD NO:46 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctcggttttactctccctcaccgtcttcatgctgctggtagctgag
  • SEQ DD NO:47 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatcagtgttttactctcccctcaccgtcttcatgctgctggtagctgag
  • SEQ DD NO:48 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctg
  • SEQ ED NO:49 is a nucleotide coding sequence of the T6'S variant of the chicken second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctcactaggtatatetgttttattgtctctcaccgtcttcatgttactcgtggctgaa
  • SEQ DD NO:50 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatccgttttattgtctctcaccgtcttcatgttactcgtggctgaa
  • SEQ ED NO:51 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatcagttttattgtctctcaccgtcttcatgttact ⁇ gtggctgaa
  • SEQ HD NO:52 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatcggttttattgtctctcaccgtcttcatgttactcgtggctgaa
  • SEQ DD NO:53 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtataagtgttttattgtctctcaccgtcttcatgttactcgtggctgaa
  • SEQ DD NO: 54 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtataagcgttttattgtctctcaccgtcttcatgttactcgtggctgaa
  • SEQ ID NO:55 is a nucleotide coding sequence of the T6'S variant of the zebra-fish second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctcgctcgggatctotgtcctgctctcgctgacagttttcatgcttttggtagcagag
  • SEQ DD NO:56 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctccgtcctgctctcgctgacagttttcatgcttttggtagcagag
  • SEQ DD NO:57 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctcagtcctgctctcgctgacagttttcatgcttttggtagcagag
  • SEQ DD NO:58 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctcggtcctgctctcgctgacagttttcatgcttttggtagcagag
  • SEQ DD NO:59 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgct
  • SEQ DD NO:60 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatcagcgtcctgctctcgctgacagttttcatgcttttggtagcagag
  • the T6'S variant of the ⁇ 7 nicotinic receptor subunit contains a T ⁇ S substitution at the 6' position of the second transmembrane (TM2) domain (corresponding to residue 244 of the wild-type rat ⁇ 7 subunit).
  • TM2 second transmembrane
  • AChRs are broadly subclassified as nicotinic or muscarinic.
  • nAChR refers to a nicotinic acetylcholine receptor.
  • nAChRs of various subunit structures are best known in muscle cells, neurons, and chromaffm cells, they are not necessarily excluded from other cells types (e.g., glial cells, mast cells, blood cells, fibroblasts, etc.).
  • the term "nAChR subunit”, as used herein, refers to a proteinaceous molecule that can combine with other such molecules in the formation of a nAChR.
  • the muscle nAChR is believed to be a pentamer comprised of four types of transmembrane subunit: two ⁇ l subunits, one ⁇ l subunit, one ⁇ subunit and one ⁇ or e subunit depending upon the nAChR form.
  • Neuronal nAChR analogously are also thought to be pentameric and comprised of related but different subunits. At present, eight neuronal a subunits (a2 - c ⁇ ) and three neuronal ⁇ subunits ( ⁇ 2 - ⁇ A) have been isolated. Some neuronal nAChRs appear to require at least one a subunit and at least one ⁇ subunit for a functional complex (e.g., exhibiting ion channel response to ACh or other agonists). Some subunits, however, may assemble to form "homooligomeric" nAChR, as in the case of al nAChR in Xenopus oocytes and in transfected mammalian cells.
  • wild-type refers to the typical, most common or conventional form as it occurs in nature.
  • the human wild-type a7 nAChR was described by Doucette-Stamm et al. (Drug Dev. Res. 30: 252-256, 1993; and U.S. Patent No. 5,837,489, which are inco ⁇ orated herein by reference in their entireties).
  • the o7T144S subunit indicates the threonine residue located at position 144 in the wild-type receptor has been replaced by a serine residue.
  • nicotinic cholinergic agonist refers to an agent that binds to and activates a nicotinic acetylcholine receptor. By “activates” is intended the elicitation of one or more pharmacological, physiological, or electrophysiological responses. Such a response includes, but is not limited to, cell membrane depolarization and increased permeability to Ca other cations.
  • nicotinic cholinergic antagonist refers to a substance that binds to a nicotinic acetylcholine receptor and prevents agonists from activating the receptor. Pure antagonists do not activate the receptor, but some substances may have mixed agonist and antagonist properties. Nicotinic cholinergic channel blockers block the ability of agonists to elicit current flow through the nicotinic acetylcholine receptor channel, but do so by blocking the channel rather than by preventing agonists from binding to and activating the receptor.
  • nicotinic cholinergic modulator refers to an agent that influences the activity of the nicotinic acetylcholine receptor through interaction at one or more sites other than the classic agonist binding site.
  • the modulator may itself increase or decrease receptor activity, or may influence agonist activity (for example, potentiating responses) without itself eliciting an overt change in channel current.
  • a single agent can have different properties at different nicotinic acetylcholine receptor subtypes, for example, being an agonist at one receptor and antagonist at another, or an antagonist at one and a channel blocker at another.
  • nAChR regulator refers to an agent that may act as an agonist, antagonist, channel blocker or modulator.
  • polynucleotide refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, the term includes double- stranded and single-stranded DNA, as well as double-stranded and single-stranded RNA. It also includes modifications, such as by methylation and/or by capping, and unmodified forms of the polynucleotide.
  • variant refers to an oligonucleotide sequence that differs from the related wild-type sequence in one or more nucleotides.
  • a variant oligonucleotide is expressed as a protein variant which, as used herein, indicates a polypeptide sequence that differs from the wild-type polypeptide in the substitution, insertion or deletion of one or more amino acids.
  • the variant polypeptide differs in primary structure (amino acid sequence), but may or may not differ significantly in secondary or tertiary structure or in function relative to the wild-type.
  • mutant generally refers to an organism or a cell displaying a new genetic character or phenotype as the result of change in its gene or chromosome. In some instances, however, the term “mutant” may be used in reference to a variant protein or oligonucleotide and “mutation” may refer to the change underlying the variant.
  • polypeptide and “protein” are used interchangeably herein and indicate a molecular chain of amino acids of any length linked through peptide bonds.
  • polypeptides include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like.
  • protein fragments, analogs, mutated or variant proteins, fusion proteins and the like are included within the meaning of polypeptide.
  • the polypeptides of the present invention are, optionally, N-acetylated and/or C- terminal amidated.
  • the polypeptides of the present invention may be synthetically produced using methods well known in the art utilizing D or L isomeric amino acid precursors.
  • Therapeutic peptides of the present invention preferably contain one, a few, or all of their amino acid residues in the D-isomer conformation.
  • the polypeptides of the present invention may also be produced by recombinant technology, as small polypeptides, as small synthetic fusion proteins comprising one or more polypeptides of the present invention fused to a targeting polypeptide.
  • fusion protein refers to protein constructs that are the result of combining multiple protein domains or linker regions for the pu ⁇ ose of gaining function of the combined functions of the domains or linker regions.
  • T6'S variant or “T6'S mutant” are used herein interchangeably to refer a TM2 domain having a serine residue in the sixth amino acid position (6'S), an al subunit polypeptide having a TM2 domain with a serine in the 6'S position, and/or an nACh receptor having a TM2 domain with a serine in the 6'S position, functional fragments or variants of any of the foregoing polypeptides; or polynucleotides encoding any of the foregoing polypeptides, including functional fragments or variants thereof.
  • the TM2 domain is at least 20 amino acids in length.
  • the TM2 domain comprises the amino acid sequence of ISLGISVLLSLTVFMLLVAE (SEQ DD NO:2).
  • T6'S variant or “T6'S mutant” are used herein interchangeably to refer to any polynucleotide encoding an amino acid sequence comprising a TM2 domain having a serine residue in the sixth amino acid position (6'S).
  • the polynucleotide encodes the amino acid sequence of ISLGISNLLSLTNFMLLVAE (SEQ DD ⁇ O:2), such as the nucleic acid sequences of SEQ DD NO: 18, SEQ ED NO:19, SEQ ED NO:21, SEQ DD NO:22, SEQ DD NO:23 SEQ DD NO:24, SEQ DD NO:25, SEQ DD NO:26, SEQ DD NO:27, SEQ DD NO:28, SEQ DD NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ DD NO:32, SEQ ED NO:33, SEQ DD NO:34, SEQ DD NO:35, SEQ ED NO:36, SEQ ED NO:37, SEQ ED NO:38, SEQ DD NO:39, SEQ DD NO:40, SEQ DD NO:41, SEQ DD NO:42, SEQ DD NO:43, SEQ ED NO:44
  • nucleotide sequences encoding the T6'S variant, or encoding the T6'S variant nAChR used in the subject invention include "homologous" or "modified” nucleotide sequences.
  • Homologous nucleic acid sequences will be understood to include any nucleotide sequence obtainable by mutagenesis according to techniques well known to persons skilled in the art, and exhibiting modifications in relation to the normal sequences. For example, mutations in the regulatory and/or promoter sequences for the expression of a polypeptide that result in a modification of the level of expression of a polypeptide according to the invention provide for a "modified nucleotide sequence".
  • substitutions, deletions, or additions of nucleic acid to the polynucleotides of the invention provide for "homologous” or “modified” nucleotide sequences.
  • "homologous” or “modified” nucleic acid sequences have substantially the same biological function in vitro and/or in vivo as the T6'S variant of the present invention.
  • the function of homologues of the invention can be assessed by a number of methods known for assessing nAChR receptor function known in the art, including those disclosed herein.
  • function of homologues can be determined in the Xenopus oocyte by a variety of electrophysiological techniques including intracellular voltage recording, two-electrode voltage clamp, patch clamp methods, and the like.
  • a "homologous” or “modified” nucleotide sequence will also be understood to include a splice variant of the polynucleotides of the instant invention or any nucleotide sequence encoding a "modified polypeptide" as defined below.
  • a “homologue” or “modified” nucleotide or amino acid sequence will also be understood to include mammalian homologues of the nucleotide sequences and amino acid disclosed herein.
  • Homologues of the present invention include those sequences having "functionally conservative mutations” and or “structurally conservative mutations.”
  • the phrase "functionally conservative mutation”, as used herein, intends a change in a polynucleotide encoding a derivative polypeptide in which the activity is not substantially altered compared to that of the polypeptide from which the derivative is made.
  • Such derivatives may have, for example, amino acid insertions, deletions, or substitutions in the relevant molecule that do not substantially affect its properties (see Table 1).
  • Functionally conservative mutants of the amino acid sequence of SEQ DD NO:2, SEQ ID NO:20, amino acids 23 to 502 of SEQ JJD NO:20, and other T6'S polypeptides disclosed herein, are encompassed by the present invention.
  • the phrase "structurally conservative mutant", as used herein, refers to a polynucleotide containing changes in the nucleic acid sequence but encoding a polypeptide having the same amino acid sequence as the polypeptide encoded by the polynucleotide from which the degenerate variant is derived. This can occur because a specific amino acid may be encoded by more than one codon (sequence of three nucleotides).
  • Structurally conservative mutants of the nucleic acid sequences encoding SEQ ID NO: 2, SEQ ED NO:20, amino acids 23 to 502 of SEQ DD NO:20, and other T6'S polypeptides disclosed herein are encompassed by the present invention.
  • degenerate variants of the T6'S TM2 domain (SEQ DD NO: 2) having alternative codons that encode serine at the sixth amino acid position are SEQ ED NO:21, SEQ DD NO:22, SEQ ED NO:23, SEQ ID NO:24, and SEQ DD NO:25.
  • Degenerate codons encoding serine at the sixth amino acid position include -tct-, -tec-, -tea-, -teg-, -agt-, and -age-.
  • Examples of degenerate variants of the T6'S ⁇ 7 receptor having alternative codons that encode serine at the sixth amino acid position of the TM2 domain include, but are not limited to, SEQ ED NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, and SEQ DD NO:30.
  • these degenerate variants of the T6'S ⁇ 7 receptor are nucleotides 67 to 1509 of SEQ DD NO:26, nucleotides 67 to 1509 of SEQ DD NO:27, nucleotides 67 to 1509 of SEQ DD NO:28, nucleotides 67 to 1509 of SEQ ID NO:29, nucleotides 67 to 1509 of SEQ DD NO:30, and the nucleotide sequences of SEQ DD NOs. 31 to 60.
  • the polynucleotides of the present invention may include further degenerate codons as well (i.e., in addition to those codons encoding serine in the sixth amino acid position of the TM2 domain).
  • the polynucleotides of the present include degenerate variants which, because of the degeneracy of the genetic code, have different nucleic acid sequences (i.e., one or more differing codons) from those polynucleotides exemplified herein, but which nonetheless encode the same amino acid sequences.
  • a listing of valid codons for any given amino acid can be readily determined by those having knowledge of, or access to, the genetic code.
  • a homologous nucleotide sequence encompasses a nucleotide sequence having a percentage identity with the bases of the nucleotide sequences of between at least (or at least about) 20.00% to 99.99% (inclusive).
  • homologous sequences exhibiting a percentage identity with the bases of the nucleotide sequences of the present invention can have 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99 percent identity with the polynucleotide sequences of the instant invention.
  • Homologous nucleotide and amino acid sequences include mammalian homologues of the rat T6'S variant and mammalian homologues of the rat T6'S variant nAChR.
  • the mammalian homologue is a nucleotide sequence encoding the human T6'S variant or the human T6'S variant nAChR.
  • the mammalian homologue is the amino acid sequence of the human T6'S variant or the human T6'S variant nAChR.
  • the T6'S variant homologues of the present invention include polypeptides containing, as a primary amino acid sequence, all or part of an exemplified T6'S variant polypeptide sequence.
  • the T6'S variant homologues thus include T6'S variant polypeptides having conservative substitutions, i.e., altered sequences in which functionally equivalent amino acid residues are substituted for residues within the sequence resulting in a peptide which is biologically active.
  • conservative substitutions for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs (see Table 1).
  • Conservative substitutions also include substitutions by amino acids having chemically modified side chains that do not eliminate the biological function of the resulting T6'S variant homologue.
  • Both protein and nucleic acid sequence homologies may be evaluated using any of the variety of sequence comparison algorithms and programs known in the art.
  • sequence comparison algorithms and programs include, but are by no means limited to, TBLASTN, BLASTP, FASTA, TFASTA, and CLUSTALW (Pearson and Lipman Proc. Natl. Acad. Sci. USA, 1988, 85(8):2444-2448; Altschul et al. J. Mol. Biol, 1990, 215(3):403-410; Thompson et al. Nucleic Acids Res., 1994, 22(2):4673-4680; Higgins et al. Methods Enzymol, 1996, 266:383-402; Altschul et al J. Mol.
  • the methods, vectors, and compositions of the present invention can utilize functional fragments of nucleic acid sequences encoding the T6'S variant or T6'S variant nAChR disclosed herein, so long as the functional fragments include those nucleotides encoding the second transmembrane (TM2) domain of the ⁇ 7 subunit and have the T ⁇ S substitution in the sixth amino acid position of the TM2 domain.
  • Representative fragments of the nucleotide sequences according to the invention will be understood to mean any polynucleotide fragment having at least 30 consecutive nucleotides, preferably at least 35 consecutive nucleotides, and still more preferably at least 40 or at least 50 consecutive nucleotides of the sequence from which it is derived.
  • fragments can comprise consecutive nucleotides of 31, 32, 33, 34 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82 ; 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100
  • restriction enzymes can be used to obtain functional fragments of the nucleic acid sequences.
  • Ba l exonuclease can be conveniently used for time-controlled limited digestion of DNA (commonly referred to as "erase-a-base” procedures). See, for example, Maniatis et al. Molecular Cloning: A Laboratory Manual, 1982, Cold Spring Harbor Laboratory, New York; Wei et al. J. Biol. Chem., 1983, 258:13006-13512.
  • the methods, vectors, and compositions of the present invention can utilize amino acid sequences that are functional fragments of the full-length T6'S variant TM2 domain, the T6'S variant subunit, or T6'S variant nAChR.
  • fragments of the polypeptides according to the invention will be understood to mean any polypeptide fragment having at least 9 or 10 consecutive amino acids, preferably at least 15 amino acids, and still more preferably at least 20 or at least 30 consecutive amino acids of the polypeptide sequence from which it is derived.
  • the upper limit for such fragments is one amino acid less than the total number of amino acids found in the full-length sequence.
  • fragments of the polypeptides can comprise consecutive amino acids of 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110,
  • Fragments of polypeptides can be any portion of the full-length amino acid sequence (including human or non- human mammalian homologues) that exhibit functional activity, e.g., a C-terminally or N-terminally truncated version, or an intervening portion of the full-length sequence.
  • the terms "recombinant host cells”, “host cells”, “cells”, “cell lines”, “cell cultures”, and other such terms denoting microorganisms or higher eukaryotic cell lines cultured as unicellular entities refer to cells which can be, or have been, used as recipients for recombinant vectors or other transfer DNA, immaterial of the method by which the DNA is introduced into the cell or the subsequent disposition of the cell.
  • the terms include the progeny of the original cell that has been transfected.
  • Cells in primary culture as well as cells such as oocytes also can be used as recipients.
  • the term "genetic modification" as used herein refers to the stable or transient alteration of the genotype of a cell of the subject invention by intentional introduction of exogenous nucleic acids by any means known in the art (including for example, direct transmission of a polynucleotide sequence from a cell or virus particle, transmission of infective virus particles, and transmission by any known polynucleotide-bearing substance) resulting in a permanent or temporary alteration of genotype.
  • the nucleic acids may be synthetic, or naturally derived, and may contain genes, portions of genes, or other useful polynucleotides in addition to those encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or T6'S variant nAChR.
  • a translation initiation codon can be inserted as necessary, making methionine the first amino acid in the sequence.
  • vector is used to refer to any molecule (e.g., nucleic acid, plasmid, or virus) usable to transfer coding sequence information (e.g., nucleic acid sequence encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or T6'S variant nACh receptor), such as to a host cell.
  • a vector typically includes a replicon in which another polynucleotide segment is attached, such as to bring about the replication and/or ' expression of the attached segment.
  • the term includes expression vectors, cloning vectors, and the like.
  • the term includes gene expression vectors capable of delivery/transfer of exogenous nucleic acid sequences into a host cell.
  • expression vector refers to a vector that is suitable for use in a host cell (e.g., a patient's cell, tissue culture cell, cells of a cell line, etc.) and contains nucleic acid sequences which direct and/or control the expression of exogenous nucleic acid sequences. Expression includes, but is not limited to, processes such as transcription, translation, and RNA splicing, if introns are present. Nucleic acid sequences can be modified according to methods known in the art to provide optimal codon usage for expression in a particular expression system.
  • the vector may include elements to control targeting, expression and transcription of the nucleic acid sequence in a cell selective manner as is known in the art.
  • the vector can include a promoter for controlling transcription of the exogenous material and can be either a constitutive or inducible promoter to allow selective transcription.
  • the expression vector can also include a selection gene.
  • a "coding sequence" is a polynucleotide sequence that is transcribed into mRNA and/or translated into a polypeptide. The boundaries of the coding sequence are determined by a translation start codon at the 5 '-terminus and a translation stop codon at the 3 '-terminus.
  • a coding sequence can include, but is not limited to, mRNA, cDNA, and recombinant polynucleotide sequences. Variants or analogs may be prepared by the deletion of a portion of the coding sequence, by insertion of a sequence, and/or by substitution of one or more nucleotides within the sequence. Techniques for modifying nucleotide sequences, such as site-directed mutagenesis, are well known to those skilled in the art (See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Second Edition, 1989; DNA Cloning, Vols. I and II, D.N. Glover ed., 1985).
  • the polynucleotides of the present invention, and composition and methods of the invention that utilize such polynucleotides can include non-coding sequences.
  • the term "operably-linked" is used herein to refer to an arrangement of flanking control sequences wherein the flanking sequences so described are configured or assembled so as to perform their usual function.
  • a flanking control sequence operably-linked to a coding sequence may be capable of effecting the replication, transcription and/or translation of the coding sequence under conditions compatible with the control sequences.
  • a coding sequence is operably-linked to a promoter when the promoter is capable of directing transcription of that coding sequence.
  • a flanking sequence need not be contiguous with the coding sequence, so long as it functions correctly.
  • intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence, and the promoter sequence can still be considered “operably-linked” to the coding sequence.
  • Each nucleotide sequence coding for a polypeptide will typically have its own operably- linked promoter sequence.
  • the terms "transfection” and “transformation” are used interchangeably herein to refer to the insertion of an exogenous polynucleotide into a host cell, irrespective of the method used for the insertion, the molecular form of the polynucleotide that is inserted, or the nature of the cell (e.g., prokaryotic or eukaryotic).
  • the insertion of a polynucleotide per se and the insertion of a plasmid or vector comprised of the exogenous polynucleotide are included.
  • the exogenous polynucleotide may be directly transcribed and translated by the cell, maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be stably integrated into the host genome.
  • isolated when referring to a polynucleotide or a polypeptide, means that the indicated molecule is present in the substantial absence of other similar biological macromolecules.
  • isolated as used herein means that at least 75 wt. %, more preferably at least 85 wt.
  • test sample refers to biological samples and non- biological samples (e.g., synthetic fluids). Biological samples which can be evaluated by the methods of the present invention described herein include body fluids such as whole blood, tissues and cell preparations.
  • cell and “cells” are used interchangeably herein to refer to a single cell or plurality of cells (i.e., at least one cell).
  • the following single-letter amino acid abbreviations are used throughout the text: Alanine: A; Arginine: R; Asparagine: N; Aspartic acid: D; Cysteine: C; Glutamine: Q; Glutamic acid: E; Glycine: G; Histidine: H; Isoleucine: I; Leucine: L; Lysine: K; Methionine: M; Phenylalanine: F; Proline: P; Serine: S; Threonine: T; Tryptophan: W; Tyrosine: Y; and Valine: V.
  • the T6'S variant TM2 domain, the T6'S variant al subunit, the T6'S variant nACh receptor; polynucleotides encoding the T6'S variant TM2 domain, the T6'S variant o7 subunit, and the T6'S variant nACh receptor; and methods of making the T6'S variant TM2 domain, the T6'S variant o7 subunit, and the T6'S variant nACh receptor, are provided herein, and encompassed by the subject invention.
  • the invention includes not only the T6'S variant but also methods for screening compounds using the T6'S variant and cells expressing the T6'S variant TM2 domain.
  • one aspect of the present invention is an isolated polynucleotide that encodes a variant of the nAChR TM2 domain of the ⁇ 7 subunit, wherein the variant of the nAChR TM2 domain comprises the amino acid sequence of SEQ ID NO:2, or a functional fragment or homologue thereof, wherein the functional fragment or homologue contains the T ⁇ S substitution at the T6'S position.
  • the polynucleotide comprises the nucleic acid sequence of SEQ DD NO: 18. In other embodiments, the polynucleotide comprises the nucleic acid sequence of SEQ DD NO:21, SEQ DD NO:22, SEQ ED NO:23, SEQ DD NO:24, or SEQ DD NO:25, which are each a degenerate variant of SEQ D NO:18.
  • the polynucleotides of the present invention comprise the nucleic acid coding sequences of the TM2 domains of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish, or mammalian or non-mammalian homologs of these polynucleotides, wherein the codon encoding the sixth amino acid residue of the TM2 domain has been altered to encode serine.
  • the altered TM2 domain comprises SEQ DD NO:2.
  • the polynucleotides of the present invention comprise the coding sequence of the nAChR ⁇ 7 subunit of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish, or mammalian or non-mammalian homologs of these polynucleotides, wherein the codon encoding the sixth acid residue of the TM2 domain has been altered to encode serine.
  • the altered TM2 domain comprises SEQ ID NO:2.
  • the present invention further includes an isolated polynucleotide that encodes a variant of the wild-type nAChR 7 subunit, such as the wild-type nAChR ⁇ 7 subunit of rat, human, mouse, monkey, cow, chicken, and zebrafish (the coding sequences of SEQ DD NO:4, SEQ DD NO:6, SEQ ED NO:8, SEQ ID NO:10, SEQ DD NO:12, SEQ DD NO:14, and SEQ ID NO:16).
  • the present invention includes an isolated polypeptide that is a variant of the wild-type TM2 domain of the ⁇ 7 subunit, wherein the domain comprises the amino acid sequence of SEQ ID NO:2.
  • the polypeptides of the present invention comprise the amino acid sequences of the mature ⁇ 7 subunit of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish (i.e., comprising the amino acid sequences of SEQ DD NO: 5, SEQ DD NO:7, SEQ DD NO:9, SEQ DD NO: 11, SEQ DD NO: 13, SEQ ED NO: 15, or SEQ DD NO: 17, with or without signal peptides), or mammalian or non- mammalian homologs of these polypeptides that have a TM2 domain, wherein the sixth amino acid residue of the TM2 domain in the amino acid sequence has been altered to encode serine.
  • zebrafish i.e., comprising the amino acid sequences of SEQ DD NO: 5, SEQ DD NO:7, SEQ DD NO:9, SEQ DD NO: 11, SEQ DD NO: 13, SEQ ED NO: 15, or SEQ DD NO: 17, with or without
  • the altered TM2 domain comprises SEQ DD NO:2.
  • the sixth amino acid is altered from a threonine to a serine (T ⁇ S).
  • a polynucleotide encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or the T6'S variant nACh receptor can be derived from genomic or cDNA as a starting material, prepared by synthesis, or by a combination of techniques.
  • the polynucleotide can then be used to express the T6'S variant TM2 domain, the T6'S variant al subunit, or the T6'S variant nACh receptor, or as a template for the preparation of RNA using methods well known in the art (see, Sambrook et al, Molecular Cloning: A Laboratory Manual, Second Edition, 1989).
  • One method for obtaining the desired polynucleotide involves isolating cDNA encoding the wild-type o7 nAChR subunit as described by Doucette-Stamm et al. Drug Dev. Res., 1993, 30: 252-256.
  • the wild-type cDNA thus obtained can then be modified by site-directed mutagenesis using, for example QUICKCHANGE kits (STRATAGENE, LaJolla, CA) and amplified using the polymerase chain reaction ("PCR") and primer sequences designed to obtain the DNA encoding the T6'S variant.
  • PCR employs short oligonucleotide primers (generally 10-20 nucleotides in length) that match opposite ends of a desired sequence within the wild-type DNA molecule. The sequence between the primers need not be known.
  • the initial template can be either RNA or DNA. If RNA is used, it is first reverse-transcribed to cDNA.
  • the cDNA is then denatured, using well known techniques such as heat, and appropriate oligonucleotide primers are added in molar excess.
  • the primer can be made specific by keeping primer length and base composition within relatively narrow limits, and by keeping the mutant base corresponding to T6'S centrally located (Zoler et al. (1983) Meth. Enzymol. 100:468).
  • Primer extension is effected using DNA polymerase in the presence of deoxynucleotide triphosphates or nucleotide analogs.
  • the resulting product includes the respective primers at their 5'- termini, covalently linked to the newly synthesized complements of the original strands.
  • the replicated molecule is again denatured, hybridized with primers, and so on, until the product is sufficiently amplified.
  • PCR methods are described in the art, e.g., U.S. Patent Nos. 4,965,188; 4,800,159; 4,683,202; 4,683,195; inco ⁇ orated herein by reference in their entireties.
  • the product of the PCR is cloned and the clones containing the mutated DNA, derived by segregation of the primer extended strand, selected. Selection can be accomplished using the mutant primer as a hybridization probe.
  • two complimentary olignonucleotides can be synthesized which contain the desired mutation flanked by 10-15 bases of unmodified nucleotide sequence.
  • RNA transcripts can be prepared in vitro using the appropriate mMessage mMachine kit from AMBION Inc. (Austin, TX).
  • the wild-type DNA may be obtained from an appropriate DNA library.
  • DNA libraries may be probed using the procedure described by Grunstein et al. (Proc. Natl. Acad. Sci. USA 73:3961, 1975).
  • Synthetic oligonucleotides may be prepared using an automated oligonucleotide synthesizer such as that described by Warner (DNA 3:401, 1984).
  • the synthetic strands may be labeled with 32 P by treatment with polynucleotide kinase in the presence of 32 P-ATP, using standard conditions for the reaction.
  • DNA sequences, including those isolated from genomic or cDNA libraries may be modified by known methods which include site-directed mutagenesis as described by Zoller (Nucleic Acids Res.
  • the DNA to be modified is packaged into phage as a single stranded sequence, and converted to a double stranded DNA with DNA polymerase using, as a primer, a synthetic oligonucleotide complementary to the portion of the DNA to be modified, and having the desired modification included in its own sequence.
  • Culture of the transformed bacteria, which contain replications of each strand of the phage are plated in agar to obtain plaques. Theoretically, 50% of the new plaques contain phage having the mutated sequence, and the remaining 50% have the original sequence. Replicates of the plaques are hybridized to labeled synthetic probe at temperatures and conditions suitable for hybridization with the conect strand, but not with the unmodified sequence.
  • sequences which have been identified by hybridization are recovered and cloned. Alternatively, it may be necessary to identify clones by sequence analysis if there is difficulty in distinguishing the variant from wild-type by hybridization. In any case, the DNA can be sequence-confirmed.
  • the DNA Once produced, the DNA may then be inco ⁇ orated into a cloning vector or an expression vector for replication in a suitable host cell.
  • Vector construction employs methods known in the art. Generally, site-specific DNA cleavage is performed by treating with suitable restriction enzymes under conditions which generally are specified by the manufacturer of the commercially available enzymes. After incubation with the restriction enzyme, protein is removed by extraction and the DNA recovered by precipitation.
  • the cleaved fragments may be separated using, for example, polyacrylamide or agarose gel electrophoresis methods, according to methods known by those of skill in the art.
  • Sticky end cleavage fragments may be blunt ended using E. coli DNA polymerase 1 (Klenow) in the presence of the appropriate deoxynucleotide triphosphates (dNTPs) present in the mixture.
  • dNTPs deoxynucleotide triphosphates
  • SI nuclease Treatment with SI nuclease also may be used, resulting in the hydrolysis of any single stranded DNA portions.
  • Ligations are performed using standard buffer and temperature conditions using T4 DNA ligase and ATP. Alternatively, restriction enzyme digestion of unwanted fragments can be used to prevent ligation.
  • Standard vector constructions can include specific antibiotic resistance elements.
  • Ligation mixtures are transfonned into a suitable host, and successful transformants selected by antibiotic resistance or other markers. Plasmids from the transformants can then be prepared according to methods known to those in the art usually following a chloramphenicol amplification as reported by Clewell et al. (J. Bacteriol 110:667, 1972) may be added.
  • the DNA is isolated and analyzed, usually by restriction enzyme analysis and/or sequencing. Sequencing may be by the well-known dideoxy method of Sanger et al. (Proc. Natl. Acad. Sci. USA 74:5463, 1977) as further described by Messing et al. (Nucleic Acid Res. 2:309, 1981), or by the method reported by Maxam et al. (Meth.
  • Host cells can be genetically modified with the vectors of the present invention, which may be a cloning vector or an expression vector.
  • the vector may be in the form of a plasmid, a viral particle, a phage, etc.
  • the genetically modified host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants/transfectants or amplifying the subunit-encoding polynucleotide.
  • prokaryotic and eukaryotic host cells may be used for expression of desired coding sequences when appropriate control sequences (e.g., promoter sequences) that are compatible with the designated host are used.
  • control sequences e.g., promoter sequences
  • Escherichia coli is frequently used.
  • expression control sequences for prokaryotes include but are not limited to promoters, optionally containing operator portions, and ribosome binding sites.
  • Transfer vectors compatible with prokaryotic hosts can be derived from, for example, the plasmid pBR322 that contains operons conferring ampicillin and tetracycline resistance, and the various pUC vectors, that also contain sequences conferring antibiotic resistance markers. These markers may be used to obtain successful transformants by selection.
  • Commonly used prokaryotic control sequences include but are not limited to the lactose operon system (Chang et al. Nature 198:1056, 1977), the tryptophan operon system (reported by Goeddel et al. (Nucleic Acid Res. 8:4057, 1980) and the lambda-derived PI promoter and N gene ribosome binding site (Shimatake et al.
  • the hybrid Tac promoter (De Boer et al. Proc. Natl. Acad. Sci. USA 292:128, 1983) derived from sequences of the t ⁇ and lac UV5 promoters.
  • the foregoing systems are particularly compatible with E. coli; however, other prokaryotic hosts such as strains of Bacillus or Pseudomonas may be used if desired.
  • Eukaryotic hosts include yeast and mammalian cells in culture systems. Pichia pastoris, Saccharomyces cerevisiae and S. carlsbergensis are commonly used yeast hosts.
  • Yeast-compatible vectors cany markers that permit selection of successful transformants by conferring protrophy to auxotrophic mutants or resistance to heavy metals on wild- type strains.
  • Yeast compatible vectors may employ the 2- ⁇ origin of replication (Broach et al. Meth. Enzymol. 101:307, 1983), the combination of CEN3 and ARSl or other means for assuring replication, such as sequences that will result in inco ⁇ oration of an appropriate fragment into the host cell genome.
  • Control sequences for yeast vectors are known in the art and include but are not limited to promoters for the synthesis of glycolytic enzymes, including the promoter for 3-phosphoglycerate kinase. (See, for example, Hess et al. J. Adv.
  • GAPDH glyceraldehyde-3-phosphate dehydrogenase
  • ADH alcohol dehydrogenase
  • terminators also derived from GAPDH
  • leader sequences from yeast alpha factor.
  • the transcriptional regulatory region and the transcriptional initiation region which are operably linked may be such that they are not naturally associated in the wild-type organism.
  • the host cells of the present invention may be used in a method of the invention (e.g., methods for identifying agents (substances such as genetic material, protein, lipids, carbohydrates, small molecules, and other compositions) that modulate nAChR activity, methods for screening for agents useful in treating disorders, and methods for identifying cytotoxic or cytoprotective agents).
  • the polynucleotide of the invention is stably expressed in the host cell such that a functional receptor is formed, wherein the functional receptor elicits electrophysiological currents in vitro or in vivo when stimulated by a wild-type al agonist.
  • Host cells useful for expression of the polynucleotides of the present invention maybe primary cells or cells of cell lines.
  • the host cells may be tumor cells or non-tumor cells.
  • Mammalian cell lines available as hosts for expression are known in the art and are available from depositories such as the American Type Culture Collection. These include but are not limited to HeLa cells, human embryonic kidney (HEK) cells, Chinese hamster ovary (CHO) cells, baby hamster kidney (BHK) cells, and others.
  • the host cell is one capable of expressing the wild-type 0/7 receptor.
  • the host cell may be the GH4C1 (rat anterior pituitary tumor; GH 4 C ⁇ ) cell line or SHEP1 (human epithelial; SH-EP1) cell line, or variants of these cell lines, that may be genetically modified to express the polynucleotides of the present invention (Tashjian A.H., Jr., Endocrinology, 1968, 82:342-352; Tashjian, A.H., Jr., Methods Enzymol, 58:527-535; Bancroft, F.C., in Functionally Differentiated Cell Lines (Sato, G., ed.), pp. 47-59, Alan R.
  • GH4C1 rat anterior pituitary tumor
  • SHEP1 human epithelial
  • Suitable promoters for mammalian cells also are known in the art and include viral promoters such as that from Simian Nirus 40 (SN40), Rous sarcoma virus (RSN), adenovirus (ADN), bovine papilloma virus (BPV) and cytomegalovirus (CMN).
  • SN40 Simian Nirus 40
  • RSN Rous sarcoma virus
  • ADN adenovirus
  • BSV bovine papilloma virus
  • CMV cytomegalovirus
  • Mammalian cells also may require terminator sequences and poly A addition sequences; enhancer sequences which increase expression also may be included, and sequences which cause amplification of the gene also may be desirable. These sequences are known in the art.
  • Nectors suitable for replication in mammalian cells may include viral replicons, or sequences which ensure integration of the appropriate sequences encoding the T6'S variant TM2 domain, the T6'S variant ofJ subunit, and/or the T6'S variant nACh receptor into the host genome.
  • An example of such a mammalian expression system is described in Gopalakrishnan et al. Eur. J. Pharmacol. -Mol. Pharmacol. 290: 237-246, 1995).
  • eukaryotic systems available as hosts for expression are also known, as are methods for introducing polynucleotides into such systems, such as amphibian cells using methods described in Briggs et al. (Neuropharmacol 34:583-590, 1995), insect cells using methods described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987), and the like.
  • the baculovirus expression system can be used to generate high levels of recombinant proteins in insect host cells.
