WO2005056764A2 - Inhibitors of type 2 vascular endothelial growth factor receptors - Google Patents
Inhibitors of type 2 vascular endothelial growth factor receptors Download PDFInfo
- Publication number
- WO2005056764A2 WO2005056764A2 PCT/US2004/040885 US2004040885W WO2005056764A2 WO 2005056764 A2 WO2005056764 A2 WO 2005056764A2 US 2004040885 W US2004040885 W US 2004040885W WO 2005056764 A2 WO2005056764 A2 WO 2005056764A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- binding
- beta
- single domain
- seq
- Prior art date
Links
- 108091008605 VEGF receptors Proteins 0.000 title abstract description 46
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 title abstract description 46
- 239000003112 inhibitor Substances 0.000 title description 13
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 477
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 468
- 229920001184 polypeptide Polymers 0.000 claims abstract description 457
- 230000027455 binding Effects 0.000 claims abstract description 277
- 238000009739 binding Methods 0.000 claims abstract description 270
- 238000000034 method Methods 0.000 claims abstract description 83
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims abstract description 79
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims abstract description 79
- 230000004071 biological effect Effects 0.000 claims abstract description 30
- 230000001404 mediated effect Effects 0.000 claims abstract description 20
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 claims description 361
- 102000016549 Vascular Endothelial Growth Factor Receptor-2 Human genes 0.000 claims description 233
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 claims description 157
- 108090000623 proteins and genes Proteins 0.000 claims description 143
- 102000004169 proteins and genes Human genes 0.000 claims description 136
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 126
- 210000004027 cell Anatomy 0.000 claims description 109
- 229920001223 polyethylene glycol Polymers 0.000 claims description 106
- 235000001014 amino acid Nutrition 0.000 claims description 80
- 150000001413 amino acids Chemical class 0.000 claims description 73
- 150000007523 nucleic acids Chemical class 0.000 claims description 51
- 241000282414 Homo sapiens Species 0.000 claims description 49
- 206010028980 Neoplasm Diseases 0.000 claims description 46
- 239000000203 mixture Substances 0.000 claims description 39
- 108020004707 nucleic acids Proteins 0.000 claims description 35
- 102000039446 nucleic acids Human genes 0.000 claims description 35
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 34
- 230000033115 angiogenesis Effects 0.000 claims description 34
- 230000000694 effects Effects 0.000 claims description 31
- 108060003951 Immunoglobulin Proteins 0.000 claims description 27
- 102000018358 immunoglobulin Human genes 0.000 claims description 27
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 claims description 21
- 239000000523 sample Substances 0.000 claims description 20
- 239000002202 Polyethylene glycol Substances 0.000 claims description 19
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 claims description 19
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 19
- 230000001225 therapeutic effect Effects 0.000 claims description 19
- 241000124008 Mammalia Species 0.000 claims description 18
- 230000006320 pegylation Effects 0.000 claims description 18
- 238000009472 formulation Methods 0.000 claims description 17
- 230000005764 inhibitory process Effects 0.000 claims description 17
- 210000002966 serum Anatomy 0.000 claims description 17
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 16
- 230000002285 radioactive effect Effects 0.000 claims description 16
- 125000003277 amino group Chemical group 0.000 claims description 15
- 210000004899 c-terminal region Anatomy 0.000 claims description 14
- 201000011510 cancer Diseases 0.000 claims description 14
- 102000055590 human KDR Human genes 0.000 claims description 14
- 102000016844 Immunoglobulin-like domains Human genes 0.000 claims description 13
- 108050006430 Immunoglobulin-like domains Proteins 0.000 claims description 13
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 13
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 claims description 12
- 238000010494 dissociation reaction Methods 0.000 claims description 12
- 230000005593 dissociations Effects 0.000 claims description 12
- 238000001990 intravenous administration Methods 0.000 claims description 9
- 230000002401 inhibitory effect Effects 0.000 claims description 8
- 239000012472 biological sample Substances 0.000 claims description 7
- 238000001514 detection method Methods 0.000 claims description 7
- 125000003827 glycol group Chemical group 0.000 claims description 7
- 238000002372 labelling Methods 0.000 claims description 7
- 208000023275 Autoimmune disease Diseases 0.000 claims description 6
- 102000002090 Fibronectin type III Human genes 0.000 claims description 6
- 208000027866 inflammatory disease Diseases 0.000 claims description 6
- 230000008520 organization Effects 0.000 claims description 6
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 6
- 206010038923 Retinopathy Diseases 0.000 claims description 5
- 239000007787 solid Substances 0.000 claims description 5
- 238000007920 subcutaneous administration Methods 0.000 claims description 5
- 108050009401 Fibronectin type III Proteins 0.000 claims description 4
- 230000003111 delayed effect Effects 0.000 claims description 4
- 239000013604 expression vector Substances 0.000 claims description 4
- 238000004949 mass spectrometry Methods 0.000 claims description 4
- 210000004671 cell-free system Anatomy 0.000 claims description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 claims description 3
- 208000017442 Retinal disease Diseases 0.000 claims description 2
- 230000009918 complex formation Effects 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 238000001917 fluorescence detection Methods 0.000 claims description 2
- 230000003463 hyperproliferative effect Effects 0.000 claims description 2
- 238000010324 immunological assay Methods 0.000 claims description 2
- 238000002601 radiography Methods 0.000 claims description 2
- 102000001708 Protein Isoforms Human genes 0.000 claims 1
- 108010029485 Protein Isoforms Proteins 0.000 claims 1
- 102000009519 Vascular Endothelial Growth Factor D Human genes 0.000 claims 1
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 abstract description 30
- 230000006872 improvement Effects 0.000 abstract description 6
- 235000018102 proteins Nutrition 0.000 description 110
- 229940024606 amino acid Drugs 0.000 description 75
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 42
- 239000000872 buffer Substances 0.000 description 38
- 102000014914 Carrier Proteins Human genes 0.000 description 36
- 108091008324 binding proteins Proteins 0.000 description 36
- 239000011230 binding agent Substances 0.000 description 34
- 102100037362 Fibronectin Human genes 0.000 description 33