  • the baculovirus expression system allows for high level of protein expression, while post-translationally processing the protein in a manner similar to mammalian cells.
  • Transfection may be by any known method for introducing polynucleotides into a host cell, including packaging the polynucleotide in a virus and transducing a host cell with the virus, by direct uptake of the polynucleotide by the host cell, and the like, which methods are known to those skilled in the art. The transfection procedures selected depend upon the host to be transfected.
  • the expression of the polynucleotide encoding the T6'S variant TM2 domain, the T6'S variant al subunit, and/or the T6'S variant nACh receptor may be detected by use of a radioligand selective for the receptor.
  • a radioligand selective for the receptor for example, for the nicotinic cholinergic receptor, such a ligand may be [ 125I ]c.-bungarotoxin.
  • any radioligand binding technique known in the art may be used to detect the receptor subunit (see, e.g., Winzor et al. (1995) Quantitative Characterization of Ligand Binding, Wiley-Liss, Inc., ⁇ .Y.).
  • T6'S variant TM2 domain polypeptide, the T6'S variant al subunit polypeptide, or the T6'S variant nACh receptor polypeptide can be recovered and purified from genetically modified host cell cultures expressing the same by known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxyapatite chromatography or lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the protein. Finally, high performance liquid chromatography (HPLC) can be employed for final purification steps.
  • HPLC high performance liquid chromatography
  • the T6'S variant TM2 domain polypeptide, the T6'S variant al subunit polypeptide, or the T6'S variant nACh receptor polypeptide, or functional fragments or homologues thereof, of the present invention also may be synthesized by conventional techniques known in the art, for example, by chemical synthesis such as solid phase peptide synthesis. In general, these methods employ either solid or solution phase synthesis methods (See, e.g., J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Co., Rockford, 111. (1984) and G. Barany and R. B. Merrifield, The Peptides: Analysis, Synthesis, Biology, editors E. Gross and J. Meienhofer, Vol.
  • either the DNA or the RNA derived therefrom, both of which encode the desired T6'S variant TM2 domain polypeptide, T6'S variant al subunit polypeptide, and/or T6'S variant nACh receptor polypeptide may be expressed by direct injection into a cell, such as a Xenopus laevis oocyte.
  • T6'S variant-encoding polynucleotide is injected into an oocyte for translation into a functional receptor subunit.
  • the function of the expressed T6'S variant TM2 domain polypeptide, T6'S variant o>7 subunit polypeptide, and/or T6'S variant nAChR polypeptide can be assessed in the oocyte by a variety of electrophysiological techniques including intracellular voltage recording, two-electrode voltage clamp, patch clamp methods, and the like.
  • the cation-conducting channel intrinsic to the nAChR opens in response to ACh or other nicotinic cholinergic agonists, permitting the flow of transmembrane current.
  • This cunent can be monitored directly by voltage clamp techniques or indirectly by intracellular voltage recording, wherein changes in membrane potential due to the induced cunent are measured.
  • Alternatives can include measurement of ion flux or fluorescent probes sensitive to transmembrane potential or changes in ion activity.
  • Receptors expressed in a genetically modified host cell may be used to identify compounds that modulate nAChR activity, hi this regard, the specificity of the binding of a compound showing affinity for the receptor is demonstrated by measuring the affinity of the compound for cells expressing the receptor or membranes from these cells.
  • This may be done by measuring specific binding of labeled (e.g., radioactive) compound to the cells, cell membranes or isolated receptor, or by measuring the ability of the compound to displace the specific binding of a standard labeled ligand.
  • labeled e.g., radioactive
  • Expression of variant receptors and screening for compounds that bind to, or inhibit the binding of labeled ligand to these cells or membranes provides a method for rapid selection of compounds with high affinity for the receptor. These compounds may be agonists, antagonists or modulators of the receptor. Expressed receptors also may be used to screen for agents, such as chemical compounds, that modulate nicotinic acetylcholine receptor activity.
  • One method for identifying agents that modulate nAChR activity comprises providing a cell that expresses a polynucleotide encoding a T6'S variant (e.g., T6'S variant TM2 domain polypeptide, a T6'S variant al subunit polypeptide, and/or a T6'S variant nACh receptor polypeptide of the present invention), contacting a test agent with the cell and measuring the effect of the test compound on the variant receptor activity.
  • the cell may be a bacterial cell, a mammalian cell, a yeast cell, an amphibian cell or any other cell expressing the receptor.
  • the cell is a mammalian cell or an amphibian cell.
  • a test agent is evaluated for its ability to elicit an appropriate response, e.g., the stimulation of transmembrane cunent flow, for its ability to inhibit the response to a cholinergic agonist, or for its ability to modulate the response to an agonist or antagonist.
  • the contacting step in the methods of the invention can involve combining or mixing the test agent and the cell, for example.
  • the present invention provides a method for identifying agents that modulate nicotinic acetylcholine receptor (nAChR) activity, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting a test agent with the host cell; and (c) determining :(i) the effect of the test agent on the variant al nAChR polypeptide or the host cell expressing the polynucleotide, or (ii) the binding of the test agent to the host cell or the variant al nAChR polypeptide, or (iii) both (c) (i) and (c) (ii).
  • nAChR nicotinic acetylcholine receptor
  • expressed receptors may be used to screen agents, such as chemical compounds, that exhibit either a cytoprotective or cytotoxic effect.
  • Abnormal activation of membrane channels is a potential cause of neurological disorders, such as neurodegenerative diseases (See, for example, Salamone, F. et al, MJM, 2000, 5:90-97; Cooper, E.C. and Jan, L.Y. Proc. Natl. Acad. Sci. USA, 1999, 96:4759-4766; Sha ⁇ les, C. and Wonnacott, S. Neuronal Nicotinic Receptors, October 2001, 19:1-12; Mihailescu, S. and Drucker-Colin, R. Arch. Med.
  • neurological disorders include, but are not limited to, presenile dementia (early onset Alzheimer's disease); senile dementia (dementia of the Alzheimer's type); movement disorders such as Parkinsonism including Parkinson's disease, Huntington's chorea, tardive dyskinesia, hyperkinesias, tremor, epilepsy, Tourette syndrome or other tic disorders; mania; attention deficit disorder; attention deficit hyperactivity disorder; sleep-wake disorder; chronic-fatigue syndrome; neuropathic pain; addiction (e.g., nicotine/smoking addiction); anxiety; dyslexia; schizophrenia; and obsessive-compulsive disorder.
  • presenile dementia eyely onset Alzheimer's disease
  • senile dementia dementia of the Alzheimer's type
  • movement disorders such as Parkinsonism including Parkinson's disease, Huntington's chorea, tardive dyskinesia, hyperkinesias, tremor, epilepsy, Tourette syndrome or other tic disorders
  • mania attention deficit disorder
  • the T6'S variant of the present invention can be used to screen for agents useful in treating disorders caused by alterations in sensory gating, immunofunction and neuropathic pain (e.g., pain associated with cancerous conditions, post he ⁇ atic neuralgia, diabetic neuropathy and osteoarthritis), as well as the foregoing list of neurological disorders.
  • nicotinic drugs are considered potential therapeutic agents in several neurological disorders, including the foregoing list of neurological disorders.
  • Compounds that activate nAChRs, especially of the al subtype, have been found to have in vivo activity in models of cognition enhancement (U.S. Patent No. 5,741,802, issued April 21, 1998).
  • Activation of the wild-type al nAChR appears to elicit cytoprotective properties (e.g., reduced cell lysis, see Donnelly-Roberts et al. Brain Res., 1996, 719:36-44).
  • cytoprotective properties e.g., reduced cell lysis, see Donnelly-Roberts et al. Brain Res., 1996, 719:36-44.
  • the T6'S variant of the present invention can be used to evaluate these questions, and to select among ligands for specific types of partial agonists or specific types of antagonists.
  • al nAChR ligand pharmacology can be studied through the use of the T6'S variant of the present invention (e.g., T6'S variant TM2 domain, T6'S variant al subunit, and/or T6'S variant nAChR).
  • the ability of a ligand to stabilize the desensitized state of the receptor can be evaluated by comparing the ligand 's potency and efficacy at the T6'S variant nAChR to its potency and efficacy at the wild-type al nAChR, for example.
  • the ligand's interaction with the T6'S variant nAChR can be compared to other variants of the wild-type al nAChR.
  • agents with variants and the wild-type nAChR can be identified using several methods, including, but not limited to, electrophysiologic measurement of transmembrane cunent flow or electrical potential, measurement of the fluorescence of potential-sensitive or ion-sensitive dyes, or measurement of radioactive ion flux and a variety of al nAChR expression systems, for example, transfected mammalian cells in culture or injected amphibian cells.
  • the responses are measured with a high throughput electrophysiology system and/or rapid fluorescence assays such as the FlipR (fluorometric imaging plate reader) system.
  • the expressed T6'S variant (e.g., T6'S variant TM2 domain, T6'S variant o7 subunit, and/or T6'S variant nACh receptor) may be used to investigate mechanisms of cytotoxicity and cytoprotection.
  • the evidence that activation of o7 nAChR is cytoprotective comes from the finding that nAChR agonists elicit cytoprotection in cells expressing the wild-type a7 nAChR subunit and that this cytoprotection is inhibited by selective o7 antagonists (for example, see Donnelly-Roberts et al. Brain Res., 719:36-44, 1996).
  • Cytoprotective or cytotoxic agents that interact with the T6'S variant (e.g., T6'S variant TM2 domain, T6'S variant o7 subunit, and/or T6'S variant nACh receptor) of the present invention may be identified using several methods.
  • One such method comprises providing a cell that expresses the T6'S variant TM2 domain, T6'S variant a7 subunit, and/or T6'S variant nACh receptor of the present invention, combining a test agent with the cell, and monitoring the cell for an indicator of cytotoxicity.
  • the variant nAChR subunit may be stably expressed in a recombinant mammalian cell line under the control of an inducible promoter, e.g., the LacSwitch system which is inducible by isopropylthiogalactoside ("IPTG").
  • IPTG isopropylthiogalactoside
  • the transfected cells could be cultured in the presence of an al blocker, such as methyllycaconitine ("MLA”) or mecamylamine, that would prevent or reduce cytotoxic action.
  • an al blocker such as methyllycaconitine ("MLA") or mecamylamine
  • MVA methyllycaconitine
  • mecamylamine mecamylamine
  • Both blockers are reversible, permitting one to measure the effect of the test agent on al nAChR function after the blocker is removed (e.g., washed out).
  • Cytoprotective agents can be identified by their ability to reduce cell death while cytotoxic agents can be identified by their ability to promote cell death. That these effects are mediated by the al subunit, T6'S variant or wild-type, can be identified by the ability of an al blocker to prevent the effect.
  • Cell death, or cytotoxicity can be monitored by a variety of techniques including but not limited to measurement of cell number or density in the culture, of cell growth rate (e.g., inco ⁇ oration of labeled nucleotide or amino acid), or of cell integrity for example by uptake of a dye (e.g., trypan blue is excluded by healthy cells, or by inclusion of MTT by healthy cells), or by the release of a cytoplasmic constituent such as lactate dehydrogenase (LDH).
  • cell growth rate e.g., inco ⁇ oration of labeled nucleotide or amino acid
  • cell integrity for example by uptake of a dye (e.g., trypan blue is excluded by healthy cells, or by inclusion of MTT by healthy cells), or by the release of a cytoplasmic constituent such as lactate dehydrogenase (LDH).
  • LDH lactate dehydrogenase
  • Cytoprotective agents may also be screened for their ability to antagonize a variant nAChR to a greater extent than a wild- type nAChR, or for their ability to augment the decay rate of variant nAChR compared to the wild-type nAChR.
  • the subject invention provides a method for identifying a cytoprotective agent, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain (such as a T6'S variant al subunit comprising SEQ ID NO:2); contacting a test agent (such as a putative wild-type al receptor agonist) with the host cell; and (c) monitoring the host cell or cellular function for an indication of cytotoxicity.
  • a test agent such as a putative wild-type al receptor agonist
  • whether the test agent overstimulates the variant al nAChR polypeptide is determined. Because the variant al nAChR polypeptide exhibits amplified pharmacologic responses compared to the wild-type al receptor, determination of overstimulation of the variant al nAChR polypeptide can indicate or connote that the test agent is sufficient to activate the wild-type c-7 receptor at a cytoprotective level. In this way, a potential therapeutic agent may elicit a cytotoxic response in the variant o7 nAChR polypeptide of the present invention but elicit a cytoprotective response in the wild-type al receptor.
  • A/3 ⁇ - 42 The neurotoxic ⁇ amyloid ⁇ - 42 (A/3 ⁇ - 42 ) is abundantly present in the amyloid plaques of Alzheimer's disease (AD) brains and also modulates cholinergic functions which are critical in memory and cognitive neurophysiology (Auld D. et al, Trends Neurosci 21:43-49, 1998).
  • A/3 ⁇ _ 42 interacts selectively with high affinity to the neuronal al nicotinic receptor.
  • the subject invention encompasses these methods, wherein polypeptides comprising the T6'S domain of the present invention, and which interact with A ⁇ , are substituted for the al and variant peptides described in U.S. Patent publication U.S. 2003/0092613.
  • the present invention also includes isolated polynucleotides (e.g., detection probes or primers) capable of selectively hybridizing to a nucleic acid sequence encoding a T6'S variant TM2 domain, T6'S variant al subunit, and/or T6'S variant nACh receptor.
  • the isolated polynucleotide can be capable of selectively hybridizing to a nucleic acid sequence comprising SEQ ID NO:18, SEQ DD NO:21, SEQ ID NO:22, SEQ ED NO:23, SEQ ED NO:24, SEQ DD NO:25, SEQ HD NO:26, SEQ DD NO:27, SEQ ID NO:28, SEQ ED NO:29, SEQ ID NO:30, or a functional fragment or homologue of any of the foregoing.
  • Such a detection probe will comprise a contiguous/consecutive span of at least 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 nucleotides.
  • Labeled probes or primers are labeled with a radioactive compound or with another type of label as set forth above (e.g., 1) radioactive labels, 2) enzyme labels, 3) chemiluminescent labels, 4) fluorescent labels, or 5) magnetic labels).
  • non-labeled nucleotide sequences may be used directly as probes or primers; however, the sequences are generally labeled with a radioactive element ( 32 P, 35 S, 3 H, 125 I) or with a molecule such as biotin, acetylaminofluorene, digoxigenin, 5-bromo-deoxyuridine, or fluorescein to provide probes that can be used in numerous applications.
  • a radioactive element 32 P, 35 S, 3 H, 125 I
  • a molecule such as biotin, acetylaminofluorene, digoxigenin, 5-bromo-deoxyuridine, or fluorescein to provide probes that can be used in numerous applications.
  • the isolated polynucleotide specifically hybridizes with at least 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
  • the isolated polynucleotide specifically hybridizes with at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, or 60 nucleotides of the T6'S variant TM2 domain (e.g., of SEQ DD NOs: 18, 21, 22, 23, 24, 25,
  • the isolated polynucleotide can specifically hybridize with nucleotides within that portion of the target sequence which encodes the T6'S variant TM2 domain and outside that which encodes the TM2 domain.
  • hybridization outside the T6'S variant TM2 domain can include hybridization to non- coding nucleotides.
  • Such polynucleotides can be produced by recombinant or synthetic techniques. Various degrees of stringency of hybridization can be employed. The more severe the conditions, the greater the complementarity that is required for duplex formation. Severity of conditions can be controlled by temperature, probe concentration, probe length, ionic strength, time, and the like.
  • hybridization is conducted under low, intermediate, or high stringency conditions by techniques well known in the art, as described, for example, in Keller, G.H., M.M. Manak, 1987, DNA Probes, Stockton Press, New York, NY., pp. 169-170.
  • hybridization of immobilized DNA on Southern blots with P- labeled gene-specific probes can be performed by standard methods (Maniatis et al. [1982] Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).
  • hybridization and subsequent washes can be canied out under intermediate to high stringency conditions that allow for detection of target sequences with homology to the exemplified polynucleotide sequence.
  • hybridization can be carried out overnight at 20-25° C below the melting temperature (T m ) of the DNA hybrid in 6X SSPE, 5X Denhardt's solution, 0.1% SDS, 0.1 mg/ml denatured DNA.
  • T m melting temperature
  • the melting temperature is described by the following formula (Beltz et al. [1983] Methods of Enzymology, R. Wu, L. Grossman and K. Moldave [eds.] Academic Press, New York 100:266-285).
  • Tm 81.5°C+16.6 Log[Na + ]+0.41 (%G+C)- 0.61 (%formamide)-600/length of duplex in base pairs.
  • Washes are typically carried out as follows: (1) twice at room temperature for 15 minutes in IX SSPE, 0.1% SDS (low stringency wash); (2) once at T m - 20°C for 15 minutes in 0.2X SSPE, 0.1% SDS (intermediate stringency wash).
  • hybridization can be carried out overnight at 10-20°C below the melting temperature (T m ) of the hybrid in 6X SSPE, 5X Denhardt's solution, 0.1% SDS, 0.1 mg/ml denatured DNA.
  • Tris-HCl pH 7.5
  • 1 mM EDTA 1 mM EDTA
  • 0.02% PVP 0.02% Ficoll
  • 0.02% BSA 500 ⁇ g/ml denatured salmon sperm DNA.
  • Filters are hybridized for 48 h at 65°C, the prefened hybridization temperature, in pre-hybridization mixture containing 100 ⁇ g/ml denatured salmon sperm DNA and 5-20 x 10 6 cpm of 32 P-labeled probe.
  • the hybridization step can be performed at 65°C in the presence of SSC buffer, IX SSC conesponding to 0.15M NaCl and 0.05 M Na citrate.
  • filter washes can be done at 37°C for 1 h in a solution containing 2X SSC, 0.01% PVP, 0.01% Ficoll, and 0.01% BSA, followed by a wash in 0.1X SSC at 50°C for 45 min.
  • filter washes can be performed in a solution containing 2X SSC and 0.1% SDS, or 0.5X SSC and 0.1% SDS, or 0.1X SSC and 0.1% SDS at 68°C for 15 minute intervals.
  • the hybridized probes are detectable by autoradiography.
  • filters washes are performed in a solution containing 2X SSC at 50°C and the hybridized probes are detectable by autoradiography.
  • Other conditions of intermediate stringency which may be used are well known in the art and as cited in Sambrook et al, 1989, Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Press, N.Y., pp. 9.47-9.57; and Ausubel et al, 1989, Cunent Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y. are inco ⁇ orated herein in their entirety. Duplex formation and stability depend on substantial complementarity between the two strands of a hybrid and, as noted above, a certain degree of mismatch can be tolerated.
  • the probe sequences of the subject invention include mutations (both single and multiple), deletions, insertions of the described sequences, and combinations thereof, wherein said mutations, insertions and deletions permit formation of stable hybrids with the target polynucleotide of interest. Mutations, insertions and deletions can be produced in a given polynucleotide sequence in many ways, and these methods are known to an ordinarily skilled artisan. Other methods may become known in the future.
  • a "complementary" polynucleotide sequence, as used herein, generally refers to a sequence arising from the hydrogen bonding between a particular purine and a particular pyrimidine in double-stranded nucleic acid molecules (DNA-DNA, DNA-RNA, or RNA- RNA).
  • a "complementary" polynucleotide sequence may also be refened to as an "antisense” polynucleotide sequence or an “antisense sequence”.
  • the present invention also includes pharmaceutical compositions useful for treating conditions associated with neurodegenerative processes, enzymatic function, affective disorders or immuno function, comprising a pharmaceutically acceptable carrier and an agent that regulates the function of a T6'S variant TM2 domain comprising the amino acid sequence of SEQ DD NO:2, the function of the T6'S variant al subunit comprising the amino acid sequence of SEQ ID NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ DD NO:20, and/or the function of the T6'S variant nACh receptor comprising the amino acid sequence of SEQ DD NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ DD NO:20; or a functional fragment or homologue of any of the foregoing.
  • Such homologues include, for example, the mature peptides of SEQ ID NOs. 7, 9, 11, 13, 15, and 17, wherein the threonine in the sixth amino acid position of the TM2 domain has been substituted with a serine residue.
  • the present invention also includes pharmaceutical compositions useful for treating conditions associated with neurodegenerative processes, enzymatic function, affective disorders or immuno function, comprising a pharmaceutically acceptable carrier and a polynucleotide encoding the T6'S variant TM2 domain comprising the amino acid sequence of SEQ ED NO:2, the T6'S variant al subunit comprising the amino acid sequence of SEQ DD NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ ID NO:20, and/or the T6'S variant nACh receptor comprising the amino acid sequence of SEQ ID NO:2, or SEQ HD NO:20, or amino acids 23 to 502 of SEQ ID NO:20; or a functional fragment or homologue of any of the foregoing.
  • the polynucleotide is preferably a component of a host cell or an expression vector, which further comprises a control sequence that directs expression of the polynucleotide, whereby the polynucleotide is expressed within the cell upon transplantation in vivo, i other embodiments, the polynucleotide T6'S variant TM2 domain can encode homologs of SEQ ID NO:20.
  • Such homologues include, for example, the mature peptides of SEQ ID NOs. 7, 9, 11, 13, 15, and 17, wherein the threonine in the sixth amino acid position of the TM2 domain has been substituted with a serine residue.
  • the present invention further includes methods for treating one or more of the aforementioned conditions by administering an agent that regulates the function of a T6'S variant of the present invention, or by administering a T6'S variant polypeptide of the present invention, or by administering a polynucleotide encoding a T6'S variant polypeptide of the present invention, to a patient in need thereof.
  • the agent, T6'S polypeptide, or T6'S polynucleotide administered is a pharmaceutical composition of the subject invention.
  • the pharmaceutical compositions of the present invention can be administered to a patient by any route that results in the desired therapeutic effect.
  • the pharmaceutical compositions can be administered intravenously (I.N.), intramuscularly (I.M.), subcutaneously (S.C.), intradermally (I.D.), orally, intranasally, etc.
  • the present invention includes methods of gene therapy whereby polynucleotides encoding the T6'S variant of the present invention is delivered to a patient, and the T6'S variant-encoding polynucleotide is expressed in vivo.
  • gene therapy refers to the transfer of genetic material (e.g., D ⁇ A or R ⁇ A) of interest into a host to treat or prevent a genetic or acquired disease or condition phenotype.
  • the genetic material of interest encodes a product (e.g., a protein, polypeptide, peptide, or functional R ⁇ A) whose production in vivo is desired.
  • the genetic material of interest can encode a hormone, receptor, enzyme, polypeptide or peptide of therapeutic value.
  • a product e.g., a protein, polypeptide, peptide, or functional R ⁇ A
  • the genetic material of interest can encode a hormone, receptor, enzyme, polypeptide or peptide of therapeutic value.
  • Two basic approaches to gene therapy have evolved: (1) ex vivo and (2) in vivo gene therapy.
  • the methods of the subject invention encompass either or both. In e vtvo gene therapy, cells are removed from a patient and, while being cultured, are treated in vitro.
  • a functional replacement gene is introduced into the cell via an appropriate gene delivery vehicle/method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the host/patient.
  • These genetically reimplanted cells have been shown to produce the transfected gene product in situ.
  • target cells are not removed from the subject, rather the gene to be transfened is introduced into the cells of the recipient organism in situ, that is within the recipient.
  • the host gene is defective, the gene is repaired in situ.
  • These genetically altered cells have been shown to produce the transfected gene product in situ.
  • the gene expression vector is capable of delivery/transfer of heterologous nucleic acid sequences into a host cell.
  • the expression vector may include elements to control targeting, expression and transcription of the nucleic acid sequence in a cell selective manner as is known in the art. It should be noted that often the 5'UTR and/or 3'UTR of the gene may be replaced by the 5 'UTR and/or 3 'UTR of the expression vehicle.
  • the expression vector can include a promoter for controlling transcription of the heterologous material and can be either a constitutive or inducible promoter to allow selective transcription.
  • the expression vector can also include a selection gene. Nectors can be introduced into cells or tissues by any one of a variety of known methods within the art.
  • nucleic acids by infection offers several advantages over the other listed methods. Higher efficiency can be obtained due to their infectious nature. Moreover, viruses are very specialized and typically infect and propagate in specific cell types. Thus, their natural specificity can be used to target the vectors to specific cell types in vivo or within a tissue or mixed culture of cells. Viral vectors can also be modified with specific receptors or ligands to alter target specificity through receptor mediated events.
  • a specific example of a D ⁇ A viral vector for introducing and expressing recombinant sequences is the adenovirus derived vector Adenop53TK.
  • This vector expresses a he ⁇ es virus thymidine kinase (TK) gene for either positive or negative selection and an expression cassette for desired recombinant sequences.
  • TK thymidine kinase
  • This vector can be used to infect cells that have an adenovirus receptor which includes most cancers of epithelial origin as well as others.
  • This vector as well as others that exhibit similar desired functions can be used to treat a mixed population of cells and can include, for example, an in vitro or ex vivo culture of cells, a tissue or a human subject. Additional features can be added to the vector to ensure its safety and/or enhance its therapeutic efficacy. Such features include, for example, markers that can be used to negatively select against cells infected with the recombinant virus.
  • Negative selection is therefore a means by which infection can be controlled because it provides inducible suicide through the addition of antibiotic. Such protection ensures that if, for example, mutations arise that produce altered forms of the viral vector or recombinant sequence, cellular transformation will not occur.
  • Features that limit expression to particular cell types can also be included. Such features include, for example, promoter and regulatory elements that are specific for the desired cell type.
  • recombinant viral vectors are useful for in vivo expression of a desired nucleic acid because they offer advantages such as lateral infection and targeting specificity.
  • compositions of the subject invention can be formulated according to known methods for preparing pharmaceutically useful compositions.
  • Formulations are described in a number of sources which are well known and readily available to those skilled in the art. For example, Remington 's Pharmaceutical Sciences (Martin EW [1995] Easton Pennsylvania, Mack Publishing Company, 19 th ed.) describes formulations which can be used in connection with the subject invention.
  • Formulations suitable for parenteral administration include, for example, aqueous sterile injection solutions, which may contain antioxidants, buffers, bacteriostats, and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents.
  • the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze dried (lyophilized) condition requiring only the condition of the sterile liquid carrier, for example, water for injections, prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powder, granules, tablets, etc. It should be understood that in addition to the ingredients particularly mentioned above, the formulations of the subject invention can include other agents conventional in the art having regard to the type of formulation in question.
  • the present invention also includes antibodies (e.g., monoclonal or polyclonal) and antibody fragments that specifically bind to a T6'S variant al TM2 domain comprising the amino acid sequence of SEQ DD NO: 2.
  • Antibodies that are immunospecific for the polypeptides as set forth herein are specifically contemplated, ha various embodiments, antibodies that do not cross-react with other proteins (such as A. marginale MSP5) are also specifically contemplated.
  • the antibody or antibody fragment does not specifically bind to the wild-type al TM2 domain.
  • the antibodies of the subject invention can be prepared using standard materials and methods known in the art (see, for example, Monoclonal Antibodies: Principles and Practice, 1983; Monoclonal Hybridoma Antibodies: Techniques and Applications, 1982; Selected Methods in Cellular Immunology, 1980; Immunological Methods, Vol. II, 1981; Practical Immunology, and Kohler et al. [1975] Nature 256:495).
  • antibodies can further comprise one or more additional components, such as a solid support, a carrier or pharmaceutically acceptable excipient, or a label.
  • a solid support e.g., a carrier or pharmaceutically acceptable excipient, or a label.
  • antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity, particularly neutralizing activity.
  • Antibody fragments comprise a portion of a full-length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab') , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multi-specific antibodies formed from antibody fragments.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. [1975] Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. [1991] Nature 352: 624-628 and Marks et al. [1991] J. Mol. Biol. 222: 581-597, for example.
  • the monoclonal antibodies described herein specifically include "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to conesponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to conesponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al. [1984] Proc. Natl. Acad Sci. USA 81: 6851-6855).
  • chimeric antibodies immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to conesponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homo
  • Single-chain Fv or “sFv” antibody fragments comprise the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the sFv to form the desired structure for antigen binding.
  • an "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-tenninal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • patient refers to human or non-human mammals.
  • patient may be a human or non-human primate, rodent (such as rat or mouse), or other mammalian species.
  • comprising means for one another throughout the instant application in order to attach the specific meaning associated with each term.
  • isolated or “biologically pure” refer to material that is substantially or essentially free from components which normally accompany the material as it is found in its native state.
  • isolated peptides in accordance with the invention preferably do not contain materials normally associated with the peptides in their in situ environment.
  • Link refers to any method known in the art for functionally connecting peptides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, and electrostatic bonding.
  • a includes plural reference unless the context clearly dictates otherwise.
  • a reference to “a receptor subunit” includes more than one such subunit, and the like.
  • the practice of the present invention can employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA technology, electrophysiology, and pharmacology, that are within the skill of the art.
  • cDNA clones Materials and Methods cDNA clones. These experiments used the rat neuronal nAChR and the mouse muscle cDNA clones, which were obtained from Dr. Jim Boulter (UCLA). Site-directed mutagenesis. Site-directed mutagenesis was performed using QuickChange (TM) kits (Strategene, LaJoUa, CA). In brief, two complimentary oligonucleotides were synthesized which contained the desired mutation flanked by 10-15 bases of unmodified nucleotide sequence. Using a thermal cycler, Pfu DNA polymerase extends the sequence around the whole vector, generating a plasmid with staggered nicks.
  • TM QuickChange kits
  • RNA transcripts were prepared in vitro using the appropriate mMessage mMachine kit from Ambion Inc. (Austin, TX). Expression in Xenopus oocytes. Mature (>9 cm) female Xenopus laevis African toads (Nasco, Ft.
  • oocytes were used as a source of oocytes.
  • frogs Prior to surgery, frogs were anesthetized by placing the animal in a 2 g/L solution of MS222 (3-aminobenzoic acid ethyl ester). Oocytes were removed from an incision made in the abdomen.
  • harvested oocytes were treated with collagenase from Worthington Biochemical Co ⁇ oration (Freehold, NJ) for 2 hours at room temperature in calcium-free Barm's solution (88 mM NaCl, 10 mM HEPES pH 7.6, 0.33 mM MgS04, 0.1 mg/ml gentamicin sulfate).
  • stage 5 oocytes were isolated and injected with 50 nl each of a mixture of the appropriate subunit cRNAs following harvest. Recordings were made 3 to 21 days after injection depending on the cRNAs being tested. Voltage-clamp recording of whole oocyte responses. Data were obtained by means of two-electrode voltage-clamp recording. Recordings were made at room temperature (21-24 deg. C) in Frog Ringer's solution (115 mM NaCl, 10 mM HEPES, 2.5 mM KCl, and 1.8 mM CaCl 2 , pH 7.3) with 1 ⁇ M atropine to inhibit muscarinic acetylcholine receptor responses.
  • Frog Ringer's solution 115 mM NaCl, 10 mM HEPES, 2.5 mM KCl, and 1.8 mM CaCl 2 , pH 7.3
  • Cunent responses are recorded using a PC interfaced to either a Warner OC-725C (Warner Instruments, Hamden, CT) or a GeneClamp 500 amplifier via a Digidata 1200 digitizer (Axon Instruments, Union City, CA).
  • some oocyte recordings were made using a beta version of the OpusXpress 6000A (Axon Instruments, Union City, CA).
  • OpusXpress is an integrated system that provides automated impalement and voltage clamp, which in our case permitted the study of four oocytes in parallel. Cells were automatically perfused with bath solution, and agonist solutions were delivered from a 96-well compound plate. In experiments using the OpusXpress system, the voltage and cunent electrodes were filled with 3 M KCl.
  • Imax denotes the maximal response for a particular agonist/subunit combination
  • n represents the Hill coefficient.
  • Imax > n > and the EC 50 were all unconstrained for the fitting procedures.
  • barium Ringers low barium: 90.7 mM NaCl, 2.5 mM KCl, 10 mM HEPES pH 7.3, 1.8 mM BaC12, 48.6 mM sucrose; high barium: 90.7 mM NaCl, 2.5 mM KCl, 10 mM HEPES pH 7.3, 18 mM BaC12).
  • Shifts in reversal potential were measured by changing the holding potential from -40 mV to +30 mV by 10 mV increments.
  • Calculations of barium - sodium permeability ratios using the extended GHK equation were performed using the Clampfit analysis portion of the pClamp software suite (Axon Instruments, Union City, CA). Barium was used instead of calcium to minimize the contribution of endogenous calcium-activated chloride channels (Sands, S.B. et al. Biophys. J. , 1993, 65:2614-2621). Calculations of peak amplitudes and net charge were made using pClamp either during acquisition or during subsequent Clampfit analysis.
  • GH4C1 cells were cultured in F10 medium (Gibco, Carlsbad, CA) at 37 °C, 5% CO 2 . Cells were transiently transfected using Fugene (Roche, Indianapolis, IN), according to the manufacturer instructions. One microgram of WT or T6'F mutant al cDNA (pTR-UF22, University of Florida, Gainesville, FL) was added to each 35-mm Petri dish, together with 0.5 or 1 ⁇ g of the cDNA encoding the red fluorescent DsRed protein (BD Biosciences Clontech, Palo Alto, CA). Cells were used 48-72 hours after transfection. Typical transfection efficiency was 10-25% using this method.
  • Example 1 The T6'S mutant receptor pharmacology closely resembles that of wild-type ⁇ 7
  • Raw data traces from transiently transfected GH4C1 cells show the larger amplitude and slower macroscopic kinetics of the T6'S mutant compared to wild-type ⁇ 7 ( Figures 8A and 8B), and that this observation carries over from oocyte studies to a mammalian cell under whole-cell voltage clamp.
  • Table 2 shows the results of oocyte experiments examining representative concentrations of a battery of compounds, indicating the ability of the T6'S mutant to effectively emulate wild-type al.
  • the T6'S mutant is more like wild-type al, particularly in regard to antagonists that have been converted to agonists in the L247T mutant.
  • FIGS 8 A and 8B and Table 2 show that the T6'S variant of the present invention yields much larger cunents than wild-type 07 receptor, and provides a more faithful representation of the wild-type o7 pharmacology than does the commonly used L247T mutant.
  • Example 2 Alpha7 TM2 6' mutants are functionally expressed in oocytes and impact absolute cunent amplitude
  • Raw data traces for each of the TM2 6' single point mutations and wild-type ⁇ 7 are shown in Figure 3.
  • a particularly obvious difference between the two 6' mutant receptors and wild-type al is the consistently large peak cunent for the T6'S mutant and the relatively small peak for the T6'F response.
  • Quantification of differences in absolute amplitude is complicated by variations in the degree of receptor expression from cell to cell (which is why each cell is used as it's own control), however variations in cunent amplitude similar to those seen were regularly observed.
  • Example 3 The ⁇ 7 T6'F mutation increases ACh potency while the T6'S mutant shows no significant change in ACh potency compared to wild type al Concentration-response functions for wild-type ⁇ 7 and each of the two TM2 6' mutants are seen in Figures 4A-4C. Both net charge (area under the curve) and peak CRCs are shown to illustrate the differences in apparent ACh potency as a function of the analysis method used. Comparison of these analyses shows that the wild-type ⁇ 7 receptor shows the greatest difference in apparent potency, while the two 6' mutants show less difference between the two methods, probably due to their slower response kinetics (see methods). In addition, a dramatic increase in ACh potency is seen for the net charge analysis if the T6'F mutant, whereas the T6'S mutant is not significantly different from wild-type.
  • Example 4 The ⁇ 7 T6'F mutation abolishes divalent ion permeability and reduces inward cunent rectification
  • Current- voltage relationships in either high or low extracellular barium show that the wild-type al receptor displays its characteristic inward rectification and permeability to divalent ions ( Figures 5A and 5B).
  • the extended GHK equation gives an estimated barium-to-sodium permeability ratio of approximately 4:1.
  • the T6'F mutant receptor shows little cunent rectification, particularly under conditions of high extracellular barium and there was a complete lack of a shift in reversal potential with varying extracellular divalent ion concentrations.
  • the GHK equation applied to these results gives a barium to sodium permeability ratio that is near zero.
  • Example 5 Succinylcholine is a selective agonist of muscle-type receptors, and is also an agonist of al T6'F mutant receptors, but not the T6'S mutant The comparative effect of 100 ⁇ M succinylcholine on muscle or wild-type al receptors, shows that succinylcholine is relatively ineffective in activating wild-type al

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Analytical Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention relates to a variant of the nicotinic acetylcholine receptor (nAChR) α7 subunit having a substitution within its second transmembrane (TM2) domain. Specifically, the sixth amino acid position within the TM2 domain has the point mutation T→ S, such that threonine-244 becomes serine-244. Advantageously, the α7 variant of the present invention retains the essential drug sensitivities of the wild-type α7 receptor, but does not exhibit the response-limiting form of fast desensitization. Therefore, the α7 variant is a 'gain of function' mutant that is particularly useful for testing new pharmacological agents. The present invention includes the T6'S variant TM2 domain, T6'S variant α7 subunit, and T6'S variant nACh receptor polypeptides, polynucleotides encoding these polypeptides, recombinant hosts expressing these polynucleotides, and assays utilizing the T6'S variant TM2 domain, T6'S variant α7 subunit, and/or T6'S variant nACh receptor.

Description

DESCRIPTION
VARIANT NEURONAL NICOTINIC ALPHA-7 RECEPTOR AND METHODS OF USE
Cross-Reference to Related Application This application is a continuation-in-part of U.S. Application Serial No. 10/769,085, filed January 30, 2004, which is hereby incorporated by reference herein in its entirety, including any figures, tables, nucleic acid sequences, amino acid sequences, and drawings.
The subject invention was made with government support under a research project supported by National Institutes of Health Grant No. GM57481-01A2. The federal government may have certain rights in this invention.
Background of Invention Nicotinic acetylcholine receptors (nAChRs) have long been recognized as the primary postsynaptic effector in vertebrate neuromuscular transmission, as well as having a clearly established role in ganglionic neurotransmission. In recent years, nicotinic receptors have also been identified as being important functional molecules in central neurons (reviewed in (McGehee, D.S. and Role, L.W., Annu. Rev. Physiol, 57:521-546, 1995; Dani, J.A., Biol. Psychiatry, 49:166-174, 2001)). There are multiple types of nAChRs in the brain associated with synaptic function, signal processing or cell survival. Based on differences in function, pharmacology, and tissue distribution, it is possible to categorize the larger family of nAChRs broadly into three major subfamilies. These are the muscle-type receptors, the neuronal beta subunit-containing receptors that bind agonist with relatively high affinity in the desensitized state, and the homomeric alpha subunit receptors, typified by oti '. Concomitant with the evolution of these diverse forms of the nAChR and the functional radiation of these receptor subtypes into various tissues where each subtype performs highly specialized functions, a large amount of sequence divergence has emerged. There is less than 40% amino acid sequence identity between the alpha subunit of muscle type receptors (c-1) and the α7-type receptor found in the brain. It has generally been assumed that the functional differences that exist among these receptor subtypes are emgergent properties of the collective sequence differences. Nonetheless, it is well appreciated that specific residues, conserved across multiple subtypes, can be key features common to all those subtypes. Several such foci of important conserved sequence are in the pore-forming second transmembrane domain, and in this domain the sequence identity between al and oil is increased to 60%. Both muscle-type and homomeric 07 nAChRs are widely expressed in mammals and bind the snake toxin, α-Btx. Despite these similarities, there are numerous important functional and pharmacological differences between the muscle and cύ receptors. For example, cϋ receptors have high divalent ion permeability, show inward rectifying current-voltage relationships, and have unique agonist concentration-dependent macroscopic response kinetics (Decker, E.R. and Dani, J.A. 1990, J. Neurosci., 10(10):3413-3420; Sands et al, 1993, Biophys. J, 65:2614-2621; Seguela et al, 1993, J. Neurosci., 13(2):596-604; Vernino et al, 1994, J Neurosci, 14:5514-5524). Previous work has indicated that amino acid residues in the TM2 domain of the beta subunit of heteromeric nAChRs are important regulators of nAChR pharmacology. Specifically, substitution of the TM2 6' (according to the numbering scheme proposed by Miller et al. (Miller, C. 1989, Neuron, 2:1195-1205)) phenylalanine of the muscle βl subunit for the neuronal βA subunit serine residue increased sensitivity to nicotine. This study also showed that substitution of βl subunit amino acid sequence at the TM2 6' and 10' positions of the neuronal βA subunit reduced inhibition by the ganglionic blocker mecamylaminie (Webster et al, 1999, Br. J. Pharmacol, 127:1337-1348). The therapeutic targeting of nicotinic receptors in the brain requires the identification of drugs which may be selective for their ability to activate or inhibit a limited range of these receptor subtypes. An important nAChR in the brain is the α7 subtype, which has high permeability to the calcium ion. This receptor subtype has been implicated to have an important role in improving memory-related behaviors and slowing neuronal degeneration, as may occur in aging or dementia. The activation of α7 receptors has also been suggested as a therapeutic approach for treating schizophrenia, Alzheimer's disease, inflammation, and other pathologies. (Salamone, F. et al, MJM, 2000, 5:90-97; Cooper, E.C. and Jan, L.Y. Proc. Natl. Acad. Sci. USA, 1999, 96:4759- 4766; Sharpies, C. and Wonnacott, S. Neuronal Nicotinic Receptors, October 2001, 19:1- 12; Mihailescu, S. and Dracker-Colin, R. Arch. Med. Res., 2000, 31:131-144; Papke, R.L. et al, Euro. J. Pharm., 2000, 393:179-195; Newhouse, P.A. and Kelton, M. Pharm. Acta Helv., 2000, 74:91-101; Newhouse, P.A. et al, Clin. Pharm., 1997, 11:206-228; Lloyd, G.K. and Williams, M. J. Pharm. Exp. Therapies, 2000, 292:461-467; Hollady, M.W. et al, J. Med. Chem., 1997, 40:4169-4194; Benowitz, N.L. Annu. Rev. Pharm. Toxicol, 1996, 36:597-613; Freedman, R. et al, Harvard Rev. Psych., 1994, 2:179-192; and Freedman, R. et al, J. Chem. Neuroanatomy, 2000, 20:299-306). The development of drugs for targeting the 7 receptor therapeutically has been impeded by the fact that the wild-type receptor exhibits a unique concentration-dependent fast desensitization that makes it difficult to study with large-scale drug screens. It would be advantageous to have available a variant of the wild-type α7 nAChR that does not exhibit the response-limiting form of fast desensitization. Variant 7 nAChRs have been reported previously (Galzi JL et al, Nature, 359:500-505, 1992; Bertrand D. et al, Proc. Natl. Acad. Sci. U.S.A., 90(15):6971-6975, 1993; Revah F. et al, Nature 353:846-849, 1991; Hogg R.C. et al, J. Biol. Chem., 278(29):26908-26912, July 2003, Epub May 13, 2003; Tonini R. et al, Neuropharmacology, 44(6):765-771, May 2003; Eddins D. et al, Am. J. Cell PhysioL, 283(5):C1454-C1460, 2003; Lyford L.K. et al, Biochem Biophys. Acta. 10;1559(l):69-78, 2002; Orr-Urtreger A et al, J. Neurochem., 74(5) :2154-2166, 2000; Palma E, et al, Proc. Natl. Acad. Sci. U.S.A., 96(23):13421-13426, 1999; Maggi L. et al, Mol Psychiatry, 3(4):350-355, 1998; Bertrand S. et al, Neuroreport, 8(16):3591- 3596, 1997; Palma E. et al, Proc. Natl. Acad. Sci. U.S.A., 94(4):1539-1543, 1997; Palma E. et al, Proc. Natl. Acad. Sci. U S A., 93(20):11231-11235, 1996; Bertrand D. et al, Proc. Natl. Acad. Sci. U.S.A., 89(4):1261-1265, 1992; U.S. Patent No. 6,323,000 (Briggs et al), filed December 20, 1996; and U.S. Patent No. 6,683,157 (Briggs et al), filed September 18, 2001. "Gain of function" mutants of the α7 receptor have previously been described; however, these mutants respond very differently to experimental drugs from wild-type receptors. The ideal "gain of function" mutant would retain the essential drug sensitivities of the wild-type native α7 receptors and, therefore, provide a much sought after model for testing new drugs. Brief Summary of the Invention The present invention relates to a variant of the nicotinic acetylcholine receptor (nAChR) 7 subunit having a substitution at the 6' position of the second transmembrane domain (referred to as M2 or TM2). Specifically, a threonine has been substituted with serine. For example, in the case of the rat (Rattus norvegicus) α.7 subunit, threonine-244 has been substituted with serine. In accordance with the numbering scheme proposed by Miller (Neuron, 1989, 2:1195-1205), the variant is referred to herein as the T6'S mutant or T6'S variant (because the point mutation T→ S is in the sixth amino acid position of the TM2 domain). Thus, the nucleotide sequence encoding the T6'S variant differs from the coding sequence of the wild-type rat α7 subunit in containing a codon (sequence of three nucleotides) encoding serine, instead of threonine, at nucleotides 799 to 781 of the coding sequence (nucleotides 733-735 excluding signal sequence). The T6'S variant of the subject invention exhibits pharmacological and electrophysiological characteristics that are very similar to the wild-type α7 subunit. However, unexpectedly, the T6'S variant exhibits much slower desensitization in comparison to the wild-type α7 subunit and is, therefore, a "gain of function" mutant. In fact, the T6'S variant of the present invention substantially eliminates the fast desensitization rate observed in the wild-type α7 subunit. This distinguishing feature, combined with the variant's similarities to the wild-type α7 subunit, makes the T6'S variant particularly useful for drug screening purposes. Accordingly, one aspect of the present invention is an isolated polynucleotide comprising a nucleotide sequence that encodes a variant of the nAChR TM2 domain of the α7 subunit, wherein the variant of the nAChR TM2 domain comprises the amino acid sequence of SEQ ID NO:2, or a functional fragment or homologue thereof, wherein the functional fragment or homologue contains the T→ S substitution at the T6'S position. In one embodiment, the polynucleotide comprises the nucleic acid sequence of SEQ ID NO: 18. In other embodiments, the polynucleotide comprises the nucleic acid sequence of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, or SEQ ID NO:25, each of which are degenerate variants of SEQ ID NO: 18. The present invention further includes an isolated polynucleotide comprising a nucleotide sequence that encodes a variant of the wild-type nAChR α7 subunit. In one embodiment, the polynucleotide comprises the nucleic acid sequence of SEQ ID NO:4 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:4. In other embodiments, the polynucleotide is a degenerate variant of SEQ ID NO:4 . For example, the degenerate variant can comprise the nucleic acid sequence of SEQ ID NO:26 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:26; or SEQ ID NO:27 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:27; or SEQ ID NO:28 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:28; or SEQ JJD NO:29 or nucleotides 67 to 1509 of SEQ ID NO:29;or SEQ ID NO:30 or the contiguous nucleotides 67 to 1509 of SEQ ID NO:30. In another aspect, the present invention includes an isolated polypeptide that is a variant of the wild-type TM2 domain of the α7 subunit (SEQ ID NO:l), wherein the variant domain comprises the amino acid sequence of SEQ ID NO:2. The present invention further includes isolated polypeptides that are variants of the wild-type nAChR α7 subunits of rat (amino acids 23 to 502 of SEQ ID NO:5), human (amino acids 23 to 502 of SEQ ID NO: 7), mouse (amino acids 23 to 502 of SEQ ID NO: 9) monkey (amino acids 23 to 502 of SEQ ID NO: 11), cow (amino acids 23 to 502 of SEQ ID NO: 13), chicken (amino acids 23 to 502 of SEQ ID NO: 13), zebra fish (amino acids 23 to 502 of SEQ ID NO: 15) wherein the variants of the wild-type nAChR α7 subunit comprise the contiguous amino acids 23 to 502 of SEQ ID NO:20, or a functional fragment or homologue thereof, wherein the functional fragment or homologue contains a TM2 domain with the T→ S substitution at the T6'S position (e.g., functional fragments or homologues comprising the amino acid sequence of SEQ ID NO:2). In other aspects, the present invention concerns an isolated nAChR (also referred to herein as the T6'S variant nAChR) comprising the T6'S variant TM2 domain (SEQ ID NO:2) or a T6'S variant c l subunit (such as the contiguous amino acids 23 to 502 of SEQ JJD NO:20), and an isolated polynucleotide encoding the T6'S variant nAChR or cfJ subunit. The isolated nAChR may comprise other wild-type nAChR subunits and/or nAChR variant subunits, in addition to the T6'S variant α7 subunit of the present invention. In another aspect, the present invention concerns a recombinant vector comprising a polynucleotide of the invention, such as a vector comprising a nucleotide sequence encoding the T6'S variant, or encoding a variant o-7 nAChR subunit having the T6'S variant TM2 domain, or encoding a variant nAChR comprising a variant oϋ subunit having the T6'S variant TM2 domain. In another aspect, the present invention concerns genetically modified host cells that have been transformed or transfected with vectors comprising a polynucleotide of the invention, including genetically modified progeny of such cells. In another aspect, the present invention concerns methods of producing recombinant polypeptides for the treatment of neurological conditions (e.g., neurodegenerative processes), enzymatic function, affective disorders, and immunofunction, using such genetically modified cells. In another aspect, the present invention concerns methods of treating pathologic conditions, such as neurological disorders, by administering to a subject a polynucleotide encoding a T6'S variant of the present invention, or a genetically modified cell of the invention that comprises and expresses the polynucleotide in vivo, or a polypeptide of the invention comprising the T6'S variant TM2 domain. In another aspect, the present invention concerns agents (e.g., antisense polynucleotides, compounds), such as antagonists, which are useful in treating conditions such as neurological conditions (e.g., neurodegenerative processes), enzymatic function, affective disorders, and immunofunction. Methods of treating patients using these antisense polynucleotides and compounds are also provided. In another aspect, the present invention pertains to methods and reagents for detecting the T6'S variant in a sample in vitro, or in vivo. In another aspect, the present invention is directed to a method of expressing a polynucleotide of the subject invention in a cell. In one embodiment, a polynucleotide encoding the T6'S variant is expressed in the cell. In another embodiment, a polynucleotide encoding a variant al nAChR subunit having the T6'S variant TM2 domain is expressed in the cell. In another embodiment, a polynucleotide encoding an nAChR comprising the T6'S variant subunit is expressed in the cell. In another aspect, the present invention is directed to a method of identifying agents that modulate the activity of the T6'S variant and receptors containing the variant subunit, and to a method of identifying cytoprotective or other therapeutic agents, using recombinant cells of the present invention.
Brief Description of Drawings Figure 1 shows a rendering of the nicotinic acetylcholine receptor (nAChR) accompanied by a hydrophobicity plot of the α7 nAChR subunit. Figure 2 shows the amino acid sequences of the wild-type α7 TM2 domain, wild- type β2 TM2 domain, wild-type βA TM2 domain, wild-type βl TM2 domain, and two α7 TM2 mutants having amino acid substitutions at the sixth and tenth amino acid positions of the TM2 domain. The numbering of specific residues of the second membrane spanning region is in accordance with that proposed by Miller et al. (Neuron, 2:1195- 1205, 1989). Figure 3 shows acetylcholine (ACh) evoked responses from oocytes expressing wild-type 7 (300 μM ACh), rat 7 TM2 T6'F (3 μM ACh), rat α7 TM2 T6'S (100 μM ACh). The inset represents the same current traces normalized to one another for the purpose of comparison. Figures 4A-4C show ACh evoked normalized responses from oocytes expressing wild-type α7, rat α7 TM2 T6'S, and rat α7 TM2 T6'F, respectively, at the ACh concentrations indicated. Figures 5A-5C show electrophysiological characterization of wild-type and mutant α7. Figures 5A and 5B demonstrate that the T6'F mutant receptor shows a nearly total loss of permeability to barium. Figure 5C demonstrates that the T6'S mutant exhibits a confounding biphasic current that occurs near the chloride reversal potential. Figures 6A-6D show electrophysiological traces demonstrating that substitution of the muscle βl subunit phenylalanine at the TM2 6' position confers the predicted sensitivity to succinylcholine, whereas the T6'S mutant is similar to wild-type α7. Figure 7 shows the concentration-response relationships for wild-type α7 and TM2 6' mutants showing selectivity of succinylcholine (SuCh) for the T6'F mutant. Figures 8 A and 8B show ACh evoked responses from GH4C1 cells expressing the T6'S mutant and the wild-type α7 receptor, respectively. Brief Description of Sequences SEQ ID NO:l is the amino acid sequence of the TM2 domain of the wild-type α7 subunit (the threonine in the sixth amino acid position of TM2 is underlined and bold for reference), which has 100% homology among Homo sapiens (human), Mucaca mulatto (rhesus monkey), Rattus norvegicus (rat), Mus musculus (mouse), Bos taurus (domestic cow), Gallus gallus (chicken), Danio rerio (zebrafish): ISLGITVLLSLTNFMLLVAE
SEQ ID ΝO:2 is the amino acid sequence of the T6'S variant of the second transmembrane (TM2) domain (the serine in the sixth amino acid position of TM2 is underlined and bold for reference): ISLGISNLLSLTVFMLLVAE
SEQ ID ΝO:3 is the nucleotide coding sequence of the TM2 domain of the wild-type rat α7 subunit (the codon encoding the threonine at the sixth amino acid of TM2 is underlined and bold for reference): atctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO:4 is the nucleotide coding sequence of the wild-type rat α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the sixth amino acid (6') of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatat caccaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaa gaggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgc aggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcc agactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatggg gaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatct gcagtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcat cctcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
(NCBI Accession No. NM_012832; Khirog S. et al, J. Physiol. (Lond.) 540(Pt. 2):425- 434, 2002; Oshikawa J. et al, Am. J. Physiol, Cell Physiol., 285(3):C567-C574, 2003; which are incorporated herein by reference in their entireties)
SEQ ID NO:5 is the amino acid sequence of the wild-type rat α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is underlined and the 6' threonine of TM2 is bold for reference):
MCGGRGGIWLALAAALLHVSLOGEFORRLYI^LVKNYNPLERPVANDSOPLTV YFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQ IWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGJTKSSCYIDVRWFPFDV QQCI^l^GSWSYGGWSLDLQMQEADISSYlPNGEWDLMGffGKP^EKJ YECCKE PYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSL TNFMLLNAEMPATSDSNPLIAOYFASTMIINGLSNNVTVIVLRYHHHDPDGGKM PKWTRIILLΝWCAWFLRMKRPGEDKVRPACQHKPRRCSLASVELSAGAGPPTSΝ GΝLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGAHPSDGDPDLAK ILEEVRY ^ΝRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPΝ FVEAVSKDFA
The 7 subunit protein has approximately 90% homology among rat, chick, and humans.
SEQ ID ΝO:6 is the nucleotide coding sequence of the wild-type human α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtccctgcaaggcgagttccagaggaa gctttacaaggagctggtcaagaactacaatcccttggagaggcccgtggccaatgactcgcaaccactcaccgtctacttctcc ctgagcctcctgcagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatgtcttggacagatca ctatttacagtggaatgtgtcagaatatccaggggtgaagactgttcgtttcccagatggccagatttggaaaccagacattcttctc tataacagtgctgatgagcgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtacctgcctccag gcatattcaagagttcctgctacatcgatgtacgctggtttccctttgatgtgcagcactgcaaactgaagtttgggtcctggtcttac ggaggctggtccttggatctgcagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtgggaatc cccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtcaccttcacagtgaccatgcgccgcag gacgctctactatggcctcaacctgctgatcccctgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattcc ggggagaagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggctgagatcatgcccgcaacatcc gattcggtaccattgatagcccagtacttcgccagcaccatgatcatcgtgggcctctcggtggtggtgacggtgatcgtgctgca gtaccaccaccacgaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcgtggttcctgc gaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaagcagcggcgctgcagcctggccagtgtgga gatgagcgccgtggcgccgccgcccgccagcaacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgt gtcccgacccccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctcctgcacggcgggc aaccccccgagggggacccggacttggccaagatcctggaggaggtccgctacattgccaaccgcttccgctgccaggacga aagcgaggcggtctgcagcgagtggaagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagactttgcgtaa
(NCBI Accession No. NM000746; Chini B. et al, Genomics 19(2):379-381, 1994; Burhaus L. et al, Parkinsonism Relat. Disord., 9(5):243-246, 2003; which are incoφorated by reference herein in their entireties)
SEQ JJD NO:7 is the amino acid sequence of the wild-type human α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference for reference):
MRCSPGGVWLALAASLLHVSLOGEFORJ^YT^LVKNYNPLERPVANDSOPLTV YFSLSLLQΓMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQI WKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGΓFKSSCYIDVRWFPFDVQ HCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEP YPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLT VFMLLNAEIMPATSDSNPLIAQYFASTMIINGLSNNNTNIVLOYHHHDPDGGKMP KWTRVILLΝWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASΝ GΝLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAK ILEEVRYIAΝRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP ΝFVEAVSKDFA
SEQ JJD ΝO:8 is the nucleotide coding sequence of the wild-type mouse 7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature 7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggccggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagcctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggcttcaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaaaaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgcagatgaacgctttgatgccacattccacaccaacgtcttggtgaatgcatctgggcattgccagtatctccctc caggcatattcaagagctcctgctacatcgatgtacgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtc ctatggagggtggtccttggacctgcagatgcaagaggcagatatcagcagctatatccccaatggagaatgggatctcatggg aatccctggcaaaaggaatgagaagttctatgaatgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaacctgctcattccttgtgtgctcatttcagccctggctttgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaataactgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttccgtgcccttgatagcacagtacttcgccagcaccatgatcatcgtgggcctctcagtggtcgtgacagtgattgtgctgcgata tcaccaccatgaccctgatggtggcaaaatgcctaagtggaccaggatcattcttctgaattggtgtgcatggtttctgcgcatgaa gaggccgggagaggacaaggtgcggccggcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagcg caggtgcggggccaccctccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaact ccagactctggggtcgtgtgtggtcgtttggcctgctccccaacacatgatgagcacctcatgcatggtacacacccctctgatgg ggaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggatgagagtgaggtgatct gcagtgagtggaagtttgcggcctgtgtggtggaccgcttgtgcctcatggccttttcggtttttaccatcatctgcaccatcggcat cctcatgtcagccccaaactttgtggaggctgtgtccaaagactttgcttaa
(NCBI Accession No. NM_007390; Orr-Urtreger A. et al, Genomics 26(2):399-402, 1995; Saragoza P.A. et al, Brain Res. Mol. Brain Res. 117(l):15-26, 2003; which are incoφorated by reference herein in their entireties)
SEQ ID NO:9 is the amino acid sequence of the wild-type mouse α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
MCGRRGGIWLALAAALLHVSLOGEFORRLYKELVKNYNPLERPVANDSOPLTV YFSLSLLQIMDVDEKNQVLTTNΓWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQ IWI^DILLY SADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDV QQC1^KFGSWSYGGWSLDLQMQEADISSY1TNGEWDLMG1TGKRNEKJ?YECCKE PYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSL TNFMLLNAEIMPATSDSNPLIAOYFASTMIINGLSNVVTVINLRYHHHDPDGGKM PKWTMILLΝWCAWFLRMKRPGEDKNRPACQHKPRRCSLASNELSAGAGPPSSΝ GΝLLYIGFRGLEGMHCAPTPDSGNNCGRLACSPTHDEHLMHGTHPSDGDPDLAK ILEENRYIAΝRFRCQDESENICSEWKFAACNNDRLCLMAFSNFTIICTIGILMSAPΝ FVEAVSKDFA
SEQ ID NO: 10 is the nucleotide coding sequence of the wild-type rhesus monkey α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgctgctcgcagggaggcgtctggctggctctggccgcgtcgctcctgcatgtgtccctgcaaggcgagttccagaggaa gctttacaaggagctggtcaagaactacaaccccttggagaggcccgtggccaatgactcgcaaccgctcaccgtctacttctcc ctgagcctcctgcagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatgtcttggacagatca ctatttacagtggaatgtgtcagaatatccaggggtgaagactgttcgtttcccagatggccagatttggaaaccagacattcttctc tataacagtgcggatgagcgctttgacgccacattccacaccaacgtgttggtgaattcttctgggcattgccagtacctgcctcca ggcatattcaagagttcctgctacatcgatgtgcgctggtttccctttgatgtgcagcattgcaaactgaagtttggatcctggtcttat ggaggctggtccttggatctgcagatgcaggaggcagatatcagtggctatatccccagtggagaatgggacctagtgggaatt cccggcaagaggagtgaaaagttctatgagtgctgcaaagagccctaccccgatgtcaccttcacagtgaccatgcgccgcag gaccctctactacggcctcaacctgctgatcccctgtgtgctcatctctgcccttgccctgctggtgttcctgcttcctgcagattccg gggagaagatttccctggggataacagtcttactctctctcactgtcttcatgctgctcgtggctgagatcatgcccgcaacatctg attcagtaccattgatagcccagtacttcgccagcaccatgatcatcgtgggcctctccgtggtggtgacggtgatcgtgctgcag taccaccaccacgaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcgtggttcctgcg catgaagaggccgggagaggataaggtgcgcccggcctgccagcacaagcagcgccgctgcagcctggccagcgtggaga tgagcgccgtggcgccgccgcccgccagcaacgggaacctgctgtacatcggcttccgcggcctggacggcatgcattgcgc cccgacccccgactccggggtggtgtgcggccgcatggcctgctcccccacgcacgacgagcacctcctgcacggtgggca gccccccgagggggacccggacctggccaagatcctggaggaggtccgctacatcgccaaccgctttcgctgccaggacga aagcgaggcggtctgcagtgagtggaagttcgccgcctgcgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagactttgcgtaa
(NCBI Accession No. AF486623)
SEQ ID NO: 11 is the amino acid sequence of the wild-type rhesus monkey α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
MRCSOGGVWLALAASLLHVSLOGEFORKLYKELVKNYNPLERPVANDSOPLTV
YFSLSLLQΓMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQI
WI^DILLYI SADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQ HCKLKFGSWSYGGWSLDLQMQEADISGYJJPSGEWDLVG GKRSEKFYECCKEP YPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLT VFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTV1VLQYHHHDPDGGKMP KWTRVILLΝWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASΝ GNLLYIGFRGLDGMHCAPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAK ILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP NFVEAVSKDFA
SEQ JJD NO: 12 is the nucleotide coding sequence of the wild-type domestic cow α7 subunit, -including nucleotides 1-57 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 775-834 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgcgcggctcgttgtgcctggcgctggcagcgtcgatcttgcacgtgtccctgcaaggcgagttccagaggaagctctacaaa gacctggtgaagaactacaaccccttggagaggccggtggccaacgactcgctgccgctcacagtctacttctccctgagcctc ctgcagatcatggacgtggatgagaagaaccaggtgttgaccaccaacatttggctacaaatgacttggacagatcactatttaca gtggaatgcatccgagtatccaggcgtgaagacggttcgtttcccagacggccagatctggaagccagacattctcctctacaac agtgctgatgaacggtttgatgctacgttccacaccaatgtgttagtgaattcttctgggcactgccagtacctccctccaggcatct ttaagagctcctgctacatcgatgtgcgctggttcccatttgatgtgcagcagtgcaaactgaagtttgggtcctggtcttatggagg atggtccttggatctgcaaatgcaggaggcagacatcagcggctatatcccaaatggagaatgggaccttgtgggggtcttggg caagcggagtgagaagttctacgagtgctgcaaagaaccctacccagacgtgaccttcacggtcagcatccgccgcaggactc tctactacggcctcaacctgctcatcccctgtgtgctcatctctgccctagccctcctcgtcttcttgctccctgcagactctggagag aaaatctccctgggaatcacagttttactctccctcaccgtcttcatgctgctggtagctgagatcatgcctgcgacctctgactcag tgcccttaatagcccagtacttcgccagcaccatgatcatcgtgggcctctctgtggttgtcacggtgatcgtgctacagtaccacc accacgaccctgatggtggcaagatgcccaagtggaccagagtcgtcctcctgaactggtgtgcctggttccttcgcatgaaga ggccgggggaggacaaggtgcggccagcctgccagcacaacgagcggcgctgcagcctggccagcgtggagatgagcgc agtggcggggccgccggccaccaatggcaacctgctgtacatcggctttcgcggcctggacaccatgcactgcgcacccacc cctgactcaggggtcgtgtgcggccgcgtggcctgctccccaacccatgacgagcacctgctgcacgccggccagccctctga gggggacccggacctagccaagatcctggaggaggtgcgctacattgcccaccgcttccgctgccaggatgagagtgaggcc gtgtgcagtgagtggaagttcgcggcctgtgtggtggaccgcctgtgtctcatggccttctccgtcttcaccatcctctgcaccatt ggcatcctgatgtcggcgcccaacttcgttgaagctgtgtccaaagacttcgcttga
(NCBI Accession No. NM_174515; Garcia-Guzman, M. et al, Eur. J. Neurosci. 7(4):647-655, 1995; Maneu V. et al, Ann. NY. Acad. Sci. 971:165-167, 2002; which are incoφorated by reference herein in their entirety)
SEQ ED NO: 13 is the amino acid sequence of the wild-type cow α7 subunit, including amino acids 1-19 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 259-278 is also underlined for reference):