- 108010067306 Fibronectins Proteins 0.000 description 33
- 230000004927 fusion Effects 0.000 description 31
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 30
- -1 KDR Chemical compound 0.000 description 26
- 230000002441 reversible effect Effects 0.000 description 25
- 239000011324 bead Substances 0.000 description 24
- 238000001727 in vivo Methods 0.000 description 24
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 23
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 23
- 101710204410 Scaffold protein Proteins 0.000 description 23
- 238000003556 assay Methods 0.000 description 23
- 239000011780 sodium chloride Substances 0.000 description 21
- 150000001875 compounds Chemical class 0.000 description 20
- 239000003814 drug Substances 0.000 description 20
- 238000006243 chemical reaction Methods 0.000 description 19
- 210000002889 endothelial cell Anatomy 0.000 description 19
- 108020003175 receptors Proteins 0.000 description 19
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 18
- 102000005962 receptors Human genes 0.000 description 18
- 230000011664 signaling Effects 0.000 description 18
- 241000699666 Mus <mouse, genus> Species 0.000 description 17
- 210000001519 tissue Anatomy 0.000 description 17
- 238000012217 deletion Methods 0.000 description 16
- 230000037430 deletion Effects 0.000 description 16
- 238000000338 in vitro Methods 0.000 description 16
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- 235000018417 cysteine Nutrition 0.000 description 15
- 239000012634 fragment Substances 0.000 description 15
- 239000003446 ligand Substances 0.000 description 15
- 230000035772 mutation Effects 0.000 description 15
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 14
- 230000007423 decrease Effects 0.000 description 14
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 13
- 108020004414 DNA Proteins 0.000 description 13
- 238000002703 mutagenesis Methods 0.000 description 13
- 231100000350 mutagenesis Toxicity 0.000 description 13
- 239000002246 antineoplastic agent Substances 0.000 description 12
- 229940088598 enzyme Drugs 0.000 description 12
- 238000002474 experimental method Methods 0.000 description 12
- 125000005647 linker group Chemical group 0.000 description 12
- 238000000159 protein binding assay Methods 0.000 description 12
- 238000011282 treatment Methods 0.000 description 12
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 11
- 230000009824 affinity maturation Effects 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- 229920004890 Triton X-100 Polymers 0.000 description 10
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 239000002609 medium Substances 0.000 description 10
- 238000006467 substitution reaction Methods 0.000 description 10
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 10
- 229940124597 therapeutic agent Drugs 0.000 description 10
- 238000013519 translation Methods 0.000 description 10
- 230000004614 tumor growth Effects 0.000 description 10
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 9
- 241001529936 Murinae Species 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 239000003153 chemical reaction reagent Substances 0.000 description 9
- 238000010276 construction Methods 0.000 description 9
- 230000001419 dependent effect Effects 0.000 description 9
- 230000009977 dual effect Effects 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 230000035755 proliferation Effects 0.000 description 9
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 8
- 230000004913 activation Effects 0.000 description 8
- 229910052799 carbon Inorganic materials 0.000 description 8
- 230000003247 decreasing effect Effects 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 239000012091 fetal bovine serum Substances 0.000 description 8
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 8
- 238000007912 intraperitoneal administration Methods 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 7
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 7
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 241000700159 Rattus Species 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 230000003321 amplification Effects 0.000 description 7
- 230000002491 angiogenic effect Effects 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 210000004204 blood vessel Anatomy 0.000 description 7
- 238000001516 cell proliferation assay Methods 0.000 description 7
- 238000010828 elution Methods 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 235000018977 lysine Nutrition 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 238000003199 nucleic acid amplification method Methods 0.000 description 7
- 239000012071 phase Substances 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- 108010092160 Dactinomycin Proteins 0.000 description 6
- 108010075944 Erythropoietin Receptors Proteins 0.000 description 6
- 102100036509 Erythropoietin receptor Human genes 0.000 description 6
- 239000007995 HEPES buffer Substances 0.000 description 6
- 239000004472 Lysine Substances 0.000 description 6
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 6
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 6
- 229940034982 antineoplastic agent Drugs 0.000 description 6
- 230000004663 cell proliferation Effects 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 230000021615 conjugation Effects 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 239000012216 imaging agent Substances 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 238000010839 reverse transcription Methods 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108091035707 Consensus sequence Proteins 0.000 description 5
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 5
- 206010027476 Metastases Diseases 0.000 description 5
- 101000851005 Mus musculus Vascular endothelial growth factor receptor 2 Proteins 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 5
- 229940098773 bovine serum albumin Drugs 0.000 description 5
- 229960000640 dactinomycin Drugs 0.000 description 5
- 238000000113 differential scanning calorimetry Methods 0.000 description 5
- 238000000684 flow cytometry Methods 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 239000003102 growth factor Substances 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 229920000642 polymer Polymers 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 238000006722 reduction reaction Methods 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 229910000162 sodium phosphate Inorganic materials 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 241000972773 Aulopiformes Species 0.000 description 4
- 101100098985 Caenorhabditis elegans cct-3 gene Proteins 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- 206010012689 Diabetic retinopathy Diseases 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 4
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 4
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 4
- 229920001213 Polysorbate 20 Polymers 0.000 description 4
- 238000012300 Sequence Analysis Methods 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- 125000000217 alkyl group Chemical group 0.000 description 4
- 239000005557 antagonist Substances 0.000 description 4
- 238000001574 biopsy Methods 0.000 description 4
- 230000003833 cell viability Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 238000004587 chromatography analysis Methods 0.000 description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 4
- 229960000975 daunorubicin Drugs 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 4
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 4
- 229960001156 mitoxantrone Drugs 0.000 description 4
- 239000003068 molecular probe Substances 0.000 description 4
- 230000009871 nonspecific binding Effects 0.000 description 4
- 229960003171 plicamycin Drugs 0.000 description 4
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 4
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 4
- 230000004481 post-translational protein modification Effects 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 235000019515 salmon Nutrition 0.000 description 4
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 3
- YXHLJMWYDTXDHS-IRFLANFNSA-N 7-aminoactinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=C(N)C=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 YXHLJMWYDTXDHS-IRFLANFNSA-N 0.000 description 3
- 108700012813 7-aminoactinomycin D Proteins 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 3
- 239000012103 Alexa Fluor 488 Substances 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 108010006654 Bleomycin Proteins 0.000 description 3
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 3
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 3
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 3
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 3
- 108700010070 Codon Usage Proteins 0.000 description 3
- 238000001712 DNA sequencing Methods 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 3
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- 229930192392 Mitomycin Natural products 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 3
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 3
- 102000003683 Neurotrophin-4 Human genes 0.000 description 3
- 108090000099 Neurotrophin-4 Proteins 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 229930182555 Penicillin Natural products 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- 241001415846 Procellariidae Species 0.000 description 3
- 201000004681 Psoriasis Diseases 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 206010038934 Retinopathy proliferative Diseases 0.000 description 3
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 3
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 3
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 3
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 3
- 229960001220 amsacrine Drugs 0.000 description 3
- 230000001028 anti-proliverative effect Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 230000006287 biotinylation Effects 0.000 description 3
- 238000007413 biotinylation Methods 0.000 description 3
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 229960002092 busulfan Drugs 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229960004562 carboplatin Drugs 0.000 description 3
- 230000015861 cell surface binding Effects 0.000 description 3
- 239000001913 cellulose Substances 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 3
- 229960004630 chlorambucil Drugs 0.000 description 3
- 229960004316 cisplatin Drugs 0.000 description 3
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 3
- 230000001268 conjugating effect Effects 0.000 description 3
- 229960004397 cyclophosphamide Drugs 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 229960001904 epirubicin Drugs 0.000 description 3
- 229960005420 etoposide Drugs 0.000 description 3
- 238000002523 gelfiltration Methods 0.000 description 3
- 208000005017 glioblastoma Diseases 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 102000006261 human tropomyosin-related kinase-B Human genes 0.000 description 3
- 108010058135 human tropomyosin-related kinase-B Proteins 0.000 description 3
- 229960000908 idarubicin Drugs 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 208000002780 macular degeneration Diseases 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 3
- 229960001924 melphalan Drugs 0.000 description 3
- 229910052751 metal Chemical class 0.000 description 3
- 239000002184 metal Chemical class 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 229960004857 mitomycin Drugs 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 229940049954 penicillin Drugs 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 3
- 229960000624 procarbazine Drugs 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 239000002510 pyrogen Substances 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 229960001278 teniposide Drugs 0.000 description 3
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 3
- 230000007704 transition Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 230000002792 vascular Effects 0.000 description 3
- 210000005166 vasculature Anatomy 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 229960003048 vinblastine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 3
- 229960004528 vincristine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- MWWSFMDVAYGXBV-MYPASOLCSA-N (7r,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.O([C@@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-MYPASOLCSA-N 0.000 description 2
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 2
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 2
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 2
- 101710097567 12 kDa protein Proteins 0.000 description 2
- NQUNIMFHIWQQGJ-UHFFFAOYSA-N 2-nitro-5-thiocyanatobenzoic acid Chemical compound OC(=O)C1=CC(SC#N)=CC=C1[N+]([O-])=O NQUNIMFHIWQQGJ-UHFFFAOYSA-N 0.000 description 2
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 2
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 101100000858 Caenorhabditis elegans act-3 gene Proteins 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 2
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 2
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 2
- 206010016654 Fibrosis Diseases 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- 208000010412 Glaucoma Diseases 0.000 description 2
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 2
- 108010069236 Goserelin Proteins 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000852145 Homo sapiens Erythropoietin receptor Proteins 0.000 description 2
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 2
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 2
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 229930182816 L-glutamine Natural products 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- XUMBMVFBXHLACL-UHFFFAOYSA-N Melanin Chemical compound O=C1C(=O)C(C2=CNC3=C(C(C(=O)C4=C32)=O)C)=C2C4=CNC2=C1C XUMBMVFBXHLACL-UHFFFAOYSA-N 0.000 description 2
- 101710164418 Movement protein TGB2 Proteins 0.000 description 2