MRGSLCLALAASILHVSLOGEFORKLYKDLVKNYNPLERPVANDSLPLTVYFSLS LLQ DVDEKNQVLTTNIWLQMTWTDHYLQWNASEYPGVKTVRFPDGQIWKPD ILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKL KFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGVLGKRSEKFYECCKEPYPD VTFTVSIRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFML LNAE PATSDSNPLIAQYFASTMIINGLSNNVTNINLQYHHHDPDGGKMPKWTR NNLLΝWCAWFLRMlDlPGEDKNRPACQFfΝERRCSLASNEMSANAGPPATΝGΝL LYIGFRGLDTMHCAPTPDSGNNCGRNACSPTHDEHLLHAGQPSEGDPDLAKILEE NRYIAHRFRCQDESEANCSEWKFAACNNDRLCLMAFSNFTILCTIGILMSAPΝFN EANSKDFA
SEQ ID NO: 14 is the nucleotide coding sequence of the wild-type chicken α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgggcctccgggcgctgatgctgtggctgctggcggcggcggggctcgtgcgcgagtccctgcaaggagagttccaaagga agctgtacaaggagctgctgaagaactacaaccctctggaacgaccagttgcaaatgactcccagccgctcactgtctatttcact ctcagcctcatgcagatcatggatgtggatgaaaagaatcaagtattaacaacaaacatctggctacaaatgtactggacagatca ttacttacagtggaatgtgtctgaataccctggagtgaagaacgtccgttttcctgatggactgatttggaagccagatattcttctct ataacagtgctgatgaaagatttgatgctacatttcacactaatgttttagtcaattcttcgggacactgccaatatctgccaccaggc atatttaaaagctcatgctacatagacgtgcgttggtttccatttgatgttcagaagtgcaatctgaagtttggatcttggacatatgga ggctggtccttagacttacaaatgcaagaagcagatatatccggctatatttcaaatggagagtgggatttagtaggaattcctggg aagagaactgagagcttttatgagtgctgtaaagaaccatacccagatatcacattcacagtaaccatgagacgcagaactctcta ctacgggctcaaccttcttattccctgtgtactgatatcagcacttgccttattagtctttctgcttccagcagactcaggagaaaagat ctcactaggtataacagttttattgtctctcaccgtcttcatgttactcgtggctgaaattatgccagcaacatctgattctgtgccctta attgctcagtattttgccagcaccatgattattgttggcctctctgttgttgtcactgttatcgttctacaataccatcatcacgatccaga tgggggaaaaatgcctaaatggacaagagtcatccttctgaattggtgtgcttggtttctgaggatgaagagaccaggggaagat aaagtgcgtcccgcctgtcaacataaacagcgccgatgcagcctgtcaagcatggagatgaacactgtgagtggtcagcaatgc agtaatgggaacatgctgtatattgggtttcgagggctggatggggttcactgcacacccaccactgattcaggggtgatctgtgg gaggatgacctgttcaccaacagaggaagaaaatcttctgcacagtggccacccctctgaaggcgacccagatttggctaagat cctggaagaggtcagatacattgcaaacaggttcagagaccaggatgaagaagaagccatttgcaacgaatggaagtttgcag cctctgtagtagatcggctctgcttgatggcattttcggtcttcaccatcatttgtacaattggcatcttaatgtcagcaccaaactttgt agaggctgtctctaaagattttgcttaa
(NCBI Accession No. X52295; Schoepfer R. et al, Neuron 5(l):35-48, 1990; which is incoφorated herein by reference in its entirety)
SEQ ID NO: 15 is the amino acid sequence of the wild-type chicken α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
MGLRALMLWLLAAAGLVRESLOGEFORKLYKELLKNYNPLERPVANDSOPLTV YFTLSLMQBVIDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDG LIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDV QKCNLKFGSWTYGGWSLDLQMQEADISGYISNGEWDLVGIPGKRTESFYECCKE PYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLT VFMLLVAEIMPATSDSVPLIAOYFASTMIIVGLSVVVTVIVLOYHHHDPDGGKMP KWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLSSMEMNTVSGQQCS NGNMLYIGFRGLDGVHCTPTTDSGNICGRMTCSPTEEENLLHSGHPSEGDPDLAK ILEENRYIANRFRDQDEEEAICNEWKFAASNNDRLCLMAFSNFTIICTIGILMSAPN FVEAVSKDFA
SEQ ED NO: 16 is the nucleotide coding sequence of the wild-type zebrafish α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature α7 receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgggaatttgggaatatactctttatttcaccaccacatgctgcctatggagtgtgtcacttcagggggagcatcagaggagactc tatagagacctgatgaaagattataacccactggagagacctgtgttcaatgacacccactcactcacggtgtatttcagcatgag cctcatgcagattatggatgtggatgaaaagaatcaagttcttacgaccaacatttggctacagctgtactggtatgactactatcttc aatggaacgcctcagaatatcctggagtaaccaatgtaaggtttcctgacagtcagatctggaagcctgacatcttactttataaca gtgctgatgaaaggtttgatgccacatttcatactaatgtgctggtgaactcttctggtgcctgccaatacttaccgccagggatcttc aaaagcacctgctacatcgacgttcgctggttcccctttgatcttcagaggtgtgatctgaaatttggctcctggacgtatggaggat ggtctctggacctgcagatgattgatgccgacatcacaggatacattgctaatggagagtgggaccttgtggaagttccaggtag acggaatgagaggttctacgactgctgcaaggagccgtacccagatgtgacttttacggtggtgatgcggagacgaacactgtat tacggtcttaatctacttattccctgtgtgctcatctctactctggccctgctggtgttcctgctgcctgctgactcaggagaaaagato tcgctcgggatcaccgtcctgctctcgctgacagttttcatgcttttggtagcagagataatgccggcaacatctgactctgtgccttt aatagctcagtattttgccaccaccatggttattgttggactatctgtaatagccacagtctgggttttacaataccactaccatgatcc tgaaggaggaaaaatgccaaaatggacacgtgtggtgctgttgaactggtgtgcctggttcctgcggatgaagagacctggcga agacaaagttcgcccagcttgtcacaacaagcagccgcgcagcagcctctccagcgtggatctaaacatcagccctggagtcg cacagtccaccaatggaaacctgctgtacatcggcttccgcgggatggacactattcactatgctacttcacccgattctggggtg atctgcagccggcttgtggcgaccggagaggaggatgtgctgctccccggagcccaggcatcttcagtcagtagtagcggccc tggagaaaccgaactgtccaagatcttggatgaggtgcggtacatttccaagcgctttcgggaccaagacgaggaagacactgt gtgtaatgagtggaagtttgcagcgtctgtgattgaccgtctctgtctcatggctttttccctgttcaccatcctctgcaccattggtatc ttaatgtctgcccctaactttgttgaggccatatcaaaagattttttcacctga
(NCBI Accession No. NM_201219; Zirger J.M. et al, Gen Expr. Patterns 3(6):747-754, 2003)
SEQ ID NO: 17 is the amino acid sequence of the wild-type zebra fish α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
MGIWEYTLYFTTTCCLWSVSLQGEHQRRLYRDLMKDYNPLERPVFNDTHSLTVY FSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQI WKPDILLYNSADERFDATFHTNNLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQ RCDLKFGSWTYGGWSLDLQMmADITGYIANGEWDLVEVPGRRNERFYDCCKE PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSL TNFMLLNAEIMPATSDSNPLIAOYFATTMNINGLSNIATNWVLOYHYHDPEGGK MPKWTRNNLLΝWCAWFLRMKRPGEDKVRPACHΝKQPRSSLSSVDLΝISPGVAQ STΝGΝLLYIGFRGMDTIHYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSGPG ETELSKILDEVRYISKRFRDQDEEDTVCΝEWKFAASVIDRLCLMAFSLFTILCTIGI LMSAPΝFVEAISKDFFT SEQ ID NO:18 is a nucleotide coding sequence of the T6'S variant of the rat (and mouse) second transmembrane (TM2) domain from (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctctcttggaatatctgtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO: 19 is a nucleotide coding sequence of the T6'S variant α7 subunit, including nucleotides 1-66 (underlined), which encode a signal peptide that is not present in the mature receptor subunit (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaatatctgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctgat tctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatatc accaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaag aggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgca ggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcca gactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatgggg accccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatctgc agtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcatcc tcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
SEQ ED NO:20 is an amino acid sequence of the T6'S variant α7 subunit, including amino acids 1-22 (underlined), which represent a signal peptide that is not present in the mature receptor subunit (the TM2 domain at amino acids 262-281 is also underlined for reference):
MCGGRGGIWLALAAALLHNSLOGEFORRLY^LVKNYNPLERPNANDSOPLTN YFSLSLLQMDVDEKΝQVLTTΝIWLQMSWTDHYLQWΝMSEYPGVKΝVRFPDGQ IWKPDILLYΝSADERFDATFHTΝNLNΝASGHCQYLPPGIFKSSCYIDVRWFPFDV QQCKLKFGSWSYGGWSLDLQMQEADISSYEPΝGEWDLMGIPGKRΝEKFYECCKE PYPDVTYTVTMRRRTLYYGLΝLLIPCVLISALALLVFLLPADSGEKISLGISVLLSL TVFMLLVAEIMPATSDSVPLIAOYFASTMIIVGLSVVVTVTNLRYHHHDPDGGKM PKWTMILLΝWCAWFLRMKRPGEDKNRPACQHKPRRCSLASNELSAGAGPPTSΝ GΝLLYIGFRGLEGMHCAPTPDSGNNCGRLACSPTHDEHLMHGAHPSDGDPDLAK ILEENRYIANRFRCQDESENICSEWKFAACNNDRLCLMAFSNFTIICTIGILMSAPN FVEAVSKDFA
SEQ ID NO:21 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tcc-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatatccgtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO:22 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ TD NO:2), containing a degenerate codon (-tca-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatatcagtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO:23 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-tcg-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaatateggtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO:24 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaataagtgtcttactttctctgactgtcttcatgctgcttgtggctgag
SEQ ID NO:25 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 18) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agc-)encoding serine at the sixth amino acid position of the TM2 domain: atctctcttggaataagcgtcttactttctctgactgtcttcatgctgcttgtggctgag SEQ ID NO:26 is an example of a degenerate variant of a nucleotide sequence (SEQ ID
NO:19) encoding a T6'S mutant α7 subunit (SEQ ID NO:20), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain (the
TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaatatccgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctgat tctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatatc accaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaag aggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgca ggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcca gactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatgggg accccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatctgc agtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcatcc tcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa SEQ ID NO:27 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO: 19) encoding a T6'S mutant α7 subunit (SEQ ID NO:20), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaatatcagtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatat caccaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaa gaggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgc aggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcc agactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatggg gaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatct gcagtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcat cctcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
SEQ ID NO:28 is an example of a degenerate variant of the nucleotide sequence (SEQ ID
NO: 19) encoding a T6'S mutant α7 subunit (SEQ ID NO:20), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain (the
TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaatatcggtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatat caccaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaa gaggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgc aggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcc agactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatggg gaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatct gcagtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcat cctcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
SEQ ID NO:29 is an example of a degenerate variant of the nucleotide sequence (SEQ ID NO: 19) encoding a T6'S mutant α7 subunit (SEQ ID NO:20), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaataagtgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatat caccaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaa gaggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgc aggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcc agactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatggg gaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatct gcagtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcat cctcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
SEQ ID NO:30 is an example of a degenerate variant of the nucleotide sequence (SEQ ED
NO:19) encoding a T6'S mutant α7 subunit (SEQ ID NO:20), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain (the TM2 domain at nucleotides 784-843 is underlined and the codon for the 6' amino acid of
TM2 (threonine) is bold for reference): atgtgcggcgggcggggaggcatctggctggctctggccgcggcgctgctgcacgtgtccctgcaaggcgagttccagagga ggctgtacaaggagctggtcaagaactacaacccgctggagaggccggtggccaacgactcgcagccgctcaccgtgtacttc tccctgagtctcctgcagatcatggatgtggatgagaagaaccaagttttaaccaccaacatttggctacaaatgtcttggacagat cactatttgcagtggaacatgtctgagtaccccggagtgaagaatgttcgttttccagatggccagatttggaaaccagacattctc ctctataacagtgctgatgagcgctttgatgccacgttccacaccaatgttttggtgaatgcatctgggcattgccagtatctccctcc aggcatattcaagagctcctgctacattgacgttcgctggttcccttttgatgtgcagcagtgcaaactgaagtttgggtcctggtcc tatggagggtggtcactggacctgcaaatgcaagaggcagatatcagcagctatatccccaacggagaatgggatctcatggga atccctggcaaaaggaatgagaagttctatgagtgctgcaaagagccatacccagatgtcacctacacagtaaccatgcgccgt aggacactctactatggcctcaatctgctcatcccttgtgtactcatttcagccctggctctgctggtattcttgctgcctgcagactct ggagagaaaatctctcttggaataagcgtcttactttctctgactgtcttcatgctgcttgtggctgagatcatgccagcaacatctga ttctgtgcccttgatagcacaatacttcgccagcaccatgatcatcgtgggcctctctgtagtggtgacagtgattgtgctgagatat caccaccatgaccctgatggtggcaaaatgcctaagtggaccagaatcattctcctgaactggtgtgcatggtttctgcgcatgaa gaggcccggagaggacaaggtgcggccagcttgtcagcacaagcctcggcgctgcagcctggccagtgtggagctgagtgc aggtgctgggccacccaccagcaatggcaacctgctctacattggcttccgaggcctggagggcatgcactgtgccccaactcc agactctggggtcgtatgtggccgtttggcctgctccccaacacatgatgagcacctcatgcacggtgcacacccctctgatggg gaccccgacctggccaagatcctggaggaggtccgctacatcgccaaccgcttccgctgccaggacgagagtgaggtgatct gcagtgaatggaagtttgcagcctgcgtggtggaccgcttgtgcctcatggccttttcggtctttaccatcatctgtaccatcggcat cctcatgtcagctccaaactttgtggaggctgtgtccaaagactttgcttaa
SEQ ID NO:31 is a nucleotide coding sequence of the T6'S variant of the human second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atttccctggggatatctgtcttactctctcttaccgtcttcatgctgctcgtggctgag SEQ ED NO:32 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatocgtcttactctctcttaccgtcttcatgctgctcgtggctgag
SEQ ED NO:33 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatateagtcttactctctcttaccgtcttcatgctgctcgtggctgag
SEQ ID NO:34 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatoggtcttactctctcttaccgtcttcatgctgctcgtggctgag
SEQ DD NO:35 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagtgtcttactctctcttaccgtcttcatgctgctcgtggctgag
SEQ ED NO:36 is an example of a degenerate variant of a nucleotide sequence (SEQ ID NO:31) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagcgtcttactctctcttaccgtcttcatgctgctcgtggctgag SEQ DD NO:37 is a nucleotide coding sequence of the T6'S variant of the rhesus monkey second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atttccctggggatatetgtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ DD NO:38 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatatocgtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ DD NO:39 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO: 37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatateagtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ DD NO:40 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggatateggtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ DD NO:41 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ID NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagtgtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ DD NO:42 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:37) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atttccctggggataagcgtcttactctctctcactgtcttcatgctgctcgtggctgag
SEQ ED NO:43 is a nucleotide coding sequence of the T6'S variant of the cow second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctccctgggaatctetgttttactctccctcaccgtcttcatgctgctggtagctgag
SEQ ID NO:44 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctecgttttactctccctcaccgtcttcatgctgctggtagctgag
SEQ DD NO:45 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctcagttttactctccctcaccgtcttcatgctgctggtagctgag
SEQ DD NO:46 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatctcggttttactctccctcaccgtcttcatgctgctggtagctgag
SEQ DD NO:47 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatcagtgttttactctccctcaccgtcttcatgctgctggtagctgag SEQ DD NO:48 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:43) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctccctgggaatcagcgttttactctccctcaccgtcttcatgctgctggtagctgag
SEQ ED NO:49 is a nucleotide coding sequence of the T6'S variant of the chicken second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctcactaggtatatetgttttattgtctctcaccgtcttcatgttactcgtggctgaa
SEQ DD NO:50 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatccgttttattgtctctcaccgtcttcatgttactcgtggctgaa
SEQ ED NO:51 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatcagttttattgtctctcaccgtcttcatgttactςgtggctgaa
SEQ HD NO:52 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtatatcggttttattgtctctcaccgtcttcatgttactcgtggctgaa
SEQ DD NO:53 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtataagtgttttattgtctctcaccgtcttcatgttactcgtggctgaa
SEQ DD NO: 54 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:49) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctcactaggtataagcgttttattgtctctcaccgtcttcatgttactcgtggctgaa
SEQ ID NO:55 is a nucleotide coding sequence of the T6'S variant of the zebra-fish second transmembrane (TM2) domain of (the codon encoding serine, in place of threonine, at the sixth amino acid position of TM2 is underlined): atctcgctcgggatctotgtcctgctctcgctgacagttttcatgcttttggtagcagag
SEQ DD NO:56 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tec-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctccgtcctgctctcgctgacagttttcatgcttttggtagcagag
SEQ DD NO:57 is an example of a degenerate variant of a nucleotide sequence (SEQ ED NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-tea-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctcagtcctgctctcgctgacagttttcatgcttttggtagcagag
SEQ DD NO:58 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-teg-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatctcggtcctgctctcgctgacagttttcatgcttttggtagcagag SEQ DD NO:59 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ DD NO:2), containing a degenerate codon (-agt-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatcagtgtcctgctctcgctgacagttttcatgcttttggtagcagag
SEQ DD NO:60 is an example of a degenerate variant of a nucleotide sequence (SEQ DD NO:55) encoding the T6'S mutant second transmembrane (TM2) domain (SEQ ED NO:2), containing a degenerate codon (-age-) encoding serine at the sixth amino acid position of the TM2 domain: atctcgctcgggatcagcgtcctgctctcgctgacagttttcatgcttttggtagcagag
Detailed Disclosure of the Invention The T6'S variant of the α7 nicotinic receptor subunit contains a T→ S substitution at the 6' position of the second transmembrane (TM2) domain (corresponding to residue 244 of the wild-type rat α7 subunit). The biophysical and pharmacological properties of the T6'S variant, including its slow rate of desensitization, make it particularly useful for drug screening. The term "AChR", as used herein, refers to a receptor for the neurotransmitter acetylcholine ("Ach"). AChRs are broadly subclassified as nicotinic or muscarinic.
These types differ in their pharmacology, structures, and signal transduction mechanisms. The term "nAChR", as used herein, refers to a nicotinic acetylcholine receptor.
Although nAChRs of various subunit structures are best known in muscle cells, neurons, and chromaffm cells, they are not necessarily excluded from other cells types (e.g., glial cells, mast cells, blood cells, fibroblasts, etc.). The term "nAChR subunit", as used herein, refers to a proteinaceous molecule that can combine with other such molecules in the formation of a nAChR. For example, the muscle nAChR is believed to be a pentamer comprised of four types of transmembrane subunit: two αl subunits, one βl subunit, one δ subunit and one γ or e subunit depending upon the nAChR form. Neuronal nAChR analogously are also thought to be pentameric and comprised of related but different subunits. At present, eight neuronal a subunits (a2 - cθ) and three neuronal β subunits (β2 - βA) have been isolated. Some neuronal nAChRs appear to require at least one a subunit and at least one β subunit for a functional complex (e.g., exhibiting ion channel response to ACh or other agonists). Some subunits, however, may assemble to form "homooligomeric" nAChR, as in the case of al nAChR in Xenopus oocytes and in transfected mammalian cells. Although the combination of nAChR subunits with subunits related to other types of receptor (e.g., other classes of ligand-gated ion channel) has not been demonstrated, such combinations are possible and contemplated within the scope of the present invention. The term "wild-type" (WT), as used herein, refers to the typical, most common or conventional form as it occurs in nature. The human wild-type a7 nAChR was described by Doucette-Stamm et al. (Drug Dev. Res. 30: 252-256, 1993; and U.S. Patent No. 5,837,489, which are incoφorated herein by reference in their entireties). The rat and mouse wild-type al nAChRs were described by Khiroug, S.S., et al. (J. Physiol (Lond.) 540 (Pt 2): 425-434, 2002) (NCBI Accession No. L31629); and Orr-Urtreger,A. et al. (Genomics 26 (2): 399-402, 1995) (NCBI Accession No. L37663), respectively. An abbreviation of the form "α7XnιιnO" intends an al subunit in which the amino acid X, located at position nnn, relative to the wild-type sequence, has been replaced by amino acid O. Thus, for example, the o7T144S subunit indicates the threonine residue located at position 144 in the wild-type receptor has been replaced by a serine residue. The term "nicotinic cholinergic agonist", as used herein, refers to an agent that binds to and activates a nicotinic acetylcholine receptor. By "activates" is intended the elicitation of one or more pharmacological, physiological, or electrophysiological responses. Such a response includes, but is not limited to, cell membrane depolarization and increased permeability to Ca other cations. The term "nicotinic cholinergic antagonist", as used herein, refers to a substance that binds to a nicotinic acetylcholine receptor and prevents agonists from activating the receptor. Pure antagonists do not activate the receptor, but some substances may have mixed agonist and antagonist properties. Nicotinic cholinergic channel blockers block the ability of agonists to elicit current flow through the nicotinic acetylcholine receptor channel, but do so by blocking the channel rather than by preventing agonists from binding to and activating the receptor. The term "nicotinic cholinergic modulator", as used herein, refers to an agent that influences the activity of the nicotinic acetylcholine receptor through interaction at one or more sites other than the classic agonist binding site. The modulator may itself increase or decrease receptor activity, or may influence agonist activity (for example, potentiating responses) without itself eliciting an overt change in channel current. A single agent can have different properties at different nicotinic acetylcholine receptor subtypes, for example, being an agonist at one receptor and antagonist at another, or an antagonist at one and a channel blocker at another. The term "nAChR regulator", as used herein, refers to an agent that may act as an agonist, antagonist, channel blocker or modulator. The term "polynucleotide", as used herein, refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, the term includes double- stranded and single-stranded DNA, as well as double-stranded and single-stranded RNA. It also includes modifications, such as by methylation and/or by capping, and unmodified forms of the polynucleotide. The term "variant", as used herein, refers to an oligonucleotide sequence that differs from the related wild-type sequence in one or more nucleotides. Such a variant oligonucleotide is expressed as a protein variant which, as used herein, indicates a polypeptide sequence that differs from the wild-type polypeptide in the substitution, insertion or deletion of one or more amino acids. The variant polypeptide differs in primary structure (amino acid sequence), but may or may not differ significantly in secondary or tertiary structure or in function relative to the wild-type. The term "mutant", as used herein, generally refers to an organism or a cell displaying a new genetic character or phenotype as the result of change in its gene or chromosome. In some instances, however, the term "mutant" may be used in reference to a variant protein or oligonucleotide and "mutation" may refer to the change underlying the variant. The terms "polypeptide" and "protein" are used interchangeably herein and indicate a molecular chain of amino acids of any length linked through peptide bonds.
Thus, peptides, oligopeptides, and proteins are included within the definition of polypeptide. The terms include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like. In addition, protein fragments, analogs, mutated or variant proteins, fusion proteins and the like are included within the meaning of polypeptide. The polypeptides of the present invention are, optionally, N-acetylated and/or C- terminal amidated. The polypeptides of the present invention may be synthetically produced using methods well known in the art utilizing D or L isomeric amino acid precursors. Therapeutic peptides of the present invention preferably contain one, a few, or all of their amino acid residues in the D-isomer conformation. The polypeptides of the present invention may also be produced by recombinant technology, as small polypeptides, as small synthetic fusion proteins comprising one or more polypeptides of the present invention fused to a targeting polypeptide. The term "fusion protein" as used herein refers to protein constructs that are the result of combining multiple protein domains or linker regions for the puφose of gaining function of the combined functions of the domains or linker regions. This is most often accomplished by molecular cloning of the nucleotide sequences to result in the creation of a new polynucleotide sequence that codes for the desired protein. Alternatively, creation of a fusion protein may be accomplished by chemically joining two proteins together. Unless otherwise specified, the terms "T6'S variant" or "T6'S mutant" are used herein interchangeably to refer a TM2 domain having a serine residue in the sixth amino acid position (6'S), an al subunit polypeptide having a TM2 domain with a serine in the 6'S position, and/or an nACh receptor having a TM2 domain with a serine in the 6'S position, functional fragments or variants of any of the foregoing polypeptides; or polynucleotides encoding any of the foregoing polypeptides, including functional fragments or variants thereof. Preferably, the TM2 domain is at least 20 amino acids in length. Preferably, the TM2 domain comprises the amino acid sequence of ISLGISVLLSLTVFMLLVAE (SEQ DD NO:2). The terms "T6'S variant" or "T6'S mutant" are used herein interchangeably to refer to any polynucleotide encoding an amino acid sequence comprising a TM2 domain having a serine residue in the sixth amino acid position (6'S). Preferably, the polynucleotide encodes the amino acid sequence of ISLGISNLLSLTNFMLLVAE (SEQ DD ΝO:2), such as the nucleic acid sequences of SEQ DD NO: 18, SEQ ED NO:19, SEQ ED NO:21, SEQ DD NO:22, SEQ DD NO:23 SEQ DD NO:24, SEQ DD NO:25, SEQ DD NO:26, SEQ DD NO:27, SEQ DD NO:28, SEQ DD NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ DD NO:32, SEQ ED NO:33, SEQ DD NO:34, SEQ DD NO:35, SEQ ED NO:36, SEQ ED NO:37, SEQ ED NO:38, SEQ DD NO:39, SEQ DD NO:40, SEQ DD NO:41, SEQ DD NO:42, SEQ DD NO:43, SEQ ED NO:44, SEQ DD NO:45, SEQ DD NO:46, SEQ DD NO:47, SEQ DD NO:48, SEQ DD NO:49, SEQ DD NO:50, SEQ DD NO:51, SEQ DD NO:52, SEQ DD NO:53, SEQ DD NO:54, SEQ DD NO:55, SEQ DD NO:56, SEQ DD NO:57, SEQ DD NO:58, SEQ ED NO:59, and SEQ ED NO:60, or degenerate variants (i.e., structurally conservative mutants) of these nucleic acid sequences. The nucleotide sequences encoding the T6'S variant, or encoding the T6'S variant nAChR used in the subject invention include "homologous" or "modified" nucleotide sequences. Homologous nucleic acid sequences will be understood to include any nucleotide sequence obtainable by mutagenesis according to techniques well known to persons skilled in the art, and exhibiting modifications in relation to the normal sequences. For example, mutations in the regulatory and/or promoter sequences for the expression of a polypeptide that result in a modification of the level of expression of a polypeptide according to the invention provide for a "modified nucleotide sequence". Likewise, substitutions, deletions, or additions of nucleic acid to the polynucleotides of the invention provide for "homologous" or "modified" nucleotide sequences. In various embodiments, "homologous" or "modified" nucleic acid sequences have substantially the same biological function in vitro and/or in vivo as the T6'S variant of the present invention. The function of homologues of the invention can be assessed by a number of methods known for assessing nAChR receptor function known in the art, including those disclosed herein. For example, function of homologues can be determined in the Xenopus oocyte by a variety of electrophysiological techniques including intracellular voltage recording, two-electrode voltage clamp, patch clamp methods, and the like. A "homologous" or "modified" nucleotide sequence will also be understood to include a splice variant of the polynucleotides of the instant invention or any nucleotide sequence encoding a "modified polypeptide" as defined below. A "homologue" or "modified" nucleotide or amino acid sequence will also be understood to include mammalian homologues of the nucleotide sequences and amino acid disclosed herein. Homologues of the present invention include those sequences having "functionally conservative mutations" and or "structurally conservative mutations." The phrase "functionally conservative mutation", as used herein, intends a change in a polynucleotide encoding a derivative polypeptide in which the activity is not substantially altered compared to that of the polypeptide from which the derivative is