- 101100372766 Mus musculus Kdr gene Proteins 0.000 description 2
- KYRVNWMVYQXFEU-UHFFFAOYSA-N Nocodazole Chemical compound C1=C2NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CS1 KYRVNWMVYQXFEU-UHFFFAOYSA-N 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100035194 Placenta growth factor Human genes 0.000 description 2
- 102000013566 Plasminogen Human genes 0.000 description 2
- 108010051456 Plasminogen Chemical group 0.000 description 2
- 208000002151 Pleural effusion Diseases 0.000 description 2
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 2
- 102000003923 Protein Kinase C Human genes 0.000 description 2
- 108090000315 Protein Kinase C Proteins 0.000 description 2
- 206010037649 Pyogenic granuloma Diseases 0.000 description 2
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 206010038933 Retinopathy of prematurity Diseases 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 206010043189 Telangiectasia Diseases 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 102000016548 Vascular Endothelial Growth Factor Receptor-1 Human genes 0.000 description 2
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- 229960003942 amphotericin b Drugs 0.000 description 2
- 229960002932 anastrozole Drugs 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 239000002870 angiogenesis inducing agent Substances 0.000 description 2
- 239000004037 angiogenesis inhibitor Substances 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000002927 anti-mitotic effect Effects 0.000 description 2
- 230000000118 anti-neoplastic effect Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 210000002469 basement membrane Anatomy 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 229960000997 bicalutamide Drugs 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 229960004117 capecitabine Drugs 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 229960005243 carmustine Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 230000000973 chemotherapeutic effect Effects 0.000 description 2
- 229960002436 cladribine Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000002131 composite material Substances 0.000 description 2
- 239000003636 conditioned culture medium Substances 0.000 description 2
- 238000011443 conventional therapy Methods 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 229960000684 cytarabine Drugs 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- 229960003668 docetaxel Drugs 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000007515 enzymatic degradation Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 229940126864 fibroblast growth factor Drugs 0.000 description 2
- 230000004761 fibrosis Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- 229940045109 genistein Drugs 0.000 description 2
- 235000006539 genistein Nutrition 0.000 description 2
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 2
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 229960002913 goserelin Drugs 0.000 description 2
- 201000011066 hemangioma Diseases 0.000 description 2
- 102000058223 human VEGFA Human genes 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- 108091005979 iodinated proteins Proteins 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- 229910052742 iron Inorganic materials 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 229940043355 kinase inhibitor Drugs 0.000 description 2
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 2
- 229960003881 letrozole Drugs 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 229960004961 mechlorethamine Drugs 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 229960000350 mitotane Drugs 0.000 description 2
- 231100000219 mutagenic Toxicity 0.000 description 2
- 230000003505 mutagenic effect Effects 0.000 description 2
- 201000003142 neovascular glaucoma Diseases 0.000 description 2
- 201000009925 nephrosclerosis Diseases 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 2
- 229960002653 nilutamide Drugs 0.000 description 2
- 229950006344 nocodazole Drugs 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 230000000269 nucleophilic effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 229960002340 pentostatin Drugs 0.000 description 2
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 230000035699 permeability Effects 0.000 description 2
- 235000021317 phosphate Nutrition 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000003566 phosphorylation assay Methods 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 230000001023 pro-angiogenic effect Effects 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 238000006268 reductive amination reaction Methods 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 210000001995 reticulocyte Anatomy 0.000 description 2
- FGDZQCVHDSGLHJ-UHFFFAOYSA-M rubidium chloride Chemical compound [Cl-].[Rb+] FGDZQCVHDSGLHJ-UHFFFAOYSA-M 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 125000005629 sialic acid group Chemical group 0.000 description 2
- 229960002930 sirolimus Drugs 0.000 description 2
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 229960001052 streptozocin Drugs 0.000 description 2
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 208000009056 telangiectasis Diseases 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- 210000001685 thyroid gland Anatomy 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 229960000303 topotecan Drugs 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 229960000575 trastuzumab Drugs 0.000 description 2
- 229960001727 tretinoin Drugs 0.000 description 2
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 2
- 102000015534 trkB Receptor Human genes 0.000 description 2
- 108010064880 trkB Receptor Proteins 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 210000003556 vascular endothelial cell Anatomy 0.000 description 2
- 230000004862 vasculogenesis Effects 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 2
- 229960002066 vinorelbine Drugs 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- FQWZLZJRZNURGX-BYPYZUCNSA-N (2s)-2-(2-diazohydrazinyl)-4-methylsulfanylbutanoic acid Chemical group CSCC[C@@H](C(O)=O)NN=[N+]=[N-] FQWZLZJRZNURGX-BYPYZUCNSA-N 0.000 description 1
- DEQANNDTNATYII-OULOTJBUSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-19-[[(2r)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-n-[(2r,3r)-1,3-dihydroxybutan-2-yl]-7-[(1r)-1-hydroxyethyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxa Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)C1=CC=CC=C1 DEQANNDTNATYII-OULOTJBUSA-N 0.000 description 1
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 1
- CTRPRMNBTVRDFH-UHFFFAOYSA-N 2-n-methyl-1,3,5-triazine-2,4,6-triamine Chemical class CNC1=NC(N)=NC(N)=N1 CTRPRMNBTVRDFH-UHFFFAOYSA-N 0.000 description 1
- 108020005065 3' Flanking Region Proteins 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- PEJGGZVVBQPTRG-UHFFFAOYSA-N 3-[2-[2-[2-[bis(4-methoxyphenyl)-phenylmethoxy]ethoxy]ethoxy]ethoxy-[di(propan-2-yl)amino]phosphanyl]oxypropanenitrile Chemical compound C1=CC(OC)=CC=C1C(OCCOCCOCCOP(OCCC#N)N(C(C)C)C(C)C)(C=1C=CC(OC)=CC=1)C1=CC=CC=C1 PEJGGZVVBQPTRG-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- APRZHQXAAWPYHS-UHFFFAOYSA-N 4-[5-[3-(carboxymethoxy)phenyl]-3-(4,5-dimethyl-1,3-thiazol-2-yl)tetrazol-3-ium-2-yl]benzenesulfonate Chemical compound S1C(C)=C(C)N=C1[N+]1=NC(C=2C=C(OCC(O)=O)C=CC=2)=NN1C1=CC=C(S([O-])(=O)=O)C=C1 APRZHQXAAWPYHS-UHFFFAOYSA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- RXGJTUSBYWCRBK-UHFFFAOYSA-M 5-methylphenazinium methyl sulfate Chemical compound COS([O-])(=O)=O.C1=CC=C2[N+](C)=C(C=CC=C3)C3=NC2=C1 RXGJTUSBYWCRBK-UHFFFAOYSA-M 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 208000003120 Angiofibroma Diseases 0.000 description 1
- 102000012936 Angiostatins Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 239000005552 B01AC04 - Clopidogrel Substances 0.000 description 1
- 239000005528 B01AC05 - Ticlopidine Substances 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 101000645291 Bos taurus Metalloproteinase inhibitor 2 Proteins 0.000 description 1
- 108010037003 Buserelin Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- COXVTLYNGOIATD-HVMBLDELSA-N CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O Chemical compound CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O COXVTLYNGOIATD-HVMBLDELSA-N 0.000 description 1
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- DQFBYFPFKXHELB-UHFFFAOYSA-N Chalcone Natural products C=1C=CC=CC=1C(=O)C=CC1=CC=CC=C1 DQFBYFPFKXHELB-UHFFFAOYSA-N 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 229940122097 Collagenase inhibitor Drugs 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 206010011017 Corneal graft rejection Diseases 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- QMNFFXRFOJIOKZ-UHFFFAOYSA-N Cycloguanyl Natural products CC1(C)N=C(N)N=C(N)N1C1=CC=C(Cl)C=C1 QMNFFXRFOJIOKZ-UHFFFAOYSA-N 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- CKLJMWTZIZZHCS-UWTATZPHSA-N D-aspartic acid Chemical compound OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- 239000012623 DNA damaging agent Substances 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000007342 Diabetic Nephropathies Diseases 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 206010013710 Drug interaction Diseases 0.000 description 1
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 1
- 101710146526 Dual specificity mitogen-activated protein kinase kinase 1 Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 108010029961 Filgrastim Proteins 0.000 description 1
- 229940123414 Folate antagonist Drugs 0.000 description 1
- 206010017076 Fracture Diseases 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- GYHNNYVSQQEPJS-UHFFFAOYSA-N Gallium Chemical compound [Ga] GYHNNYVSQQEPJS-UHFFFAOYSA-N 0.000 description 1
- 102100040004 Gamma-glutamylcyclotransferase Human genes 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 208000032759 Hemolytic-Uremic Syndrome Diseases 0.000 description 1
- 206010019668 Hepatic fibrosis Diseases 0.000 description 1
- 101000886680 Homo sapiens Gamma-glutamylcyclotransferase Proteins 0.000 description 1
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 1
- 101000996663 Homo sapiens Neurotrophin-4 Proteins 0.000 description 1
- 101001001487 Homo sapiens Phosphatidylinositol-glycan biosynthesis class F protein Proteins 0.000 description 1
- 101000700735 Homo sapiens Serine/arginine-rich splicing factor 7 Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 108700001097 Insect Genes Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 239000007760 Iscove's Modified Dulbecco's Medium Substances 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 229940124647 MEK inhibitor Drugs 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 208000006395 Meigs Syndrome Diseases 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 206010066453 Mesangioproliferative glomerulonephritis Diseases 0.000 description 1
- XOGTZOOQQBDUSI-UHFFFAOYSA-M Mesna Chemical compound [Na+].[O-]S(=O)(=O)CCS XOGTZOOQQBDUSI-UHFFFAOYSA-M 0.000 description 1
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 102100023174 Methionine aminopeptidase 2 Human genes 0.000 description 1
- 108090000192 Methionyl aminopeptidases Proteins 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 101001026869 Mus musculus F-box/LRR-repeat protein 3 Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical class ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical class O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 1
- 101150056950 Ntrk2 gene Proteins 0.000 description 1
- MSHZHSPISPJWHW-UHFFFAOYSA-N O-(chloroacetylcarbamoyl)fumagillol Chemical compound O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)NC(=O)CCl)CCC21CO2 MSHZHSPISPJWHW-UHFFFAOYSA-N 0.000 description 1
- 108010016076 Octreotide Proteins 0.000 description 1
- 108091006006 PEGylated Proteins Proteins 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- 208000005228 Pericardial Effusion Diseases 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 102000004422 Phospholipase C gamma Human genes 0.000 description 1
- 108010056751 Phospholipase C gamma Proteins 0.000 description 1
- 241001315609 Pittosporum crassifolium Species 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-RNFDNDRNSA-N Potassium-43 Chemical compound [43K] ZLMJMSJWJFRBEC-RNFDNDRNSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 1
- 101710141955 RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 1
- 102100030852 Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Human genes 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 102000017852 Saposin Human genes 0.000 description 1
- 108050007079 Saposin Proteins 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 102100029287 Serine/arginine-rich splicing factor 7 Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 208000032005 Spinocerebellar ataxia with axonal neuropathy type 2 Diseases 0.000 description 1
- 238000003800 Staudinger reaction Methods 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102000012607 Thrombomodulin Human genes 0.000 description 1
- 108010079274 Thrombomodulin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 208000034841 Thrombotic Microangiopathies Diseases 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 241000390203 Trachoma Species 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical class OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046392 Ureteric cancer Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 1
- 102000016663 Vascular Endothelial Growth Factor Receptor-3 Human genes 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 102100035140 Vitronectin Human genes 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- JOOSFXXMIOXKAZ-UHFFFAOYSA-H [Au+3].[Au+3].[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O Chemical compound [Au+3].[Au+3].[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O JOOSFXXMIOXKAZ-UHFFFAOYSA-H 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 238000011374 additional therapy Methods 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 238000007818 agglutination assay Methods 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 230000000964 angiostatic effect Effects 0.000 description 1