made. Such derivatives may have, for example, amino acid insertions, deletions, or substitutions in the relevant molecule that do not substantially affect its properties (see Table 1). Functionally conservative mutants of the amino acid sequence of SEQ DD NO:2, SEQ ID NO:20, amino acids 23 to 502 of SEQ JJD NO:20, and other T6'S polypeptides disclosed herein, are encompassed by the present invention. The phrase "structurally conservative mutant", as used herein, refers to a polynucleotide containing changes in the nucleic acid sequence but encoding a polypeptide having the same amino acid sequence as the polypeptide encoded by the polynucleotide from which the degenerate variant is derived. This can occur because a specific amino acid may be encoded by more than one codon (sequence of three nucleotides). Structurally conservative mutants of the nucleic acid sequences encoding SEQ ID NO: 2, SEQ ED NO:20, amino acids 23 to 502 of SEQ DD NO:20, and other T6'S polypeptides disclosed herein are encompassed by the present invention. For example, degenerate variants of the T6'S TM2 domain (SEQ DD NO: 2) having alternative codons that encode serine at the sixth amino acid position are SEQ ED NO:21, SEQ DD NO:22, SEQ ED NO:23, SEQ ID NO:24, and SEQ DD NO:25. Degenerate codons encoding serine at the sixth amino acid position include -tct-, -tec-, -tea-, -teg-, -agt-, and -age-. Examples of degenerate variants of the T6'S α7 receptor having alternative codons that encode serine at the sixth amino acid position of the TM2 domain include, but are not limited to, SEQ ED NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, and SEQ DD NO:30. Specific embodiments of these degenerate variants of the T6'S α7 receptor are nucleotides 67 to 1509 of SEQ DD NO:26, nucleotides 67 to 1509 of SEQ DD NO:27, nucleotides 67 to 1509 of SEQ DD NO:28, nucleotides 67 to 1509 of SEQ ID NO:29, nucleotides 67 to 1509 of SEQ DD NO:30, and the nucleotide sequences of SEQ DD NOs. 31 to 60. Of course, the polynucleotides of the present invention may include further degenerate codons as well (i.e., in addition to those codons encoding serine in the sixth amino acid position of the TM2 domain). Accordingly, the polynucleotides of the present include degenerate variants which, because of the degeneracy of the genetic code, have different nucleic acid sequences (i.e., one or more differing codons) from those polynucleotides exemplified herein, but which nonetheless encode the same amino acid sequences. A listing of valid codons for any given amino acid can be readily determined by those having knowledge of, or access to, the genetic code. Alternatively, so-called "back-translation" tools can be utilized to reverse-translate any given amino acid into its respective codons. One such tool is the "Utilities/Codon Calculator" feature of DNATOOLS for WINDOWS 95/98/NT/2000, which displays all possible degenerate codons for each amino acid input. A homologous nucleotide sequence, for the purposes of the present invention, encompasses a nucleotide sequence having a percentage identity with the bases of the nucleotide sequences of between at least (or at least about) 20.00% to 99.99% (inclusive). The aforementioned range of percent identity is to be taken as including, and providing written description and support for, any fractional percentage, in intervals of 0.01%, between 20.00% and 99.99%. These percentages are purely statistical and differences between two nucleic acid sequences can be distributed randomly and over the entire sequence length. In various embodiments, homologous sequences exhibiting a percentage identity with the bases of the nucleotide sequences of the present invention can have 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99 percent identity with the polynucleotide sequences of the instant invention. Homologous nucleotide and amino acid sequences include mammalian homologues of the rat T6'S variant and mammalian homologues of the rat T6'S variant nAChR. In a specific embodiment, the mammalian homologue is a nucleotide sequence encoding the human T6'S variant or the human T6'S variant nAChR. In another embodiment, the mammalian homologue is the amino acid sequence of the human T6'S variant or the human T6'S variant nAChR. The T6'S variant homologues of the present invention include polypeptides containing, as a primary amino acid sequence, all or part of an exemplified T6'S variant polypeptide sequence. The T6'S variant homologues thus include T6'S variant polypeptides having conservative substitutions, i.e., altered sequences in which functionally equivalent amino acid residues are substituted for residues within the sequence resulting in a peptide which is biologically active. For example, one or more amino acid residues within the sequence can be substituted by another amino acid of a similar polarity which acts as a functional equivalent, resulting in a silent alteration. In one aspect of the present invention, conservative substitutions for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs (see Table 1). Conservative substitutions also include substitutions by amino acids having chemically modified side chains that do not eliminate the biological function of the resulting T6'S variant homologue.
Table 1. Class of Amino Acid Examples of Amino Acids Nonpolar Ala, Val, Leu, De, Pro, Met, Phe, Tφ Uncharged Polar Gly, Ser, Thr, Cys, Tyr, Asn, Gin Acidic Asp, Glu Basic Lys, Arg, His
Both protein and nucleic acid sequence homologies may be evaluated using any of the variety of sequence comparison algorithms and programs known in the art. Such algorithms and programs include, but are by no means limited to, TBLASTN, BLASTP, FASTA, TFASTA, and CLUSTALW (Pearson and Lipman Proc. Natl. Acad. Sci. USA, 1988, 85(8):2444-2448; Altschul et al. J. Mol. Biol, 1990, 215(3):403-410; Thompson et al. Nucleic Acids Res., 1994, 22(2):4673-4680; Higgins et al. Methods Enzymol, 1996, 266:383-402; Altschul et al J. Mol. Biol, 1990, 215(3):403-410; Altschul et al. Nature Genetics, 1993, 3:266-272). Identity and similarity of related nucleic acid molecules and polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988;York (1988); Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;York (1993); Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Jersey (1994); Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Press (1987); Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991;York (1991); and Carillo et al, SIAM J. Applied Math., 48:1073 (1988). The methods, vectors, and compositions of the present invention can utilize functional fragments of nucleic acid sequences encoding the T6'S variant or T6'S variant nAChR disclosed herein, so long as the functional fragments include those nucleotides encoding the second transmembrane (TM2) domain of the α7 subunit and have the T→ S substitution in the sixth amino acid position of the TM2 domain. Representative fragments of the nucleotide sequences according to the invention will be understood to mean any polynucleotide fragment having at least 30 consecutive nucleotides, preferably at least 35 consecutive nucleotides, and still more preferably at least 40 or at least 50 consecutive nucleotides of the sequence from which it is derived. The upper limit for such fragments is one nucleotide less than the total number of nucleotides found in the full-length sequence (or, in certain embodiments, of the full length open reading frame (ORF) identified herein). In other embodiments, depending upon the relevant full-length sequence from which they are derived, fragments can comprise consecutive nucleotides of 31, 32, 33, 34 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82; 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 123, 124, 125, 126, 127, and up to one nucleotide less than the full-length T6'S variant TM2 domain, up to one nucleotide less than the full-length T6'S variant subunit, or up to one nucleotide less than the full-length T6'S variant nAChR. It is also well known in the art that restriction enzymes can be used to obtain functional fragments of the nucleic acid sequences. For example, Ba l exonuclease can be conveniently used for time-controlled limited digestion of DNA (commonly referred to as "erase-a-base" procedures). See, for example, Maniatis et al. Molecular Cloning: A Laboratory Manual, 1982, Cold Spring Harbor Laboratory, New York; Wei et al. J. Biol. Chem., 1983, 258:13006-13512. The methods, vectors, and compositions of the present invention can utilize amino acid sequences that are functional fragments of the full-length T6'S variant TM2 domain, the T6'S variant subunit, or T6'S variant nAChR. Representative fragments of the polypeptides according to the invention will be understood to mean any polypeptide fragment having at least 9 or 10 consecutive amino acids, preferably at least 15 amino acids, and still more preferably at least 20 or at least 30 consecutive amino acids of the polypeptide sequence from which it is derived. The upper limit for such fragments is one amino acid less than the total number of amino acids found in the full-length sequence. In other embodiments, depending upon the relevant full-length sequence from which they are derived, fragments of the polypeptides can comprise consecutive amino acids of 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, and up to one amino acid less than the full-length T6'S variant TM2 domain, up to one amino acid less than the full-length T6'S variant subunit, or up to one amino acid less than the full-length T6'S variant nAChR. Fragments of polypeptides can be any portion of the full-length amino acid sequence (including human or non- human mammalian homologues) that exhibit functional activity, e.g., a C-terminally or N-terminally truncated version, or an intervening portion of the full-length sequence. The terms "recombinant host cells", "host cells", "cells", "cell lines", "cell cultures", and other such terms denoting microorganisms or higher eukaryotic cell lines cultured as unicellular entities refer to cells which can be, or have been, used as recipients for recombinant vectors or other transfer DNA, immaterial of the method by which the DNA is introduced into the cell or the subsequent disposition of the cell. The terms include the progeny of the original cell that has been transfected. Cells in primary culture as well as cells such as oocytes also can be used as recipients. The term "genetic modification" as used herein refers to the stable or transient alteration of the genotype of a cell of the subject invention by intentional introduction of exogenous nucleic acids by any means known in the art (including for example, direct transmission of a polynucleotide sequence from a cell or virus particle, transmission of infective virus particles, and transmission by any known polynucleotide-bearing substance) resulting in a permanent or temporary alteration of genotype. The nucleic acids may be synthetic, or naturally derived, and may contain genes, portions of genes, or other useful polynucleotides in addition to those encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or T6'S variant nAChR. A translation initiation codon can be inserted as necessary, making methionine the first amino acid in the sequence. The term "vector" is used to refer to any molecule (e.g., nucleic acid, plasmid, or virus) usable to transfer coding sequence information (e.g., nucleic acid sequence encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or T6'S variant nACh receptor), such as to a host cell. A vector typically includes a replicon in which another polynucleotide segment is attached, such as to bring about the replication and/or ' expression of the attached segment. The term includes expression vectors, cloning vectors, and the like. Thus, the term includes gene expression vectors capable of delivery/transfer of exogenous nucleic acid sequences into a host cell. The term "expression vector" refers to a vector that is suitable for use in a host cell (e.g., a patient's cell, tissue culture cell, cells of a cell line, etc.) and contains nucleic acid sequences which direct and/or control the expression of exogenous nucleic acid sequences. Expression includes, but is not limited to, processes such as transcription, translation, and RNA splicing, if introns are present. Nucleic acid sequences can be modified according to methods known in the art to provide optimal codon usage for expression in a particular expression system. The vector may include elements to control targeting, expression and transcription of the nucleic acid sequence in a cell selective manner as is known in the art. It should be noted that often the 5'UTR and/or 3'UTR of the gene may be replaced by the 5'UTR and/or 3'UTR of the expression vehicle. The vector can include a promoter for controlling transcription of the exogenous material and can be either a constitutive or inducible promoter to allow selective transcription. The expression vector can also include a selection gene. A "coding sequence" is a polynucleotide sequence that is transcribed into mRNA and/or translated into a polypeptide. The boundaries of the coding sequence are determined by a translation start codon at the 5 '-terminus and a translation stop codon at the 3 '-terminus. A coding sequence can include, but is not limited to, mRNA, cDNA, and recombinant polynucleotide sequences. Variants or analogs may be prepared by the deletion of a portion of the coding sequence, by insertion of a sequence, and/or by substitution of one or more nucleotides within the sequence. Techniques for modifying nucleotide sequences, such as site-directed mutagenesis, are well known to those skilled in the art (See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Second Edition, 1989; DNA Cloning, Vols. I and II, D.N. Glover ed., 1985). Optionally, the polynucleotides of the present invention, and composition and methods of the invention that utilize such polynucleotides, can include non-coding sequences. The term "operably-linked" is used herein to refer to an arrangement of flanking control sequences wherein the flanking sequences so described are configured or assembled so as to perform their usual function. Thus, a flanking control sequence operably-linked to a coding sequence may be capable of effecting the replication, transcription and/or translation of the coding sequence under conditions compatible with the control sequences. For example, a coding sequence is operably-linked to a promoter when the promoter is capable of directing transcription of that coding sequence. A flanking sequence need not be contiguous with the coding sequence, so long as it functions correctly. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence, and the promoter sequence can still be considered "operably-linked" to the coding sequence. Each nucleotide sequence coding for a polypeptide will typically have its own operably- linked promoter sequence. The terms "transfection" and "transformation" are used interchangeably herein to refer to the insertion of an exogenous polynucleotide into a host cell, irrespective of the method used for the insertion, the molecular form of the polynucleotide that is inserted, or the nature of the cell (e.g., prokaryotic or eukaryotic). The insertion of a polynucleotide per se and the insertion of a plasmid or vector comprised of the exogenous polynucleotide are included. The exogenous polynucleotide may be directly transcribed and translated by the cell, maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be stably integrated into the host genome. The term "isolated", as used herein, when referring to a polynucleotide or a polypeptide, means that the indicated molecule is present in the substantial absence of other similar biological macromolecules. The term "isolated" as used herein means that at least 75 wt. %, more preferably at least 85 wt. %, more preferably still at least 95 wt. %., and most preferably at least 98 wt. % of a composition is the isolated polynucleotide or polypeptide. An "isolated polynucleotide" that encodes a particular polypeptide refers to a polynucleotide that is substantially free of other nucleic acid molecules that do not encode the subject polypeptide; however, the molecule may include functionally and or structurally conservative mutations as defined herein. The term "test sample", as used herein, refers to biological samples and non- biological samples (e.g., synthetic fluids). Biological samples which can be evaluated by the methods of the present invention described herein include body fluids such as whole blood, tissues and cell preparations. The terms "cell" and "cells" are used interchangeably herein to refer to a single cell or plurality of cells (i.e., at least one cell). The following single-letter amino acid abbreviations are used throughout the text: Alanine: A; Arginine: R; Asparagine: N; Aspartic acid: D; Cysteine: C; Glutamine: Q; Glutamic acid: E; Glycine: G; Histidine: H; Isoleucine: I; Leucine: L; Lysine: K; Methionine: M; Phenylalanine: F; Proline: P; Serine: S; Threonine: T; Tryptophan: W; Tyrosine: Y; and Valine: V. The T6'S variant TM2 domain, the T6'S variant al subunit, the T6'S variant nACh receptor; polynucleotides encoding the T6'S variant TM2 domain, the T6'S variant o7 subunit, and the T6'S variant nACh receptor; and methods of making the T6'S variant TM2 domain, the T6'S variant o7 subunit, and the T6'S variant nACh receptor, are provided herein, and encompassed by the subject invention. The invention includes not only the T6'S variant but also methods for screening compounds using the T6'S variant and cells expressing the T6'S variant TM2 domain. Further, polynucleotides and antibodies which can be used in methods for detection of the variant subunit, as well as the reagents useful in these methods, are provided. Compounds and polynucleotides useful in regulating the variant and its expression also are provided as disclosed herein below. Accordingly, one aspect of the present invention is an isolated polynucleotide that encodes a variant of the nAChR TM2 domain of the α7 subunit, wherein the variant of the nAChR TM2 domain comprises the amino acid sequence of SEQ ID NO:2, or a functional fragment or homologue thereof, wherein the functional fragment or homologue contains the T→ S substitution at the T6'S position. In one embodiment, the polynucleotide comprises the nucleic acid sequence of SEQ DD NO: 18. In other embodiments, the polynucleotide comprises the nucleic acid sequence of SEQ DD NO:21, SEQ DD NO:22, SEQ ED NO:23, SEQ DD NO:24, or SEQ DD NO:25, which are each a degenerate variant of SEQ D NO:18. In other embodiments, the polynucleotides of the present invention comprise the nucleic acid coding sequences of the TM2 domains of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish, or mammalian or non-mammalian homologs of these polynucleotides, wherein the codon encoding the sixth amino acid residue of the TM2 domain has been altered to encode serine. Preferably, the altered TM2 domain comprises SEQ DD NO:2. In other embodiments, the polynucleotides of the present invention comprise the coding sequence of the nAChR α7 subunit of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish, or mammalian or non-mammalian homologs of these polynucleotides, wherein the codon encoding the sixth acid residue of the TM2 domain has been altered to encode serine. Preferably, the altered TM2 domain comprises SEQ ID NO:2. The present invention further includes an isolated polynucleotide that encodes a variant of the wild-type nAChR 7 subunit, such as the wild-type nAChR α7 subunit of rat, human, mouse, monkey, cow, chicken, and zebrafish (the coding sequences of SEQ DD NO:4, SEQ DD NO:6, SEQ ED NO:8, SEQ ID NO:10, SEQ DD NO:12, SEQ DD NO:14, and SEQ ID NO:16). In another aspect, the present invention includes an isolated polypeptide that is a variant of the wild-type TM2 domain of the α7 subunit, wherein the domain comprises the amino acid sequence of SEQ ID NO:2. In other embodiments, the polypeptides of the present invention comprise the amino acid sequences of the mature α7 subunit of human, mouse, rat, rhesus monkey, domestic cow, chicken, or zebrafish (i.e., comprising the amino acid sequences of SEQ DD NO: 5, SEQ DD NO:7, SEQ DD NO:9, SEQ DD NO: 11, SEQ DD NO: 13, SEQ ED NO: 15, or SEQ DD NO: 17, with or without signal peptides), or mammalian or non- mammalian homologs of these polypeptides that have a TM2 domain, wherein the sixth amino acid residue of the TM2 domain in the amino acid sequence has been altered to encode serine. Preferably, the altered TM2 domain comprises SEQ DD NO:2. hi a specific embodiment, the sixth amino acid is altered from a threonine to a serine (T→ S). A polynucleotide encoding the T6'S variant TM2 domain, the T6'S variant al subunit, or the T6'S variant nACh receptor can be derived from genomic or cDNA as a starting material, prepared by synthesis, or by a combination of techniques. The polynucleotide can then be used to express the T6'S variant TM2 domain, the T6'S variant al subunit, or the T6'S variant nACh receptor, or as a template for the preparation of RNA using methods well known in the art (see, Sambrook et al, Molecular Cloning: A Laboratory Manual, Second Edition, 1989). One method for obtaining the desired polynucleotide involves isolating cDNA encoding the wild-type o7 nAChR subunit as described by Doucette-Stamm et al. Drug Dev. Res., 1993, 30: 252-256. The wild-type cDNA thus obtained can then be modified by site-directed mutagenesis using, for example QUICKCHANGE kits (STRATAGENE, LaJolla, CA) and amplified using the polymerase chain reaction ("PCR") and primer sequences designed to obtain the DNA encoding the T6'S variant. PCR employs short oligonucleotide primers (generally 10-20 nucleotides in length) that match opposite ends of a desired sequence within the wild-type DNA molecule. The sequence between the primers need not be known. The initial template can be either RNA or DNA. If RNA is used, it is first reverse-transcribed to cDNA. The cDNA is then denatured, using well known techniques such as heat, and appropriate oligonucleotide primers are added in molar excess. The primer can be made specific by keeping primer length and base composition within relatively narrow limits, and by keeping the mutant base corresponding to T6'S centrally located (Zoler et al. (1983) Meth. Enzymol. 100:468). Primer extension is effected using DNA polymerase in the presence of deoxynucleotide triphosphates or nucleotide analogs. The resulting product includes the respective primers at their 5'- termini, covalently linked to the newly synthesized complements of the original strands. The replicated molecule is again denatured, hybridized with primers, and so on, until the product is sufficiently amplified. Such PCR methods are described in the art, e.g., U.S. Patent Nos. 4,965,188; 4,800,159; 4,683,202; 4,683,195; incoφorated herein by reference in their entireties. The product of the PCR is cloned and the clones containing the mutated DNA, derived by segregation of the primer extended strand, selected. Selection can be accomplished using the mutant primer as a hybridization probe. By way of example, two complimentary olignonucleotides can be synthesized which contain the desired mutation flanked by 10-15 bases of unmodified nucleotide sequence. Using a thermal cycler, Pfu DNA polymerase extends the sequence around the whole vector, generating a plasmid with staggered nicks. Each cycle builds only off the parent strands, and therefore there is no amplification of misincoφorations. After approximately 12-16 cycles, the product can then be treated with the restriction endonuclease Dpn I, which digests the methylated parent DNA into numerous small pieces. Optionally, the product can then be transformed into cells, such as E. coli, which repair the nicks. After linearization and purification of cloned cDNAs, RNA transcripts can be prepared in vitro using the appropriate mMessage mMachine kit from AMBION Inc. (Austin, TX). Alternatively, the wild-type DNA may be obtained from an appropriate DNA library. DNA libraries may be probed using the procedure described by Grunstein et al. (Proc. Natl. Acad. Sci. USA 73:3961, 1975). Synthetic oligonucleotides may be prepared using an automated oligonucleotide synthesizer such as that described by Warner (DNA 3:401, 1984). If desired, the synthetic strands may be labeled with 32P by treatment with polynucleotide kinase in the presence of 32P-ATP, using standard conditions for the reaction. DNA sequences, including those isolated from genomic or cDNA libraries, may be modified by known methods which include site-directed mutagenesis as described by Zoller (Nucleic Acids Res. 10:6487, 1982). Briefly, the DNA to be modified is packaged into phage as a single stranded sequence, and converted to a double stranded DNA with DNA polymerase using, as a primer, a synthetic oligonucleotide complementary to the portion of the DNA to be modified, and having the desired modification included in its own sequence. Culture of the transformed bacteria, which contain replications of each strand of the phage, are plated in agar to obtain plaques. Theoretically, 50% of the new plaques contain phage having the mutated sequence, and the remaining 50% have the original sequence. Replicates of the plaques are hybridized to labeled synthetic probe at temperatures and conditions suitable for hybridization with the conect strand, but not with the unmodified sequence. The sequences which have been identified by hybridization are recovered and cloned. Alternatively, it may be necessary to identify clones by sequence analysis if there is difficulty in distinguishing the variant from wild-type by hybridization. In any case, the DNA can be sequence-confirmed. Once produced, the DNA may then be incoφorated into a cloning vector or an expression vector for replication in a suitable host cell. Vector construction employs methods known in the art. Generally, site-specific DNA cleavage is performed by treating with suitable restriction enzymes under conditions which generally are specified by the manufacturer of the commercially available enzymes. After incubation with the restriction enzyme, protein is removed by extraction and the DNA recovered by precipitation. The cleaved fragments may be separated using, for example, polyacrylamide or agarose gel electrophoresis methods, according to methods known by those of skill in the art. Sticky end cleavage fragments may be blunt ended using E. coli DNA polymerase 1 (Klenow) in the presence of the appropriate deoxynucleotide triphosphates (dNTPs) present in the mixture. Treatment with SI nuclease also may be used, resulting in the hydrolysis of any single stranded DNA portions. Ligations are performed using standard buffer and temperature conditions using T4 DNA ligase and ATP. Alternatively, restriction enzyme digestion of unwanted fragments can be used to prevent ligation. Standard vector constructions can include specific antibiotic resistance elements.
Ligation mixtures are transfonned into a suitable host, and successful transformants selected by antibiotic resistance or other markers. Plasmids from the transformants can then be prepared according to methods known to those in the art usually following a chloramphenicol amplification as reported by Clewell et al. (J. Bacteriol 110:667, 1972) may be added. The DNA is isolated and analyzed, usually by restriction enzyme analysis and/or sequencing. Sequencing may be by the well-known dideoxy method of Sanger et al. (Proc. Natl. Acad. Sci. USA 74:5463, 1977) as further described by Messing et al. (Nucleic Acid Res. 2:309, 1981), or by the method reported by Maxam et al. (Meth. Enzymol. 65:499, 1980). Problems with band compression, which are sometimes observed in GC rich regions, can be overcome by use of, for example, T-deazoguanosine or inosine, according to the method reported by Ban et al. (Biotechniques 4:428, 1986). Host cells can be genetically modified with the vectors of the present invention, which may be a cloning vector or an expression vector. The vector may be in the form of a plasmid, a viral particle, a phage, etc. The genetically modified host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants/transfectants or amplifying the subunit-encoding polynucleotide. The culture conditions, such as temperature, pH and the like, generally are similar to those previously used with the host cell selected for expression, and will be apparent to those of skill in the art. Both prokaryotic and eukaryotic host cells may be used for expression of desired coding sequences when appropriate control sequences (e.g., promoter sequences) that are compatible with the designated host are used. For example, among prokaryotic hosts, Escherichia coli is frequently used. Also, for example, expression control sequences for prokaryotes include but are not limited to promoters, optionally containing operator portions, and ribosome binding sites. Transfer vectors compatible with prokaryotic hosts can be derived from, for example, the plasmid pBR322 that contains operons conferring ampicillin and tetracycline resistance, and the various pUC vectors, that also contain sequences conferring antibiotic resistance markers. These markers may be used to obtain successful transformants by selection. Commonly used prokaryotic control sequences include but are not limited to the lactose operon system (Chang et al. Nature 198:1056, 1977), the tryptophan operon system (reported by Goeddel et al. (Nucleic Acid Res. 8:4057, 1980) and the lambda-derived PI promoter and N gene ribosome binding site (Shimatake et al. Nature 292:128, 1981), the hybrid Tac promoter (De Boer et al. Proc. Natl. Acad. Sci. USA 292:128, 1983) derived from sequences of the tφ and lac UV5 promoters. The foregoing systems are particularly compatible with E. coli; however, other prokaryotic hosts such as strains of Bacillus or Pseudomonas may be used if desired. Eukaryotic hosts include yeast and mammalian cells in culture systems. Pichia pastoris, Saccharomyces cerevisiae and S. carlsbergensis are commonly used yeast hosts. Yeast-compatible vectors cany markers that permit selection of successful transformants by conferring protrophy to auxotrophic mutants or resistance to heavy metals on wild- type strains. Yeast compatible vectors may employ the 2-μ origin of replication (Broach et al. Meth. Enzymol. 101:307, 1983), the combination of CEN3 and ARSl or other means for assuring replication, such as sequences that will result in incoφoration of an appropriate fragment into the host cell genome. Control sequences for yeast vectors are known in the art and include but are not limited to promoters for the synthesis of glycolytic enzymes, including the promoter for 3-phosphoglycerate kinase. (See, for example, Hess et al. J. Adv. Enzyme Reg. 7:149, 1968; Holland et al. Biochemistry 17:4900, 1978; and Hitzeman J Biol. Chem. 255:2073, 1980). For example, some useful control systems are those that comprise the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) promoter or alcohol dehydrogenase (ADH) regulatable promoter, terminators also derived from GAPDH, and, if secretion is desired, leader sequences from yeast alpha factor. In addition, the transcriptional regulatory region and the transcriptional initiation region which are operably linked may be such that they are not naturally associated in the wild-type organism. Thus, the host cells of the present invention may be used in a method of the invention (e.g., methods for identifying agents (substances such as genetic material, protein, lipids, carbohydrates, small molecules, and other compositions) that modulate nAChR activity, methods for screening for agents useful in treating disorders, and methods for identifying cytotoxic or cytoprotective agents). Preferably, the polynucleotide of the invention is stably expressed in the host cell such that a functional receptor is formed, wherein the functional receptor elicits electrophysiological currents in vitro or in vivo when stimulated by a wild-type al agonist. Host cells useful for expression of the polynucleotides of the present invention maybe primary cells or cells of cell lines. The host cells may be tumor cells or non-tumor cells. Mammalian cell lines available as hosts for expression are known in the art and are available from depositories such as the American Type Culture Collection. These include but are not limited to HeLa cells, human embryonic kidney (HEK) cells, Chinese hamster ovary (CHO) cells, baby hamster kidney (BHK) cells, and others. Preferably, the host cell is one capable of expressing the wild-type 0/7 receptor. For example, the host cell may be the GH4C1 (rat anterior pituitary tumor; GH4Cι) cell line or SHEP1 (human epithelial; SH-EP1) cell line, or variants of these cell lines, that may be genetically modified to express the polynucleotides of the present invention (Tashjian A.H., Jr., Endocrinology, 1968, 82:342-352; Tashjian, A.H., Jr., Methods Enzymol, 58:527-535; Bancroft, F.C., in Functionally Differentiated Cell Lines (Sato, G., ed.), pp. 47-59, Alan R. Liss, Inc., New York; Westendorf, J.M., J. Biol. Chem., 1983, 258(12):7527-7535; Peng J-H. et al, Soc. Neurosci. Abstr., 1999, 25:1723; Eaton J.B. et al, Soc. Neurosci., Abstr., 2000, 26:371; Lukas R.J. et al, Some methods for studies of nicotinic acetylcholine receptor pharmacology, in Nicotinic Receptors and the Neι~vous System (Levin ED ed.) pp. 3-27, CRC Press, Boca Raton; Gentry CL. et al, JPET, 2003, 304:206-216, Peng J.H. et al, J. Pharmacol. Exp. Ther., "High affinity epibatidine biding of functional, human {alpha} 7- nicotinic acetylcholine receptors stably and heterologously expressed de novo in human SH-EP1 cells, 2004 Dec. 8, Epub ahead of print; Pacheco M.A. et al, Neurochem. Res., 2001, 26(6):683-693; Grinevich N.P. et al, J. Pharmacol. Exp.Ther., 2004, Feb; 312(2):619-626, Epub 2004, Sept. 08; Ramsdell J.S. et al, Mol. Cell. Endocrinol, 1985, 43(2-3):173-180; Zao L. et al, JPET, 2003, 305:1132-1141; Swileh W. et al, Brain Res. Mol. Brain Res., 2000, 75(2):293-302; Eaton J.B. et al, JPET, 2003, 64:1283-1294, each of which are incoφorated herein in their entirety). Suitable promoters for mammalian cells also are known in the art and include viral promoters such as that from Simian Nirus 40 (SN40), Rous sarcoma virus (RSN), adenovirus (ADN), bovine papilloma virus (BPV) and cytomegalovirus (CMN). Mammalian cells also may require terminator sequences and poly A addition sequences; enhancer sequences which increase expression also may be included, and sequences which cause amplification of the gene also may be desirable. These sequences are known in the art. Nectors suitable for replication in mammalian cells may include viral replicons, or sequences which ensure integration of the appropriate sequences encoding the T6'S variant TM2 domain, the T6'S variant ofJ subunit, and/or the T6'S variant nACh receptor into the host genome. An example of such a mammalian expression system is described in Gopalakrishnan et al. Eur. J. Pharmacol. -Mol. Pharmacol. 290: 237-246, 1995). Other eukaryotic systems available as hosts for expression are also known, as are methods for introducing polynucleotides into such systems, such as amphibian cells using methods described in Briggs et al. (Neuropharmacol 34:583-590, 1995), insect cells using methods described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987), and the like. The baculovirus expression system can be used to generate high levels of recombinant proteins in insect host cells. The baculovirus expression system allows for high level of protein expression, while post-translationally processing the protein in a manner similar to mammalian cells. These expression systems use viral promoters that are activated following baculovirus infection to drive expression of cloned genes in the insect cells (O'Reilly et al. (1992) Baculovirus Expression Nectors: A Laboratory Manual, IRL/Oxford University Press). Transfection may be by any known method for introducing polynucleotides into a host cell, including packaging the polynucleotide in a virus and transducing a host cell with the virus, by direct uptake of the polynucleotide by the host cell, and the like, which methods are known to those skilled in the art. The transfection procedures selected depend upon the host to be transfected. The expression of the polynucleotide encoding the T6'S variant TM2 domain, the T6'S variant al subunit, and/or the T6'S variant nACh receptor may be detected by use of a radioligand selective for the receptor. For example, for the nicotinic cholinergic receptor, such a ligand may be [125I]c.-bungarotoxin. However, any radioligand binding technique known in the art may be used to detect the receptor subunit (see, e.g., Winzor et al. (1995) Quantitative Characterization of Ligand Binding, Wiley-Liss, Inc., Ν.Y.). Alternatively, expression can be detected by utilizing antibodies or functional measurements which are well known to those skilled in the art. The T6'S variant TM2 domain polypeptide, the T6'S variant al subunit polypeptide, or the T6'S variant nACh receptor polypeptide can be recovered and purified from genetically modified host cell cultures expressing the same by known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxyapatite chromatography or lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the protein. Finally, high performance liquid chromatography (HPLC) can be employed for final purification steps. The T6'S variant TM2 domain polypeptide, the T6'S variant al subunit polypeptide, or the T6'S variant nACh receptor polypeptide, or functional fragments or homologues thereof, of the present invention, also may be synthesized by conventional techniques known in the art, for example, by chemical synthesis such as solid phase peptide synthesis. In general, these methods employ either solid or solution phase synthesis methods (See, e.g., J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Co., Rockford, 111. (1984) and G. Barany and R. B. Merrifield, The Peptides: Analysis, Synthesis, Biology, editors E. Gross and J. Meienhofer, Vol. 2, Academic Press, New York, (1980), pp. 3-254, for solid phase peptide synthesis techniques; and M. Bodansky, Principles of Peptide Synthesis, Springer-Verlag, Berlin (1984) and E. Gross and J. Meienhofer, Eds., The Peptides: Analysis, Synthesis, Biology, supra, Vol. 1, for classical solution synthesis). In one preferred system, either the DNA or the RNA derived therefrom, both of which encode the desired T6'S variant TM2 domain polypeptide, T6'S variant al subunit polypeptide, and/or T6'S variant nACh receptor polypeptide, may be expressed by direct injection into a cell, such as a Xenopus laevis oocyte. Using this method, the functionality of the polypeptide encoded by the DNA or the mRNA can be evaluated as follows (see Dascal CRC Crit. Rev. Biochem. 22:317-387, 1987). A T6'S variant- encoding polynucleotide is injected into an oocyte for translation into a functional receptor subunit. The function of the expressed T6'S variant TM2 domain polypeptide, T6'S variant o>7 subunit polypeptide, and/or T6'S variant nAChR polypeptide can be assessed in the oocyte by a variety of electrophysiological techniques including intracellular voltage recording, two-electrode voltage clamp, patch clamp methods, and the like. The cation-conducting channel intrinsic to the nAChR opens in response to ACh or other nicotinic cholinergic agonists, permitting the flow of transmembrane current. This cunent can be monitored directly by voltage clamp techniques or indirectly by intracellular voltage recording, wherein changes in membrane potential due to the induced cunent are measured. Alternatives can include measurement of ion flux or fluorescent probes sensitive to transmembrane potential or changes in ion activity. Receptors expressed in a genetically modified host cell may be used to identify compounds that modulate nAChR activity, hi this regard, the specificity of the binding of a compound showing affinity for the receptor is demonstrated by measuring the affinity of the compound for cells expressing the receptor or membranes from these cells. This may be done by measuring specific binding of labeled (e.g., radioactive) compound to the cells, cell membranes or isolated receptor, or by measuring the ability of the compound to displace the specific binding of a standard labeled ligand. Expression of variant receptors and screening for compounds that bind to, or inhibit the binding of labeled ligand to these cells or membranes provides a method for rapid selection of compounds with high affinity for the receptor. These compounds may be agonists, antagonists or modulators of the receptor. Expressed receptors also may be used to screen for agents, such as chemical compounds, that modulate nicotinic acetylcholine receptor activity. One method for identifying agents that modulate nAChR activity comprises providing a cell that expresses a polynucleotide encoding a T6'S variant (e.g., T6'S variant TM2 domain polypeptide, a T6'S variant al subunit polypeptide, and/or a T6'S variant nACh receptor polypeptide of the present invention), contacting a test agent with the cell and measuring the effect of the test compound on the variant receptor activity. The cell may be a bacterial cell, a mammalian cell, a yeast cell, an amphibian cell or any other cell expressing the receptor. Preferably, the cell is a mammalian cell or an amphibian cell. Thus, for example, a test agent is evaluated for its ability to elicit an appropriate response, e.g., the stimulation of transmembrane cunent flow, for its ability to inhibit the response to a cholinergic agonist, or for its ability to modulate the response to an agonist or antagonist. The contacting step in the methods of the invention can involve combining or mixing the test agent and the cell, for example. In one embodiment, the present invention provides a method for identifying agents that modulate nicotinic acetylcholine receptor (nAChR) activity, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting a test agent with the host cell; and (c) determining :(i) the effect of the test agent on the variant al nAChR polypeptide or the host cell expressing the polynucleotide, or (ii) the binding of the test agent to the host cell or the variant al nAChR polypeptide, or (iii) both (c) (i) and (c) (ii). In addition, expressed receptors may be used to screen agents, such as chemical compounds, that exhibit either a cytoprotective or cytotoxic effect. Abnormal activation of membrane channels is a potential cause of neurological disorders, such as neurodegenerative diseases (See, for example, Salamone, F. et al, MJM, 2000, 5:90-97; Cooper, E.C. and Jan, L.Y. Proc. Natl. Acad. Sci. USA, 1999, 96:4759-4766; Shaφles, C. and Wonnacott, S. Neuronal Nicotinic Receptors, October 2001, 19:1-12; Mihailescu, S. and Drucker-Colin, R. Arch. Med. Res., 2000, 31:131-144; Papke, R.L. et al, Euro. J. Pharm., 2000, 393:179-195; Newhouse, P.A. and Kelton, M. Pharm. Acta Helv., 2000, 74:91-101; Newhouse, P.A. et al, Clin. Pharm., 1997, 11:206-228; Lloyd, G.K. and Williams, M. J Pharm. Exp. Therapies, 2000, 292:461-467; Hollady, M.W. et al, J. Med. Chem., 1997, 40:4169-4194; Benowitz, N.L. Annu. Rev. Pharm. Toxicol, 1996, 36:597-613; Freedman, R. et al, Harvard Rev. Psych., 1994, 2:179-192; and Freedman, R. et al, J. Chem. Neuroanatomy, 2000, 20:299-306). Examples of such neurological disorders include, but are not limited to, presenile dementia (early onset Alzheimer's disease); senile dementia (dementia of the Alzheimer's type); movement disorders such as Parkinsonism including Parkinson's disease, Huntington's chorea, tardive dyskinesia, hyperkinesias, tremor, epilepsy, Tourette syndrome or other tic disorders; mania; attention deficit disorder; attention deficit hyperactivity disorder; sleep-wake disorder; chronic-fatigue syndrome; neuropathic pain; addiction (e.g., nicotine/smoking addiction); anxiety; dyslexia; schizophrenia; and obsessive-compulsive disorder. The T6'S variant of the present invention can be used to screen for agents useful in treating disorders caused by alterations in sensory gating, immunofunction and neuropathic pain (e.g., pain associated with cancerous conditions, post heφatic neuralgia, diabetic neuropathy and osteoarthritis), as well as the foregoing list of neurological disorders. Accordingly, nicotinic drugs are considered potential therapeutic agents in several neurological disorders, including the foregoing list of neurological disorders. Compounds that activate nAChRs, especially of the al subtype, have been found to have in vivo activity in models of cognition enhancement (U.S. Patent No. 5,741,802, issued April 21, 1998). Activation of the wild-type al nAChR appears to elicit cytoprotective properties (e.g., reduced cell lysis, see Donnelly-Roberts et al. Brain Res., 1996, 719:36-44). Although it is not yet conclusively established whether a full agonist or partial agonist is preferable, nor, if the latter, what type of partial agonist is best (e.g., one that stabilizes the open and desensitized states or one that stabilizes the open and resting states of the receptor), the T6'S variant of the present invention can be used to evaluate these questions, and to select among ligands for specific types of partial agonists or specific types of antagonists. Thus, al nAChR ligand pharmacology can be studied through the use of the T6'S variant of the present invention (e.g., T6'S variant TM2 domain, T6'S variant al subunit, and/or T6'S variant nAChR). The ability of a ligand to stabilize the desensitized state of the receptor can be evaluated by comparing the ligand 's potency and efficacy at the T6'S variant nAChR to its potency and efficacy at the wild-type al nAChR, for example. Alternatively, the ligand's interaction with the T6'S variant nAChR can be compared to other variants of the wild-type al nAChR. The interaction of agents with variants and the wild-type nAChR can be identified using several methods, including, but not limited to, electrophysiologic measurement of transmembrane cunent flow or electrical potential, measurement of the fluorescence of potential-sensitive or ion-sensitive dyes, or measurement of radioactive ion flux and a variety of al nAChR expression systems, for example, transfected mammalian cells in culture or injected amphibian cells. In prefened embodiments, the responses are measured with a high throughput electrophysiology system and/or rapid fluorescence assays such as the FlipR (fluorometric imaging plate reader) system. In addition to screening test agents, the expressed T6'S variant (e.g., T6'S variant TM2 domain, T6'S variant o7 subunit, and/or T6'S variant nACh receptor) may be used to investigate mechanisms of cytotoxicity and cytoprotection. The evidence that activation of o7 nAChR is cytoprotective comes from the finding that nAChR agonists elicit cytoprotection in cells expressing the wild-type a7 nAChR subunit and that this cytoprotection is inhibited by selective o7 antagonists (for example, see Donnelly-Roberts et al. Brain Res., 719:36-44, 1996). Cytoprotective or cytotoxic agents that interact with the T6'S variant (e.g., T6'S variant TM2 domain, T6'S variant o7 subunit, and/or T6'S variant nACh receptor) of the present invention may be identified using several methods. One such method comprises providing a cell that expresses the T6'S variant TM2 domain, T6'S variant a7 subunit, and/or T6'S variant nACh receptor of the present invention, combining a test agent with the cell, and monitoring the cell for an indicator of cytotoxicity. If it is necessary to control spontaneous action of the variant nAChR subunit, it may be stably expressed in a recombinant mammalian cell line under the control of an inducible promoter, e.g., the LacSwitch system which is inducible by isopropylthiogalactoside ("IPTG"). Expression of the T6'S variant TM2 domain, T6'S variant o7 subunit, and/or T6'S variant nACh receptor would be maintained at a low level until induction by the addition of EPTG. Alternatively, with or without an inducible promoter, the transfected cells could be cultured in the presence of an al blocker, such as methyllycaconitine ("MLA") or mecamylamine, that would prevent or reduce cytotoxic action. Both blockers are reversible, permitting one to measure the effect of the test agent on al nAChR function after the blocker is removed (e.g., washed out). Cytoprotective agents can be identified by their ability to reduce cell death while cytotoxic agents can be identified by their ability to promote cell death. That these effects are mediated by the al subunit, T6'S variant or wild-type, can be identified by the ability of an al blocker to prevent the effect. Cell death, or cytotoxicity, can be monitored by a variety of techniques including but not limited to measurement of cell number or density in the culture, of cell growth rate (e.g., incoφoration of labeled nucleotide or amino acid), or of cell integrity for example by uptake of a dye (e.g., trypan blue is excluded by healthy cells, or by inclusion of MTT by healthy cells), or by the release of a cytoplasmic constituent such as lactate dehydrogenase (LDH). Cytoprotective agents may also be screened for their ability to antagonize a variant nAChR to a greater extent than a wild- type nAChR, or for their ability to augment the decay rate of variant nAChR compared to the wild-type nAChR. In one embodiment, the subject invention provides a method for identifying a cytoprotective agent, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain (such as a T6'S variant al subunit comprising SEQ ID NO:2); contacting a test agent (such as a putative wild-type al receptor agonist) with the host cell; and (c) monitoring the host cell or cellular function for an indication of cytotoxicity. a specific embodiment, whether the test agent overstimulates the variant al nAChR polypeptide is determined. Because the variant al nAChR polypeptide exhibits amplified pharmacologic responses compared to the wild-type al receptor, determination of overstimulation of the variant al nAChR polypeptide can indicate or connote that the test agent is sufficient to activate the wild-type c-7 receptor at a cytoprotective level. In this way, a potential therapeutic agent may elicit a cytotoxic response in the variant o7 nAChR polypeptide of the present invention but elicit a cytoprotective response in the wild-type al receptor. It has been determined that native and degenerate peptides derived from the al nicotinic receptor (such as the human al receptor) are useful as ligands for β amyloid peptides. The neurotoxic β amyloidι-42 (A/3ι-42) is abundantly present in the amyloid plaques of Alzheimer's disease (AD) brains and also modulates cholinergic functions which are critical in memory and cognitive neurophysiology (Auld D. et al, Trends Neurosci 21:43-49, 1998). A/3ι_42 interacts selectively with high affinity to the neuronal al nicotinic receptor. U.S. Patent No. 6,441,049 (Reitz et al; issued August 27, 2002) describes methods of treating a neurodegenerative disorder in a subject by administering a compound that inhibits the interaction of Aβ with the al receptor. U.S. Patent publication U.S. 2003/0092613 (Lee et al; filed August 13, 2001) describes methods for diagnosing Alzheimer's disease involving the binding of al that allows the measurement of Aβ peptides in biological samples, methods for designing a drug discovery assay for identifying al nAChR modulators based on the interaction of al with Aβ (the disclosure of which is expressly incoφorated herein by reference in its entirety). The subject invention encompasses these methods, wherein polypeptides comprising the T6'S domain of the present invention, and which interact with Aβ, are substituted for the al and variant peptides described in U.S. Patent publication U.S. 2003/0092613. The present invention also includes isolated polynucleotides (e.g., detection probes or primers) capable of selectively hybridizing to a nucleic acid sequence encoding a T6'S variant TM2 domain, T6'S variant al subunit, and/or T6'S variant nACh receptor. For example, the isolated polynucleotide can be capable of selectively hybridizing to a nucleic acid sequence comprising SEQ ID NO:18, SEQ DD NO:21, SEQ ID NO:22, SEQ ED NO:23, SEQ ED NO:24, SEQ DD NO:25, SEQ HD NO:26, SEQ DD NO:27, SEQ ID NO:28, SEQ ED NO:29, SEQ ID NO:30, or a functional fragment or homologue of any of the foregoing. Such a detection probe will comprise a contiguous/consecutive span of at least 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 nucleotides. Labeled probes or primers are labeled with a radioactive compound or with another type of label as set forth above (e.g., 1) radioactive labels, 2) enzyme labels, 3) chemiluminescent labels, 4) fluorescent labels, or 5) magnetic labels). Alternatively, non-labeled nucleotide sequences may be used directly as probes or primers; however, the sequences are generally labeled with a radioactive element (32P, 35S, 3H, 125I) or with a molecule such as biotin, acetylaminofluorene, digoxigenin, 5-bromo-deoxyuridine, or fluorescein to provide probes that can be used in numerous applications. Preferably, the isolated polynucleotide specifically hybridizes with at least 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 nucleotides of the nucleotide sequence encoding the T6'S variant al subunit. More preferably, the isolated polynucleotide specifically hybridizes with at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, or 60 nucleotides of the T6'S variant TM2 domain (e.g., of SEQ DD NOs: 18, 21, 22, 23, 24, 25,
26, 27, 28, 29, or 30). Optionally, the isolated polynucleotide can specifically hybridize with nucleotides within that portion of the target sequence which encodes the T6'S variant TM2 domain and outside that which encodes the TM2 domain. Optionally, hybridization outside the T6'S variant TM2 domain can include hybridization to non- coding nucleotides. Such polynucleotides can be produced by recombinant or synthetic techniques. Various degrees of stringency of hybridization can be employed. The more severe the conditions, the greater the complementarity that is required for duplex formation. Severity of conditions can be controlled by temperature, probe concentration, probe length, ionic strength, time, and the like. Preferably, hybridization is conducted under low, intermediate, or high stringency conditions by techniques well known in the art, as described, for example, in Keller, G.H., M.M. Manak, 1987, DNA Probes, Stockton Press, New York, NY., pp. 169-170. For example, hybridization of immobilized DNA on Southern blots with P- labeled gene-specific probes can be performed by standard methods (Maniatis et al. [1982] Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). In general, hybridization and subsequent washes can be canied out under intermediate to high stringency conditions that allow for detection of target sequences with homology to the exemplified polynucleotide sequence. For double-stranded DNA gene probes, hybridization can be carried out overnight at 20-25° C below the melting temperature (Tm) of the DNA hybrid in 6X SSPE, 5X Denhardt's solution, 0.1% SDS, 0.1 mg/ml denatured DNA. The melting temperature is described by the following formula (Beltz et al. [1983] Methods of Enzymology, R. Wu, L. Grossman and K. Moldave [eds.] Academic Press, New York 100:266-285). Tm=81.5°C+16.6 Log[Na+]+0.41 (%G+C)- 0.61 (%formamide)-600/length of duplex in base pairs. Washes are typically carried out as follows: (1) twice at room temperature for 15 minutes in IX SSPE, 0.1% SDS (low stringency wash); (2) once at Tm - 20°C for 15 minutes in 0.2X SSPE, 0.1% SDS (intermediate stringency wash). For oligonucleotide probes, hybridization can be carried out overnight at 10-20°C below the melting temperature (Tm) of the hybrid in 6X SSPE, 5X Denhardt's solution, 0.1% SDS, 0.1 mg/ml denatured DNA. Tm for oligonucleotide probes can be determined by the following formula: Tm(°C)=2(number T/A base ρairs)+4(number G/C base pairs) (Suggs et al. [1981] ICN-UCLA Symp. Dev. Biol. Using Purified Genes, D.D. Brown [ed.], Academic Press, New York, 23:683-693). Washes can be carried out as follows: (1) twice at room temperature for 15 minutes IX SSPE, 0.1% SDS (low stringency wash); 2) once at the hybridization temperature for 15 minutes in IX SSPE, 0.1% SDS (intermediate stringency wash). In general, salt and/or temperature can be altered to change stringency. With a labeled DNA fragment >70 or so bases in length, the following conditions can be used: Low: 1 or 2X SSPE, room temperature Low: l or 2X SSPE, 42°C Intermediate: 0.2X or IX SSPE, 65°C High: 0.1X SSPE, 65°C. By way of another non-limiting example, procedures using conditions of high stringency can also be performed as follows: Pre-hybridization of filters containing DNA is carried out for 8 h to overnight at 65°C in buffer composed of 6X SSC, 50 mM
Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 μg/ml denatured salmon sperm DNA. Filters are hybridized for 48 h at 65°C, the prefened hybridization temperature, in pre-hybridization mixture containing 100 μg/ml denatured salmon sperm DNA and 5-20 x 106 cpm of 32P-labeled probe. Alternatively, the hybridization step can be performed at 65°C in the presence of SSC buffer, IX SSC conesponding to 0.15M NaCl and 0.05 M Na citrate. Subsequently, filter washes can be done at 37°C for 1 h in a solution containing 2X SSC, 0.01% PVP, 0.01% Ficoll, and 0.01% BSA, followed by a wash in 0.1X SSC at 50°C for 45 min. Alternatively, filter washes can be performed in a solution containing 2X SSC and 0.1% SDS, or 0.5X SSC and 0.1% SDS, or 0.1X SSC and 0.1% SDS at 68°C for 15 minute intervals. Following the wash steps, the hybridized probes are detectable by autoradiography. Other conditions of high stringency which may be used are well known in the art and as cited in Sambrook et al, 1989, Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Press, N.Y., pp. 9.47-9.57; and Ausubel et al, 1989, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y. are incoφorated herein in their entirety. Another non-limiting example of procedures using conditions of intermediate stringency are as follows: Filters containing DNA are pre-hybridized, and then hybridized at a temperature of 60°C in the presence of a 5X SSC buffer and labeled probe. Subsequently, filters washes are performed in a solution containing 2X SSC at 50°C and the hybridized probes are detectable by autoradiography. Other conditions of intermediate stringency which may be used are well known in the art and as cited in Sambrook et al, 1989, Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Press, N.Y., pp. 9.47-9.57; and Ausubel et al, 1989, Cunent Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y. are incoφorated herein in their entirety. Duplex formation and stability depend on substantial complementarity between the two strands of a hybrid and, as noted above, a certain degree of mismatch can be tolerated. Therefore, the probe sequences of the subject invention include mutations (both single and multiple), deletions, insertions of the described sequences, and combinations thereof, wherein said mutations, insertions and deletions permit formation of stable hybrids with the target polynucleotide of interest. Mutations, insertions and deletions can be produced in a given polynucleotide sequence in many ways, and these methods are known to an ordinarily skilled artisan. Other methods may become known in the future. A "complementary" polynucleotide sequence, as used herein, generally refers to a sequence arising from the hydrogen bonding between a particular purine and a particular pyrimidine in double-stranded nucleic acid molecules (DNA-DNA, DNA-RNA, or RNA- RNA). The major specific pairings are guanine with cytosine and adenine with thymine or uracil. A "complementary" polynucleotide sequence may also be refened to as an "antisense" polynucleotide sequence or an "antisense sequence". The present invention also includes pharmaceutical compositions useful for treating conditions associated with neurodegenerative processes, enzymatic function, affective disorders or immuno function, comprising a pharmaceutically acceptable carrier and an agent that regulates the function of a T6'S variant TM2 domain comprising the amino acid sequence of SEQ DD NO:2, the function of the T6'S variant al subunit comprising the amino acid sequence of SEQ ID NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ DD NO:20, and/or the function of the T6'S variant nACh receptor comprising the amino acid sequence of SEQ DD NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ DD NO:20; or a functional fragment or homologue of any of the foregoing. Such homologues include, for example, the mature peptides of SEQ ID NOs. 7, 9, 11, 13, 15, and 17, wherein the threonine in the sixth amino acid position of the TM2 domain has been substituted with a serine residue. The present invention also includes pharmaceutical compositions useful for treating conditions associated with neurodegenerative processes, enzymatic function, affective disorders or immuno function, comprising a pharmaceutically acceptable carrier and a polynucleotide encoding the T6'S variant TM2 domain comprising the amino acid sequence of SEQ ED NO:2, the T6'S variant al subunit comprising the amino acid sequence of SEQ DD NO:2, or SEQ DD NO:20, or amino acids 23 to 502 of SEQ ID NO:20, and/or the T6'S variant nACh receptor comprising the amino acid sequence of SEQ ID NO:2, or SEQ HD NO:20, or amino acids 23 to 502 of SEQ ID NO:20; or a functional fragment or homologue of any of the foregoing. The polynucleotide is preferably a component of a host cell or an expression vector, which further comprises a control sequence that directs expression of the polynucleotide, whereby the polynucleotide is expressed within the cell upon transplantation in vivo, i other embodiments, the polynucleotide T6'S variant TM2 domain can encode homologs of SEQ ID NO:20. Such homologues include, for example, the mature peptides of SEQ ID NOs. 7, 9, 11, 13, 15, and 17, wherein the threonine in the sixth amino acid position of the TM2 domain has been substituted with a serine residue. The present invention further includes methods for treating one or more of the aforementioned conditions by administering an agent that regulates the function of a T6'S variant of the present invention, or by administering a T6'S variant polypeptide of the present invention, or by administering a polynucleotide encoding a T6'S variant polypeptide of the present invention, to a patient in need thereof. Preferably, the agent, T6'S polypeptide, or T6'S polynucleotide administered is a pharmaceutical composition of the subject invention. The pharmaceutical compositions of the present invention can be administered to a patient by any route that results in the desired therapeutic effect. For example, the pharmaceutical compositions can be administered intravenously (I.N.), intramuscularly (I.M.), subcutaneously (S.C.), intradermally (I.D.), orally, intranasally, etc. Thus, the present invention includes methods of gene therapy whereby polynucleotides encoding the T6'S variant of the present invention is delivered to a patient, and the T6'S variant-encoding polynucleotide is expressed in vivo. The term "gene therapy", as used herein, refers to the transfer of genetic material (e.g., DΝA or RΝA) of interest into a host to treat or prevent a genetic or acquired disease or condition phenotype. The genetic material of interest encodes a product (e.g., a protein, polypeptide, peptide, or functional RΝA) whose production in vivo is desired. For example, the genetic material of interest can encode a hormone, receptor, enzyme, polypeptide or peptide of therapeutic value. For a review see, in general, the text "Gene Therapy" (Advances in Pharmacology 40, Academic Press, 1997). Two basic approaches to gene therapy have evolved: (1) ex vivo and (2) in vivo gene therapy. The methods of the subject invention encompass either or both. In e vtvo gene therapy, cells are removed from a patient and, while being cultured, are treated in vitro. Generally, a functional replacement gene is introduced into the cell via an appropriate gene delivery vehicle/method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the host/patient. These genetically reimplanted cells have been shown to produce the transfected gene product in situ. In in vivo gene therapy, target cells are not removed from the subject, rather the gene to be transfened is introduced into the cells of the recipient organism in situ, that is within the recipient. Alternatively, if the host gene is defective, the gene is repaired in situ. These genetically altered cells have been shown to produce the transfected gene product in situ. The gene expression vector is capable of delivery/transfer of heterologous nucleic acid sequences into a host cell. The expression vector may include elements to control targeting, expression and transcription of the nucleic acid sequence in a cell selective manner as is known in the art. It should be noted that often the 5'UTR and/or 3'UTR of the gene may be replaced by the 5 'UTR and/or 3 'UTR of the expression vehicle. The expression vector can include a promoter for controlling transcription of the heterologous material and can be either a constitutive or inducible promoter to allow selective transcription. The expression vector can also include a selection gene. Nectors can be introduced into cells or tissues by any one of a variety of known methods within the art. Such methods can be found generally described in Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (1989, 1992), in Ausubel et al, Cunent Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et al, Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al, Gene Targeting, CRC Press, Ann Arbor, Mich. (1995), Nectors: A Survey of Molecular Cloning Nectors and Their Uses, Butterworths, Boston Mass. (1988) and include, for example, stable or transient transfection, lipofection, electroporation, and infection with recombinant viral vectors. introduction of nucleic acids by infection offers several advantages over the other listed methods. Higher efficiency can be obtained due to their infectious nature. Moreover, viruses are very specialized and typically infect and propagate in specific cell types. Thus, their natural specificity can be used to target the vectors to specific cell types in vivo or within a tissue or mixed culture of cells. Viral vectors can also be modified with specific receptors or ligands to alter target specificity through receptor mediated events. A specific example of a DΝA viral vector for introducing and expressing recombinant sequences is the adenovirus derived vector Adenop53TK. This vector expresses a heφes virus thymidine kinase (TK) gene for either positive or negative selection and an expression cassette for desired recombinant sequences. This vector can be used to infect cells that have an adenovirus receptor which includes most cancers of epithelial origin as well as others. This vector as well as others that exhibit similar desired functions can be used to treat a mixed population of cells and can include, for example, an in vitro or ex vivo culture of cells, a tissue or a human subject. Additional features can be added to the vector to ensure its safety and/or enhance its therapeutic efficacy. Such features include, for example, markers that can be used to negatively select against cells infected with the recombinant virus. An example of such a negative selection marker is the TK gene described above that confers sensitivity to the antibiotic gancyclovir. Negative selection is therefore a means by which infection can be controlled because it provides inducible suicide through the addition of antibiotic. Such protection ensures that if, for example, mutations arise that produce altered forms of the viral vector or recombinant sequence, cellular transformation will not occur. Features that limit expression to particular cell types can also be included. Such features include, for example, promoter and regulatory elements that are specific for the desired cell type. In addition, recombinant viral vectors are useful for in vivo expression of a desired nucleic acid because they offer advantages such as lateral infection and targeting specificity. Lateral infection is inherent in the life cycle of, for example, retrovirus and is the process by which a single infected cell produces many progeny virions that bud off and infect neighboring cells. The result is that a large area becomes rapidly infected, most of which was not initially infected by the original viral particles. This is in contrast to vertical-type of infection in which the infectious agent spreads only through daughter progeny. Viral vectors can also be produced that are unable to spread laterally. This characteristic can be useful if the desired puφose is to introduce a specified gene into only a localized number of targeted cells. The pharmaceutical compositions of the subject invention can be formulated according to known methods for preparing pharmaceutically useful compositions. Formulations are described in a number of sources which are well known and readily available to those skilled in the art. For example, Remington 's Pharmaceutical Sciences (Martin EW [1995] Easton Pennsylvania, Mack Publishing Company, 19th ed.) describes formulations which can be used in connection with the subject invention. Formulations suitable for parenteral administration include, for example, aqueous sterile injection solutions, which may contain antioxidants, buffers, bacteriostats, and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze dried (lyophilized) condition requiring only the condition of the sterile liquid carrier, for example, water for injections, prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powder, granules, tablets, etc. It should be understood that in addition to the ingredients particularly mentioned above, the formulations of the subject invention can include other agents conventional in the art having regard to the type of formulation in question. The present invention also includes antibodies (e.g., monoclonal or polyclonal) and antibody fragments that specifically bind to a T6'S variant al TM2 domain comprising the amino acid sequence of SEQ DD NO: 2. Antibodies that are immunospecific for the polypeptides as set forth herein are specifically contemplated, ha various embodiments, antibodies that do not cross-react with other proteins (such as A. marginale MSP5) are also specifically contemplated. Preferably, the antibody or antibody fragment does not specifically bind to the wild-type al TM2 domain. The antibodies of the subject invention can be prepared using standard materials and methods known in the art (see, for example, Monoclonal Antibodies: Principles and Practice, 1983; Monoclonal Hybridoma Antibodies: Techniques and Applications, 1982; Selected Methods in Cellular Immunology, 1980; Immunological Methods, Vol. II, 1981; Practical Immunology, and Kohler et al. [1975] Nature 256:495). These antibodies can further comprise one or more additional components, such as a solid support, a carrier or pharmaceutically acceptable excipient, or a label. The term "antibody" is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity, particularly neutralizing activity. "Antibody fragments" comprise a portion of a full-length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab') , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multi-specific antibodies formed from antibody fragments. The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. [1975] Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The "monoclonal antibodies" may also be isolated from phage antibody libraries using the techniques described in Clackson et al. [1991] Nature 352: 624-628 and Marks et al. [1991] J. Mol. Biol. 222: 581-597, for example. The monoclonal antibodies described herein specifically include "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to conesponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to conesponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al. [1984] Proc. Natl. Acad Sci. USA 81: 6851-6855). Also included are humanized antibodies, such as those taught in U.S. Patent Nos. 6,407,213 or 6,417,337 which are hereby incoφorated by reference in their entirety. "Single-chain Fv" or "sFv" antibody fragments comprise the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv see Pluckthun in The Pharmacology of Monoclonal Antibodies [1994] Vol. 113:269-315, Rosenburg and Moore eds. Springer-Verlag, New York. An "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In prefened embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-tenninal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step. The terms "patient", "subject", and "individual" are used interchangeably herein to refer to human or non-human mammals. For example, the patient may be a human or non-human primate, rodent (such as rat or mouse), or other mammalian species. The terms "comprising", "consisting of and "consisting essentially of are defined according to their standard meaning. The terms may be substituted for one another throughout the instant application in order to attach the specific meaning associated with each term. The phrases "isolated" or "biologically pure" refer to material that is substantially or essentially free from components which normally accompany the material as it is found in its native state. Thus, isolated peptides in accordance with the invention preferably do not contain materials normally associated with the peptides in their in situ environment. "Link" or "join" refers to any method known in the art for functionally connecting peptides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, and electrostatic bonding. As used in this specification and the appended claims, the singular forms "a", "an", and "the" include plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to "a receptor subunit" includes more than one such subunit, and the like. The practice of the present invention can employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA technology, electrophysiology, and pharmacology, that are within the skill of the art.
Such techniques are explained fully in the literature (see, e.g., Sambrook, Fritsch &
Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989); DNA
Cloning, Vols. I and II (D. N. Glover ed. 1985); Perbal, B., A Practical Guide to
Molecular Cloning (1984); the series, Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, hie); Transcription and Translation (Hames et al. eds.
1984); Gene Transfer Vectors For Mammalian Cells (J. H. Miller et al. eds. (1987) Cold
Spring Harbor Laboratory, Cold Spring Harbor, N.Y.); Scopes, Protein Purification:
Principles and Practice (2nd ed., Springer-Verlag); and PCR: A Practical Approach
(McPherson et al. eds. (1991) IRL Press)).
Materials and Methods cDNA clones. These experiments used the rat neuronal nAChR and the mouse muscle cDNA clones, which were obtained from Dr. Jim Boulter (UCLA). Site-directed mutagenesis. Site-directed mutagenesis was performed using QuickChange (TM) kits (Strategene, LaJoUa, CA). In brief, two complimentary oligonucleotides were synthesized which contained the desired mutation flanked by 10-15 bases of unmodified nucleotide sequence. Using a thermal cycler, Pfu DNA polymerase extends the sequence around the whole vector, generating a plasmid with staggered nicks. Each cycle builds only off the parent strands, and therefore there is no amplification of misincoφorations. After 12-16 cycles, the product was treated with Dpn I, which digests the methylated parent DNA into numerous small pieces. The product was then transformed into E. coli cells, which repair the nicks. Preparation of RNA. After linearization and purification of cloned cDNAs, RNA transcripts were prepared in vitro using the appropriate mMessage mMachine kit from Ambion Inc. (Austin, TX). Expression in Xenopus oocytes. Mature (>9 cm) female Xenopus laevis African toads (Nasco, Ft. Atkinson, Wl) were used as a source of oocytes. Prior to surgery, frogs were anesthetized by placing the animal in a 2 g/L solution of MS222 (3-aminobenzoic acid ethyl ester). Oocytes were removed from an incision made in the abdomen. In order to remove the follicular cell layer, harvested oocytes were treated with collagenase from Worthington Biochemical Coφoration (Freehold, NJ) for 2 hours at room temperature in calcium-free Barm's solution (88 mM NaCl, 10 mM HEPES pH 7.6, 0.33 mM MgS04, 0.1 mg/ml gentamicin sulfate). Subsequently, stage 5 oocytes were isolated and injected with 50 nl each of a mixture of the appropriate subunit cRNAs following harvest. Recordings were made 3 to 21 days after injection depending on the cRNAs being tested. Voltage-clamp recording of whole oocyte responses. Data were obtained by means of two-electrode voltage-clamp recording. Recordings were made at room temperature (21-24 deg. C) in Frog Ringer's solution (115 mM NaCl, 10 mM HEPES, 2.5 mM KCl, and 1.8 mM CaCl2, pH 7.3) with 1 μM atropine to inhibit muscarinic acetylcholine receptor responses. This extracellular solution was used for all experiments unless otherwise noted. Voltage electrodes were filled with 3M KCl, and cunent electrodes were filled with 250 mM CsCl, 250 mM CsF, and 100 mM EGTA (pH 7.3). Bath solution and drug applications are applied through a linear perfusion system to oocytes placed in Lucite chamber with a total volume of 0.5 ml. Drug delivery involves pre-loading a 1.8 ml length of tubing at the terminus of the perfusion system, while a Mariotte flask filled with Ringer's solution is used to maintain constant perfusion. Applications of drug solutions are then synchronized with acquisition. Cunent responses are recorded using a PC interfaced to either a Warner OC-725C (Warner Instruments, Hamden, CT) or a GeneClamp 500 amplifier via a Digidata 1200 digitizer (Axon Instruments, Union City, CA). In addition, some oocyte recordings were made using a beta version of the OpusXpress 6000A (Axon Instruments, Union City, CA). OpusXpress is an integrated system that provides automated impalement and voltage clamp, which in our case permitted the study of four oocytes in parallel. Cells were automatically perfused with bath solution, and agonist solutions were delivered from a 96-well compound plate. In experiments using the OpusXpress system, the voltage and cunent electrodes were filled with 3 M KCl. In all experiments, bath flow rates were set at 6 ml/minute. Experimental protocols and analysis of data from Xenopus oocytes. Cunent responses to drug application were studied under two-electrode voltage clamp at a holding potential of -50 mV unless otherwise noted (-60 mV for the OpusXpress system). Holding cunents immediately prior to agonist application were subtracted from measurements of the peak response to agonist. All drug applications were separated by a wash period of 5 minutes unless otherwise noted. At the start of recording, all oocytes received two initial control applications of ACh. Subsequent drug applications were normalized to the second ACh application in order to control for the level of channel expression in each oocyte. Means and standard enors (SEM) were calculated from the normalized responses of at least four oocytes for each experimental concentration. For concentration-response relations, data were plotted using Kaleidagraph 3.0.2
(Abelbeck Software; Reading, PA), and curves were generated using the Hill equation: TA agonist]" Response = ^^Ηr « [agonist]" + (EC50)"
where Imax denotes the maximal response for a particular agonist/subunit combination, and n represents the Hill coefficient. Imax> n > and the EC50 were all unconstrained for the fitting procedures. For experiments measuring barium permeability, oocytes were perfused with barium Ringers (low barium: 90.7 mM NaCl, 2.5 mM KCl, 10 mM HEPES pH 7.3, 1.8 mM BaC12, 48.6 mM sucrose; high barium: 90.7 mM NaCl, 2.5 mM KCl, 10 mM HEPES pH 7.3, 18 mM BaC12). Shifts in reversal potential were measured by changing the holding potential from -40 mV to +30 mV by 10 mV increments. Calculations of barium - sodium permeability ratios using the extended GHK equation were performed using the Clampfit analysis portion of the pClamp software suite (Axon Instruments, Union City, CA). Barium was used instead of calcium to minimize the contribution of endogenous calcium-activated chloride channels (Sands, S.B. et al. Biophys. J. , 1993, 65:2614-2621). Calculations of peak amplitudes and net charge were made using pClamp either during acquisition or during subsequent Clampfit analysis. Note that measurement of net charge has been shown to be a more accurate indicator of fast α7 responses than measurement of peak response. An appropriate method using analysis of the area under the curve of agonist-evoked cunents in oocytes has been previously published (Papke, R.L. and J.K.P. Papke Br. J. Pharmacol, 2002, 137:49-61). Baseline was defined for Clampfit statistics based on 20 s before drug application, the analysis region for peak and net charge analysis went from 5 s before the initiation of drug application and extended at least 135 s following. Area analysis data is provided for all receptor subtypes examined in this paper for comparison to wild-type al. Transfection and whole cell voltage clamp recording from GH4C1 cells. GH4C1 cells were cultured in F10 medium (Gibco, Carlsbad, CA) at 37 °C, 5% CO2. Cells were transiently transfected using Fugene (Roche, Indianapolis, IN), according to the manufacturer instructions. One microgram of WT or T6'F mutant al cDNA (pTR-UF22, University of Florida, Gainesville, FL) was added to each 35-mm Petri dish, together with 0.5 or 1 μg of the cDNA encoding the red fluorescent DsRed protein (BD Biosciences Clontech, Palo Alto, CA). Cells were used 48-72 hours after transfection. Typical transfection efficiency was 10-25% using this method. Whole-cell cunents were recorded using an Axopatch 200B amplifier (Axon Instruments, Union City, CA) at room temperature. Cells were bathed in a solution containing 140 mM NaCl, 2.8 mM KCl, 2 mM CaCl2, 2 mM MgCl2, 10 mM glucose, 10 mM HEPES/ NaOH (pH 7.3). Patch electrodes (tip resistances, 1-3 MΩ) were filled with 90 mM CsCl, 60 mM CsF, 10 mM HEPES/CsOH (pH 7.3). Cells were continuously superfused by a gravity-driven perfusion system connected to a PZ-150M piezoelectric switching device (EXFO Burleigh Products Group, Victor, NY), with independent tubes for each solution placed ca. 100 μm from the cells. Cunents were recorded at 2 KHz using pClamp 8 (Axon Instruments Union City, CA), at a membrane holding potential of -70 mV, unless otherwise indicated. Analysis was conducted using pClamp 9.
Example 1 — The T6'S mutant receptor pharmacology closely resembles that of wild-type α7 Raw data traces from transiently transfected GH4C1 cells show the larger amplitude and slower macroscopic kinetics of the T6'S mutant compared to wild-type α7 (Figures 8A and 8B), and that this observation carries over from oocyte studies to a mammalian cell under whole-cell voltage clamp. Table 2 shows the results of oocyte experiments examining representative concentrations of a battery of compounds, indicating the ability of the T6'S mutant to effectively emulate wild-type al. For the drugs examined, the T6'S mutant is more like wild-type al, particularly in regard to antagonists that have been converted to agonists in the L247T mutant. Figures 8 A and 8B and Table 2 show that the T6'S variant of the present invention yields much larger cunents than wild-type 07 receptor, and provides a more faithful representation of the wild-type o7 pharmacology than does the commonly used L247T mutant.
Table 2
Figure imgf000068_0001
Example 2 — Alpha7 TM2 6' mutants are functionally expressed in oocytes and impact absolute cunent amplitude Raw data traces for each of the TM2 6' single point mutations and wild-type α7 are shown in Figure 3. A particularly obvious difference between the two 6' mutant receptors and wild-type al is the consistently large peak cunent for the T6'S mutant and the relatively small peak for the T6'F response. Quantification of differences in absolute amplitude is complicated by variations in the degree of receptor expression from cell to cell (which is why each cell is used as it's own control), however variations in cunent amplitude similar to those seen were regularly observed.
Example 3 — The α7 T6'F mutation increases ACh potency while the T6'S mutant shows no significant change in ACh potency compared to wild type al Concentration-response functions for wild-type α7 and each of the two TM2 6' mutants are seen in Figures 4A-4C. Both net charge (area under the curve) and peak CRCs are shown to illustrate the differences in apparent ACh potency as a function of the analysis method used. Comparison of these analyses shows that the wild-type α7 receptor shows the greatest difference in apparent potency, while the two 6' mutants show less difference between the two methods, probably due to their slower response kinetics (see methods). In addition, a dramatic increase in ACh potency is seen for the net charge analysis if the T6'F mutant, whereas the T6'S mutant is not significantly different from wild-type.
Example 4 — The α7 T6'F mutation abolishes divalent ion permeability and reduces inward cunent rectification Current- voltage relationships in either high or low extracellular barium, show that the wild-type al receptor displays its characteristic inward rectification and permeability to divalent ions (Figures 5A and 5B). The extended GHK equation gives an estimated barium-to-sodium permeability ratio of approximately 4:1. By contrast, the T6'F mutant receptor shows little cunent rectification, particularly under conditions of high extracellular barium and there was a complete lack of a shift in reversal potential with varying extracellular divalent ion concentrations. The GHK equation applied to these results gives a barium to sodium permeability ratio that is near zero. Measurements of barium ion permeability in the T6'S mutant were complicated by biphasic cunents like the example shown Figure 5C. These biphasic cunents occuned near the reversal potential for chloride and possibly reflect an interaction between barium and the calcium gated chloride channels that are constitutively expressed by Xenopus oocytes. Given the slow, large amplitude macroscopic responses of the al T6'S mutant, it is possible that low potency interactions between barium and these calcium gated chloride channels would be significantly enhanced.
Example 5 — Succinylcholine is a selective agonist of muscle-type receptors, and is also an agonist of al T6'F mutant receptors, but not the T6'S mutant The comparative effect of 100 μM succinylcholine on muscle or wild-type al receptors, shows that succinylcholine is relatively ineffective in activating wild-type al
(Figures 6A and 6B). A dramatic increase in sensitivity to succinylcholine can be seen in the T6'F mutant receptor, while the T6'S mutant shows no virtually no response at this concentration. The concentration-response functions for succinylcholine applied to wild-type al, or the T6'F or T6'S mutant receptors show that both wild-type α7 and the T6'S mutant respond poorly through a full range of concentrations, while succinylcholine is a relatively potent, full agonist of the T6'F mutant (Figure 7).
All patents, patent applications, provisional applications, and publications refened to or cited herein, whether supra or infra, are incoφorated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification. It should be understood that the examples and embodiments described herein are for illustrative puφoses only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application.