- 229940125364 angiotensin receptor blocker Drugs 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 230000000181 anti-adherent effect Effects 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002095 anti-migrative effect Effects 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 229940127218 antiplatelet drug Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 206010071578 autoimmune retinopathy Diseases 0.000 description 1
- 208000033361 autosomal recessive with axonal neuropathy 2 spinocerebellar ataxia Diseases 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 239000003139 biocide Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000001045 blue dye Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- CUWODFFVMXJOKD-UVLQAERKSA-N buserelin Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](COC(C)(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 CUWODFFVMXJOKD-UVLQAERKSA-N 0.000 description 1
- 229960002719 buserelin Drugs 0.000 description 1
- 150000004648 butanoic acid derivatives Chemical class 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000007707 calorimetry Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 230000006315 carbonylation Effects 0.000 description 1
- 238000005810 carbonylation reaction Methods 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 235000005513 chalcones Nutrition 0.000 description 1
- 230000001876 chaperonelike Effects 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 239000007910 chewable tablet Substances 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 208000023819 chronic asthma Diseases 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- GKTWGGQPFAXNFI-HNNXBMFYSA-N clopidogrel Chemical compound C1([C@H](N2CC=3C=CSC=3CC2)C(=O)OC)=CC=CC=C1Cl GKTWGGQPFAXNFI-HNNXBMFYSA-N 0.000 description 1
- 229960003009 clopidogrel Drugs 0.000 description 1
- 229960001338 colchicine Drugs 0.000 description 1
- 239000002442 collagenase inhibitor Substances 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 208000021921 corneal disease Diseases 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 150000001923 cyclic compounds Chemical class 0.000 description 1
- MKNXBRLZBFVUPV-UHFFFAOYSA-L cyclopenta-1,3-diene;dichlorotitanium Chemical compound Cl[Ti]Cl.C=1C=C[CH-]C=1.C=1C=C[CH-]C=1 MKNXBRLZBFVUPV-UHFFFAOYSA-L 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 229960003843 cyproterone Drugs 0.000 description 1
- DUSHUSLJJMDGTE-ZJPMUUANSA-N cyproterone Chemical compound C1=C(Cl)C2=CC(=O)[C@@H]3C[C@@H]3[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)C)(O)[C@@]1(C)CC2 DUSHUSLJJMDGTE-ZJPMUUANSA-N 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 208000033679 diabetic kidney disease Diseases 0.000 description 1
- 229960003839 dienestrol Drugs 0.000 description 1
- NFDFQCUYFHCNBW-SCGPFSFSSA-N dienestrol Chemical compound C=1C=C(O)C=CC=1\C(=C/C)\C(=C\C)\C1=CC=C(O)C=C1 NFDFQCUYFHCNBW-SCGPFSFSSA-N 0.000 description 1
- 229960003309 dienogest Drugs 0.000 description 1
- AZFLJNIPTRTECV-FUMNGEBKSA-N dienogest Chemical compound C1CC(=O)C=C2CC[C@@H]([C@H]3[C@@](C)([C@](CC3)(O)CC#N)CC3)C3=C21 AZFLJNIPTRTECV-FUMNGEBKSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 1
- 229960000452 diethylstilbestrol Drugs 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 1
- 229960002768 dipyridamole Drugs 0.000 description 1
- GCSAXWHQFYOIFE-UHFFFAOYSA-N dipyridin-2-yl carbonate Chemical compound C=1C=CC=NC=1OC(=O)OC1=CC=CC=N1 GCSAXWHQFYOIFE-UHFFFAOYSA-N 0.000 description 1
- 208000022602 disease susceptibility Diseases 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229930182833 estradiol Natural products 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 229960003699 evans blue Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- 229960004177 filgrastim Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- AAXVEMMRQDVLJB-BULBTXNYSA-N fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 1
- 229960002011 fludrocortisone Drugs 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960001751 fluoxymesterone Drugs 0.000 description 1
- YLRFCQOZQXIBAB-RBZZARIASA-N fluoxymesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)C[C@@H]2O YLRFCQOZQXIBAB-RBZZARIASA-N 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 210000000842 folliculostellate cell Anatomy 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- 229940083124 ganglion-blocking antiadrenergic secondary and tertiary amines Drugs 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000005227 gel permeation chromatography Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Polymers 0.000 description 1
- 238000005469 granulation Methods 0.000 description 1
- 230000003179 granulation Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000003668 hormone analog Substances 0.000 description 1
- 235000003642 hunger Nutrition 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 1
- 230000001631 hypertensive effect Effects 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000000797 iron chelating agent Substances 0.000 description 1
- XEEYBQQBJWHFJM-AHCXROLUSA-N iron-52 Chemical compound [52Fe] XEEYBQQBJWHFJM-AHCXROLUSA-N 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 150000003951 lactams Chemical class 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 229960001614 levamisole Drugs 0.000 description 1
- 238000000670 ligand binding assay Methods 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 238000012153 long-term therapy Methods 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004924 lung microvascular endothelial cell Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 150000002669 lysines Chemical class 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 229920001427 mPEG Polymers 0.000 description 1
- 238000002824 mRNA display Methods 0.000 description 1
- 229940124302 mTOR inhibitor Drugs 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 1
- WPBNNNQJVZRUHP-UHFFFAOYSA-L manganese(2+);methyl n-[[2-(methoxycarbonylcarbamothioylamino)phenyl]carbamothioyl]carbamate;n-[2-(sulfidocarbothioylamino)ethyl]carbamodithioate Chemical compound [Mn+2].[S-]C(=S)NCCNC([S-])=S.COC(=O)NC(=S)NC1=CC=CC=C1NC(=S)NC(=O)OC WPBNNNQJVZRUHP-UHFFFAOYSA-L 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004616 medroxyprogesterone Drugs 0.000 description 1
- FRQMUZJSZHZSGN-HBNHAYAOSA-N medroxyprogesterone Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FRQMUZJSZHZSGN-HBNHAYAOSA-N 0.000 description 1
- 229960001786 megestrol Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 229960004635 mesna Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000004065 mitochondrial dysfunction Effects 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 241000264288 mixed libraries Species 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 1