Claims

Claims What is claimed is:
1. A method for identifying agents that modulate nicotinic acetylcholine receptor (nAChR) activity, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant a7 nAChR polypeptide having a TM2 domain, wherein the variant c-7 nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting a test agent with the host cell; and (c) determining: (i) the effect of the test agent on the variant o7 nAChR polypeptide or the host cell expressing the polynucleotide, or (ii) the binding of the test agent to the host cell or the variant al nAChR polypeptide, or (iii) both (c) (i) and (c) (ii).
2. The method of claim 1, wherein the TM2 domain comprises the amino acid sequence of SEQ DD NO:2.
3. The method of claim 1 or claim 2, wherein the polynucleotide comprises a nucleic acid sequence selected from the group consisting of SEQ DD NO: 18, SEQ ID NO: 19, SEQ ED NO:21, SEQ DD NO:22, SEQ DD NO:23 SEQ DD NO:24, SEQ DD NO:25, SEQ DD NO:26, SEQ DD NO:27, SEQ ID NO:28, SEQ DD NO:29, SEQ DD NO:30, SEQ ID NO:31, SEQ ED NO:32, SEQ DD NO:33, SEQ DD NO:34, SEQ ID NO:35, SEQ DD NO:36, SEQ DD NO:37, SEQ HD NO:38, SEQ ID NO:39, SEQ DD NO:40, SEQ ED NO:41, SEQ ID NO:42, SEQ DD NO:43, SEQ ID NO:44, SEQ DD NO:45, SEQ ID NO:46, SEQ DD NO:47, SEQ DD NO:48, SEQ DD NO:49, SEQ DD NO:50, SEQ DD NO:51, SEQ DD NO:52, SEQ ID NO:53, SEQ DD NO:54, SEQ DD NO:55, SEQ HD NO:56, SEQ ID NO:57, SEQ ED NO:58, SEQ HD NO:59, and SEQ DD NO: 60, or degenerate variants of any of the foregoing.
4. The method of any of claims 1-3, wherein the variant al nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
5. The method of any of claims 1-4, wherein the effect of the test agent on the o7 receptor activity of the variant o7 nAChR polypeptide is determined.
6. The method of any of claims 1-5, wherein the variant o_7 nACliR polypeptide is a mammalian al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
7. The method of any of claims 1-5, wherein the variant al nAChR polypeptide is an al nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
8. The method of any of claims 1-7, wherein the variant al nAChR polypeptide comprises the human al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
9. The method of any of claims 1-8, wherein said determining of step (c) (ii) is performed by measuring a signal generated by a detectable moiety.
10. The method of claim 9, wherein the detectable moiety is selected from the group consisting of a fluorescent label, a radiolabel, a chemiluminescent label, and an enzyme.
11. The method of any of claims 1-10, wherein said determining of step (c) (i) is performed by measuring a signal generated by a radiolabeled ion, a fluorescent probe, or an electrical cunent.
12. The method of any of claims 1-11, wherein the host cell is selected from the group consisting of a bacterial cell, a mammalian cell, a yeast cell, an amphibian cell, and a starfish cell. (ii) the binding of the test agent to the host cell or the variant al nAChR polypeptide, or (iii) both of the foregoing.
13. The method of any of claims 1-12, wherein the host cell is a mammalian cell, and wherein the polynucleotide is stably expressed in the mammalian cell such that a functional receptor is formed, wherein the functional receptor elicits electrophysiological cunents in vitro or in vivo when stimulated by a wild-type al agonist.
14. The method of any of claims 1-13, wherein the serine residue is a substitution for a threonine residue (T→ S).
15. A method for identifying a cytoprotective agent, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting a test agent with the host cell; and (c) monitoring the cell or cellular function for an indication of cytotoxicity.
16. The method of claim 15, wherein the TM2 domain comprises the amino acid sequence of SEQ ED NO:2.
17. The method of claim 15 or claim 16, wherein the polynucleotide comprises SEQ DD NO: 18, SEQ DD NO:19, SEQ ED NO:21, SEQ ID NO:22, SEQ ID NO:23 SEQ ID NO:24, SEQ DD NO:25, SEQ DD NO:26, SEQ DD NO:27, SEQ DD NO:28, SEQ ID NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ DD NO:32, SEQ ID NO:33, SEQ DD NO:34, SEQ DD NO:35, SEQ DD NO:36, SEQ DD NO:37, SEQ DD NO:38, SEQ DD NO:39, SEQ ID NO:40, SEQ DD NO:41, SEQ DD NO:42, SEQ ED NO:43, SEQ ID NO:44, SEQ DD NO:45, SEQ DD NO:46, SEQ DD NO:47, SEQ DD NO:48, SEQ DD NO:49, SEQ DD NO:50, SEQ ID NO:51, SEQ DD NO:52, SEQ ED NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ D NO:56, SEQ DD NO:57, SEQ ED NO:58, SEQ ID NO:59, and SEQ DD NO:60, or degenerate variants of any of the foregoing.
18. The method of any of claims 15-17, wherein the host cell is selected from the group consisting of a bacterial cell, a mammalian cell, a yeast cell, an amphibian cell, and a starfish cell.
19. The method of any of claims 15-18, wherein the host cell is a mammalian cell, and wherein the polynucleotide is stably expressed in the mammalian cell such that a functional receptor is formed, wherein the functional receptor elicits electrophysiological cunents in vitro or in vivo when stimulated by a wild-type al agonist.
20. The method of any of claims 15-19, wherein the serine residue is a substitution for a threonine residue (T→ S).
21. The method of any of claims 15-20, wherein the variant al nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
22. The method of any of claims 15-21, wherein the variant al nAChR polypeptide is a mammalian al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
23. The method of any of claims 15-20, wherein the variant al nAChR polypeptide is an al nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
24. The method of any of claims 15-23, wherein the variant al nAChR polypeptide comprises the human al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
25. The method of any of claims 15-24, wherein the host cell is maintained in the presence of a substance so as to minimize or block a cytotoxic effect on the host cell.
26. An isolated polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain.
27. The isolated polynucleotide of claim 26, wherein the polypeptide comprises the amino acid sequence of SEQ ED NO:2.
28. The isolated polynucleotide of claim 26, wherein the serine residue is a substitution for a threonine residue (T→ S).
29. The isolated polynucleotide of any of claims 26-28, wherein the variant al nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
30. The isolated polynucleotide of claim 26, wherein the variant al nAChR polypeptide is a mammalian al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
31. The isolated polynucleotide of any of claims 26-28, wherein the variant al nAChR polypeptide is an dl nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
32. The isolated polynucleotide of any of claims 26-30, wherein the variant al nAChR polypeptide comprises the human al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
33. The isolated polynucleotide of any of claims 26-32, wherein the polynucleotide comprises SEQ DD NO: 18, SEQ DD NO:19, SEQ DD NO:21, SEQ DD NO:22, SEQ DD NO:23 SEQ DD NO:24, SEQ ED NO:25, SEQ ID NO:26, SEQ ED NO:27, SEQ ID NO:28, SEQ ED NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ ID NO:32, SEQ ED NO:33, SEQ DD NO:34, SEQ DD NO:35, SEQ DD NO:36, SEQ DD NO:37, SEQ D NO:38, SEQ ID NO:39, SEQ DD NO:40, SEQ DD NO:41, SEQ DD NO:42, SEQ ED NO:43, SEQ HD NO:44, SEQ DD NO:45, SEQ DD NO:46, SEQ DD NO:47, SEQ DD NO:48, SEQ DD NO:49, SEQ ID NO:50, SEQ DD NO:51, SEQ DD NO:52, SEQ DD NO:53, SEQ ID NO:54, SEQ DD NO:55, SEQ DD NO:56, SEQ DD NO:57, SEQ ED NO:58, SEQ DD NO:59, and SEQ DD NO:60, or degenerate variants of any of the foregoing.
34. An isolated variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain.
35. The isolated polypeptide of claim 34, wherein the polypeptide comprises the amino acid sequence of SEQ DD NO:2.
36. The isolated polypeptide of claim 34, wherein the serine residue is a substitution for a threonine residue (T→ S).
37. The isolated polypeptide of any of claims 34-36, wherein the variant al nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
38. The isolated polypeptide of any of claims 34-37, wherein the variant al nAChR polypeptide is a mammalian al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
39. The isolated polypeptide of any of claims 34-36, wherein the variant al nAChR polypeptide is an al nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
40. The isolated polypeptide of any of claims 34-39, wherein the variant al nAChR polypeptide comprises the human al nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
41. An expression vector comprising a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain, and wherein said polynucleotide is operably linked to a control sequence that directs the expression of said polynucleotide whereby said polynucleotide is expressed in a host cell.
42. The expression vector of claim 41, wherein said polypeptide encoded by said polynucleotide comprises the amino acid sequence of SEQ DD NO:2.
43. The expression vector of claim 41, wherein the serine residue is a substitution for a threonine residue (T→ S).
44. The expression vector of any of claims 41-43, wherein the variant dl nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
45. The expression vector of any of claims 41-44, wherein the variant al nAChR polypeptide is a mammalian dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
46. The expression vector of any of claims 41-43, wherein the variant o7 nAChR polypeptide is an dl nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
47. The expression vector of any of claims 41-46, wherein the variant dl nAChR polypeptide comprises the human dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
48. The expression vector of any of claims 41-47, wherein the polynucleotide comprises SEQ DD NO: 18, SEQ DD NO:19, SEQ DD NO:21, SEQ DD NO:22, SEQ DD NO:23 SEQ ED NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ED NO:27, SEQ ID NO:28, SEQ DD NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ ID NO:32, SEQ ED NO:33, SEQ ID NO:34, SEQ ED NO:35, SEQ DD NO:36, SEQ DD NO:37, SEQ ID NO:38, SEQ DD NO:39, SEQ ED NO:40, SEQ ED NO:41, SEQ ED NO:42, SEQ DD NO:43, SEQ DD NO:44, SEQ DD NO:45, SEQ DD NO:46, SEQ DD NO:47, SEQ HD NO:48, SEQ ED NO:49, SEQ ID NO:50, SEQ ED NO:51, SEQ DD NO:52, SEQ ED NO:53, SEQ ID NO:54, SEQ ED NO:55, SEQ DD NO:56, SEQ DD NO:57, SEQ DD NO:58, SEQ DD NO:59, and SEQ DD NO:60, or degenerate variants of any of the foregoing.
49. The expression vector of any of claims 41-48, wherein said control sequence comprises an inducible promoter.
50. An isolated host cell comprising a polynucleotide encoding a variant al nAChR polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain, and wherein said polynucleotide is operably linked to a control sequence that directs the expression of said polynucleotide in said host cell.
51. The isolated host cell of claim 50, wherein said host cell further comprises a control sequence operably linked to said polynucleotide, wherein the control sequence directs expression of said polynucleotide in said host cell.
52. The isolated host cell of claim 50, wherein said polynucleotide encodes a polypeptide comprising the amino acid sequence of SEQ DD NO:2.
53. The isolated host cell of any of claims 50-52, wherein the serine residue is a substitution for a threonine residue (T→ S).
54. The isolated host cell of any of claims 50-53, wherein the variant dl nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
55. The isolated host cell of any of claims 50-54, wherein the variant al nAChR polypeptide is a mammalian dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
56. The isolated host cell of claim 50, wherein the variant al nAChR polypeptide is an al nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
57. The isolated host cell of any of claims 50-55, wherein the variant al nAChR polypeptide comprises the human dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
58. The isolated host cell of any of claims 50-57, wherein the polynucleotide comprises SEQ ID NO: 18, SEQ ID NO:19, SEQ DD NO:21, SEQ DD NO:22, SEQ ID NO:23 SEQ HD NO:24, SEQ HD NO:25, SEQ ID NO:26, SEQ DD NO:27, SEQ DD NO:28, SEQ DD NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ ID NO:32, SEQ DD NO:33, SEQ DD NO:34, SEQ DD NO:35, SEQ ID NO:36, SEQ DD NO:37, SEQ DD NO:38, SEQ ID NO:39, SEQ DD NO:40, SEQ DD NO:41, SEQ DD NO:42, SEQ ID NO:43, SEQ DD NO:44, SEQ ED NO:45, SEQ ED NO:46, SEQ DD NO:47, SEQ DD NO:48, SEQ DD NO:49, SEQ ID NO:50, SEQ DD NO:51, SEQ DD NO:52, SEQ DD NO:53, SEQ ID NO:54, SEQ DD NO:55, SEQ DD NO:56, SEQ DD NO:57, SEQ DD NO:58, SEQ ED NO:59, and SEQ ED NO:60, or degenerate variants of any of the foregoing.
59. The isolated host cell of any of claims 50-58, wherein said cell is selected from the group consisting of a bacterial cell, a mammalian cell, a yeast cell, and an amphibian cell.
60. The isolated host cell of any of claims 50-58, wherein said cell is a human cell.
61. The isolated host cell of any of claims 50-60, wherein said host cell is a mammalian cell, and wherein said polynucleotide is stably expressed in said mammalian cell such that a functional receptor is formed, wherein said functional receptor elicits electrophysiological cunents in vitro or in vivo when stimulated by a wild-type dl agonist.
62. A method for treating a neurological condition in a patient, said method comprising administering a polypeptide to the patient having a TM2 domain, wherein the polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; or administering a polynucleotide encoding the polypeptide to the patient, wherein the polynucleotide is expressed within the patient.
63. The method of claim 62, wherein the TM2 domain comprises the amino acid of SEQ DD NO:2.
64. The method of claim 62 or claim 63, wherein a vector or host cell comprising the polynucleotide is administered to the patient.
65. The method of any of claims 62-64, wherein a viral vector or non- viral vector comprising the polynucleotide is administered to the patient.
66. The method of any of claims 62-65, wherein the serine residue is a substitution for a threonine residue (T→ S).
67. The method of any of claims 62-66, wherein the variant al nAChR polypeptide comprises a mammalian al nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
68. The method of any of claims 62-67, wherein the variant al nAChR polypeptide is a mammalian dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
69. The method of any of claims 62-66, wherein the variant al nAChR polypeptide is an al nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
70. The method of any of claims 62-69, wherein the variant al nAChR polypeptide comprises the human Ol nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
71. The method of any of claims 62-70, wherein the polynucleotide comprises SEQ ED NO: 18, SEQ DD NO: 19, SEQ ED NO:21, SEQ ID NO:22, SEQ DD NO:23 SEQ ID NO:24, SEQ ED NO:25, SEQ DD NO:26, SEQ DD NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ DD NO:30, SEQ DD NO:31, SEQ DD NO:32, SEQ ID NO:33, SEQ ED NO:34, SEQ DD NO:35, SEQ DD NO:36, SEQ ED NO:37, SEQ ED NO:38, SEQ DD NO:39, SEQ ID NO:40, SEQ HD NO:41, SEQ DD NO:42, SEQ DD NO:43, SEQ ID NO:44, SEQ DD NO:45, SEQ DD NO:46, SEQ ED NO:47, SEQ ED NO:48, SEQ ED NO:49, SEQ ED NO:50, SEQ ID NO:51, SEQ DD NO:52, SEQ ED NO:53, SEQ ED NO:54, SEQ ID NO:55, SEQ DD NO:56, SEQ DD NO:57, SEQ DD NO:58, SEQ ED NO:59, and SEQ DD NO:60, or degenerate variants of any of the foregoing.
72. A composition comprising a variant dl nAChR polypeptide having a TM2 domain, wherein the polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; or a polynucleotide encoding said polypeptide; and a pharmaceutically acceptable carrier.
73. The composition of claim 72, wherein the TM2 domain comprises the amino acid of SEQ DD NO:2.
74. The composition of claim 72 or claim 73, wherein the serine residue is a substitution for a threonine residue (T→ S).
75. The composition of any of claims 72-74, wherein the variant dl nAChR polypeptide comprises a mammalian dl nAChR polypeptide having a serine in the sixth amino acid position of the TM2 domain.
76. The composition of any of claims 72-75, wherein the variant al nAChR polypeptide is a mammalian dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
77. The composition of any of claims 72-74, wherein the variant dl nAChR polypeptide is an dl nAChR polypeptide of human, non-human primate, rodent, chicken, or zebrafish, having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
78. The composition of any of claims 72-77, wherein the variant dl nAChR polypeptide comprises the human dl nAChR polypeptide having a threonine to serine (T→ S) substitution in the sixth amino acid position of the TM2 domain.
79. The composition of any of claims 72-78, wherein the polynucleotide comprises SEQ DD NO: 18, SEQ DD NO:19, SEQ DD NO:21, SEQ ED NO:22, SEQ ED NO:23 SEQ DD NO:24, SEQ ED NO:25, SEQ ED NO:26, SEQ ED NO:27, SEQ ED NO:28, SEQ ED NO:29, SEQ ED NO:30, SEQ DD NO:31, SEQ DD NO:32, SEQ ED NO:33, SEQ ID NO:34, SEQ DD NO:35, SEQ ED NO:36, SEQ ED NO:37, SEQ ID NO:38, SEQ DD NO:39, SEQ ED NO:40, SEQ ED NO:41, SEQ DD NO:42, SEQ DD NO:43, SEQ ED NO:44, SEQ ID NO:45, SEQ ED NO:46, SEQ ED NO:47, SEQ ED NO:48, SEQ ID NO:49, SEQ DD NO:50, SEQ ED NO:51, SEQ ED NO:52, SEQ ED NO:53, SEQ DD NO:54, SEQ DD NO:55, SEQ ID NO:56, SEQ DD NO:57, SEQ DD NO:58, SEQ ED NO:59, and SEQ ED NO:60, or degenerate variants of any of the foregoing.
80. A method for identifying al nAChR modulators, said method comprising: (a) providing a variant dl nAChR polypeptide having a TM2 domain, wherein the polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting the polypeptide with an Aβ peptide capable of interacting with the polypeptide; (c) exposing the polypeptide and the Aβ peptide to a test agent; and (d) detennining the effect of the test agent on the interaction of the polypeptide and the Aβ peptide.
81. The method of claim 80, wherein the TM2 domain comprises the amino acid sequence of SEQ ED NO:2.
82. The method of claim 80 or claim 81, wherein the Aβ peptide is comprises β- amyloid peptideι.4 , |S-amyloidι-40, or a functional fragment or variant thereof.
83. A method for identifying a cytoprotective agent, comprising: (a) providing a host cell that expresses a polynucleotide encoding a variant al nACl R polypeptide having a TM2 domain, wherein the variant al nAChR polypeptide has a serine residue in the sixth amino acid position of the TM2 domain; (b) contacting a test "agent with the host cell; and (c) monitoring the cell or cellular function for overstimulation of the variant al nAChR polypeptide, wherein overstimulation of the variant al nAChR polypeptide indicates that the test agent is sufficient to activate a wild-type al receptor at a cytoprotective level.
84. The method of claim 83, wherein the TM2 domain comprises the amino acid sequence of SEQ ED NO:2.
PCT/US2005/003474 2004-01-30 2005-01-28 Variant neuronal nicotinic alpha-7 receptor and methods of use Ceased WO2005074641A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US10/769,085 US20050170360A1 (en) 2004-01-30 2004-01-30 Variant neuronal nicotinic alpha-7 receptor and methods of use
US10/769,085 2004-01-30

Publications (4)

Publication Number Publication Date
WO2005074641A2 true WO2005074641A2 (en) 2005-08-18
WO2005074641A8 WO2005074641A8 (en) 2005-11-10
WO2005074641A3 WO2005074641A3 (en) 2006-08-03
WO2005074641B1 WO2005074641B1 (en) 2006-09-08

Family

ID=34808038

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/003474 Ceased WO2005074641A2 (en) 2004-01-30 2005-01-28 Variant neuronal nicotinic alpha-7 receptor and methods of use

Country Status (2)

Country Link
US (1) US20050170360A1 (en)
WO (1) WO2005074641A2 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090221098A1 (en) * 2006-03-31 2009-09-03 Karima Ferrani-Kile Methods and compositions for obtaining and using biologically active multi-protein complexes
EP2910118B1 (en) * 2014-02-20 2017-10-18 Hamid Reza Noori Mutated receptor polypeptide and use thereof
CN110607305A (en) * 2019-08-30 2019-12-24 海南大学 Zebrafish α7 acetylcholine receptor recombinant vector and recombinant cells

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5683912A (en) * 1994-07-21 1997-11-04 The Salk Institute For Biological Studies Cloning and expression of a novel acetylcholine-gated ion channel receptor subunit
US6323000B2 (en) * 1996-12-20 2001-11-27 Clark A. Briggs Variant human α7 acetylcholine receptor subunit, and methods of production and uses thereof
DK1083889T3 (en) * 1998-06-01 2004-04-13 Ortho Mcneil Pharm Inc Tetrahydronaphthalene compounds and their use in the treatment of neurodegenerative diseases
GB0010955D0 (en) * 2000-05-05 2000-06-28 Novartis Ag Organic compounds
US20030113888A1 (en) * 2000-05-26 2003-06-19 Benjamin Christopher W. Human ion channels
US7067626B2 (en) * 2000-07-05 2006-06-27 Pharmacia & Upjohn Company Human ion channel proteins
US20030092613A1 (en) * 2000-08-14 2003-05-15 Lee Daniel H. S. Alpha7 nicotinic receptor peptides as ligands for beta amyloid peptides
DE10042177A1 (en) * 2000-08-28 2002-03-14 Bayer Ag New acetylcholine receptor subunit, useful for identifying plant-protection and therapeutic agents, comprises segment of insect subunit inserted into vertebrate subunit
US6852741B2 (en) * 2001-12-31 2005-02-08 University Of Florida Compositions and methods for treatment of neurological disorders

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
BERTRAND S. ET AL.: 'Paradoxical allosteric effects of competitive inhibitors on neuronal _alpha_7 nicotinic receptor mutants' NEUROREPORT vol. 8, October 1997, pages 3591 - 3596, XP003001747 *

Also Published As

Publication number Publication date
US20050170360A1 (en) 2005-08-04
WO2005074641A3 (en) 2006-08-03
WO2005074641B1 (en) 2006-09-08
WO2005074641A8 (en) 2005-11-10

Similar Documents

Publication Publication Date Title
US6683157B2 (en) Variant human α7 acetylcholine receptor subunit, and methods of production and use thereof
Blenau et al. Characterization of a dopamine D1 receptor from Apis mellifera: cloning, functional expression, pharmacology, and mRNA localization in the brain
Buck et al. Structural domains of catecholamine transporter chimeras involved in selective inhibition by antidepressants and psychomotor stimulants.
US5910582A (en) Human neuronal nicotinic acetylcholine receptor compositions and methods employing same
CA2097698C (en) Human dopamine d4 receptor and its uses
JPH09506241A (en) Human μ opioid receptor
CA2422288A1 (en) Novel mammalian receptor genes and uses
AU704927B2 (en) Human neuronal nicotinic acetylcholine receptor compositions and methods employing same
Lü et al. Cloning and functional expression of novel N-type Ca2+ channel variants
WO2005074641A2 (en) Variant neuronal nicotinic alpha-7 receptor and methods of use
DE69413944T2 (en) HUMANE 5-HT2 RECEPTOR
EP1194447B1 (en) Novel potassium channels and genes encoding these potassium channels
US6432652B1 (en) Methods of screening modulators of opioid receptor activity
US20060127914A1 (en) Nicotinic acetylcholine receptor
AU8403191A (en) A cdna encoding the rat d1 dopamine receptor linked to adenylyl cyclase activation and expression product
US6649371B1 (en) Potassium channel KCNQ5 and sequences encoding the same
US7563595B2 (en) Nucleic acids encoding functional splice variants of the α7 nicotinic acetylcholine receptor subunit and methods for producing the encoded proteins
US8232063B2 (en) H+-gated ion channel
WO2004009775A2 (en) Methods and compositions relating to chimeric nicotinic receptor subunits
US7381542B2 (en) Nucleic acids encoding a biogenic amine receptor
US7282563B2 (en) Opioid receptors and methods of use
US20040203033A1 (en) Variant human alpha7 acetylcholine receptor subunit, and methods of production and use thereof
EP1568770A2 (en) Pharmaceutical use of compounds which bind to a mammalian "trace amine" receptor
EP1185549A2 (en) Dna encoding a human subunit of the 5-ht3 serotonin receptor
MXPA99005856A (en) A variant human alpha-7 acetylcholine receptor subunit, and methods of production and use thereof

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

CFP Corrected version of a pamphlet front page
CR1 Correction of entry in section i

Free format text: IN PCT GAZETTE 24/2005 CLASSEE 33/2005 UNDER (63) REPLACE ""10/769,085 (CON)"" BY ""10/769,085 (CIP)"".

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Ref document number: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application
122 Ep: pct application non-entry in european phase