- 229960004866 mycophenolate mofetil Drugs 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 229940097998 neurotrophin 4 Drugs 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 239000002840 nitric oxide donor Substances 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 238000013421 nuclear magnetic resonance imaging Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 229960002700 octreotide Drugs 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000016087 ovulation Effects 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- WRUUGTRCQOWXEG-UHFFFAOYSA-N pamidronate Chemical compound NCCC(O)(P(O)(O)=O)P(O)(O)=O WRUUGTRCQOWXEG-UHFFFAOYSA-N 0.000 description 1
- 229940046231 pamidronate Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- YXJYBPXSEKMEEJ-UHFFFAOYSA-N phosphoric acid;sulfuric acid Chemical compound OP(O)(O)=O.OS(O)(=O)=O YXJYBPXSEKMEEJ-UHFFFAOYSA-N 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 238000001126 phototherapy Methods 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000000106 platelet aggregation inhibitor Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 1
- 210000004896 polypeptide structure Anatomy 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 238000002600 positron emission tomography Methods 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 239000003223 protective agent Substances 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Natural products C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 238000011127 radiochemotherapy Methods 0.000 description 1
- 230000003439 radiotherapeutic effect Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000001953 recrystallisation Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000007151 ring opening polymerisation reaction Methods 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 102220054983 rs143820757 Human genes 0.000 description 1
- 102220328483 rs1555593600 Human genes 0.000 description 1
- 229940102127 rubidium chloride Drugs 0.000 description 1
- 108010038196 saccharide-binding proteins Proteins 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 230000009450 sialylation Effects 0.000 description 1
- 238000003567 signal transduction assay Methods 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- 235000011152 sodium sulphate Nutrition 0.000 description 1
- 239000002047 solid lipid nanoparticle Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 230000037351 starvation Effects 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 239000002731 stomach secretion inhibitor Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- FRGKKTITADJNOE-UHFFFAOYSA-N sulfanyloxyethane Chemical compound CCOS FRGKKTITADJNOE-UHFFFAOYSA-N 0.000 description 1
- 230000010741 sumoylation Effects 0.000 description 1
- 229960005314 suramin Drugs 0.000 description 1
- FIAFUQMPZJWCLV-UHFFFAOYSA-N suramin Chemical compound OS(=O)(=O)C1=CC(S(O)(=O)=O)=C2C(NC(=O)C3=CC=C(C(=C3)NC(=O)C=3C=C(NC(=O)NC=4C=C(C=CC=4)C(=O)NC=4C(=CC=C(C=4)C(=O)NC=4C5=C(C=C(C=C5C(=CC=4)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)C)C=CC=3)C)=CC=C(S(O)(=O)=O)C2=C1 FIAFUQMPZJWCLV-UHFFFAOYSA-N 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000007939 sustained release tablet Substances 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- LRBQNJMCXXYXIU-NRMVVENXSA-N tannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-NRMVVENXSA-N 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 229940033123 tannic acid Drugs 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 230000010512 thermal transition Effects 0.000 description 1
- 150000003556 thioamides Chemical class 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- PHWBOXQYWZNQIN-UHFFFAOYSA-N ticlopidine Chemical compound ClC1=CC=CC=C1CN1CC(C=CS2)=C2CC1 PHWBOXQYWZNQIN-UHFFFAOYSA-N 0.000 description 1
- 229960005001 ticlopidine Drugs 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 206010044325 trachoma Diseases 0.000 description 1
- DQFBYFPFKXHELB-VAWYXSNFSA-N trans-chalcone Chemical compound C=1C=CC=CC=1C(=O)\C=C\C1=CC=CC=C1 DQFBYFPFKXHELB-VAWYXSNFSA-N 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 210000003606 umbilical vein Anatomy 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 210000000626 ureter Anatomy 0.000 description 1
- 210000003708 urethra Anatomy 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 239000002525 vasculotropin inhibitor Substances 0.000 description 1
- 230000024883 vasodilation Effects 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000000264 venule Anatomy 0.000 description 1
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000007794 visualization technique Methods 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 230000037314 wound repair Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- XOOUIPVCVHRTMJ-UHFFFAOYSA-L zinc stearate Chemical compound [Zn+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O XOOUIPVCVHRTMJ-UHFFFAOYSA-L 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1062—Isolating an individual clone by screening libraries mRNA-Display, e.g. polypeptide and encoding template are connected covalently
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/06—Libraries containing nucleotides or polynucleotides, or derivatives thereof
- C40B40/08—Libraries containing RNA or DNA which encodes proteins, e.g. gene libraries
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/23—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a GST-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/42—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a HA(hemagglutinin)-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/43—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
Definitions
- the present disclosure relates to novel vascular endothelial growth factor receptor (VEGFR)-binding polypeptides and methods for using these polypeptides to inhibit biological activities mediated by vascular endothelial growth factors (VEGFs).
- Angiogenesis is the process by which new blood vessels are formed from pre- existing capillaries or post capillary venules; it is an important component of many physiological processes including ovulation, embryonic development, wound repair, and collateral vascular generation in the myocardium.
- Angiogenesis is also central to a number of pathological conditions such as tumor growth and metastasis, diabetic retinopathy, and macular degeneration.
- the process begins with the activation of existing vascular endothelial cells in response to a variety of cytokines and growth factors.
- tumor released cytokines or angiogenic factors stimulate vascular endothelial cells by interacting with specific cell surface receptors.
- the activated endothelial cells secrete enzymes that degrade the basement membrane of the vessels, allowing invasion of the endothelial cells into the tumor tissue.
- the endothelial cells differentiate to form new vessel offshoots of pre-existing vessels.
- the new blood vessels provide nutrients to the tumor, facilitating further growth, and also provide a route for metastasis.
- numerous angiogenic factors have been identified, including the particularly potent factor VEGF.
- VEGFRs are tyrosine kinase receptors, many of which are important regulators of angiogenesis.
- the VEGFR family includes 3 major subtypes: VEGFR-1, VEGFR-2 (also known as Kinase Insert Domain Receptor, "KDR", in humans), and VEGFR-3.
- VEGF- A, VEGF-C and VEGF-D are known to bind and activate VEGFR-2.
- VEGF acting through its cognate receptors, can function as an endothelial specific mitogen during angiogenesis.
- VEGF and VEGFRs are up-regulated in conditions characterized by inappropriate angiogenesis, such as cancer.
- Current therapeutic approaches that target or inhibit VEGF or VEGFR include antibodies, peptides, and small molecule kinase inhibitors. Of these, antibodies are the most widely used for in vivo recognition and inhibition of ligands and cellular receptors.
- VEGFR-2 receptors particularly human VEGFR-2 (also known as KDR) and mouse VEGFR-2 (also known as Flk-1).
- VEGFR-2 binding proteins described herein may be used, for example, to detect VEGFR-2 in vivo or in vitro.
- certain VEGFR-2 binding proteins described herein may be used to treat diseases associated with VEGFR-2-mediated biological activity.
- KDR mediates pro- angiogenic effects of VEGF
- certain KDR binding proteins of the disclosure may be used to inhibit angiogenesis in a human patient.
- Certain VEGFR-2 binding proteins of the disclosure may be used to treat disorders such as cancers, inflammatory diseases, autoimmune diseases and retinopathies.
- a single domain polypeptide described herein will generally be a polypeptide that binds to a target, such as VEGFR-2, and where target binding activity situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain.
- the disclosure also provides larger proteins that may comprise single domain polypeptides that bind to target. For example, a plurality of single domain polypeptides may be connected to create a composite molecule with increased avidity.
- a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides.
- a single domain polypeptide may comprise at least five to seven beta or beta-like strands distributed among at least two beta sheets, as exemplified by immunoglobulin and immunoglobulin-like domains.
- a beta-like strand is a string of amino acids that participates in the stabilization of a single domain polypeptide but does not necessarily adopt a beta strand conformation. Whether a beta- like strand participates in the stabilization of the protein may be assessed by deleting the string or altering the sequence of the string and analyzing whether protein stability is diminished.
- a single domain polypeptide will include no more than two beta-like strands.
- a beta-like strand will not usually adopt an alpha-helical conformation but may adopt a random coil structure.
- a beta-like strand will most often occur at the position in the structure that would otherwise be occupied by the most N-terminal beta strand or the most C-terminal beta strand.
- an amino acid string which, if situated in the interior of a protein sequence would normally form a beta strand, may, when situated at a position closer to an N- or C-terminus, adopt a conformation that is not clearly a beta strand and is referred to herein as a beta-like strand.
- the disclosure provides single domain polypeptides that bind to VEGFR-2.
- the single domain polypeptides bind to human KDR, mouse Flk-1, or both.
- a single domain polypeptide may comprise between about 80 and about 150 amino acids that have a structural organization comprising: at least seven beta strands or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta strands or beta-like strands, which loop portion participates in binding to VEGFR-2.
- a loop portion may link two beta strands, two beta-like strands or one beta strand and one beta-like strand.
- one or more of the loop portions will participate in VEGFR-2 binding, although it is possible that one or more of the beta or beta- like strand portions will also participate in VEGFR-2 binding, particularly those beta or beta-like strand portions that are situated closest to the loop portions.
- a single domain polypeptide may comprise a structural unit that is an immunoglobulin domain or an immunoglobulin-like domain.
- a single domain polypeptide may bind to any part of VEGFR-2, although polypeptides that bind to an extracellular domain of a VEGFR-2 are preferred. Binding may be assessed in terms of equilibrium constants (e.g., dissociation, K D ) and in terms of kinetic constants (e.g., on rate constant, k on and off rate constant, k 0ff ).
- K D equilibrium constants
- kinetic constants e.g., on rate constant, k on and off rate constant, k 0ff
- a single domain polypeptide will typically be selected to bind to VEGFR-2 with a K D of less than 10 "6 M, or less than 10 " 7 M, 5xl0 "8 M, 10 "8 M or less than 10 "9 M.
- VEGFR-2 binding polypeptides may compete for binding with one, two or more members of the VEGF family, particularly VEGF- A, VEGF-C and VEGF-D and may inhibit one or more VEGFR-2-mediated biological events, such as proliferation of endothelial cells, permeabilization of blood vessels and increased motility in endothelial cells.
- VEGFR-2 binding polypeptides may be used for therapeutic purposes as well as for any purpose involving the detection or binding of VEGFR-2.
- Polypeptides for therapeutic use will generally have a K D of less than 5x10 " 8 M, less than 10 "8 M or less than 10 "9 M, although higher K D values may be tolerated where the k 0f f is sufficiently low or the k on is sufficiently high.
- a single domain polypeptide that binds to VEGFR-2 will comprise a consensus VEGFR-2 binding sequence selected from the group consisting of: SEQ LD NO:l, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4. Preferably, such sequence will be situated in a loop, particularly the FG loop.
- the single domain polypeptide comprises an immunoglobulin (Ig) variable domain.
- the Ig variable domain may, for example, be selected from the group consisting of: a human V domain, a human V H domain and a camelid V HH domain.
- the single domain polypeptide comprises an immunoglobulin-like domain.
- One, two, three or more loops of the immunoglobulin- like domain may participate in binding to VEGFR-2.
- a preferred immunoglobulin-like domain is a fibronectin type III (Fn3) domain.
- Such domain may comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta strand, B; a loop, BC; a beta strand C; a loop CD; a beta strand D; a loop DE; a beta strand F; a loop FG; and a beta or beta- like strand G.
- a beta or beta-like strand A
- loop, AB a beta strand, B
- a loop, BC a beta strand C
- a loop CD a beta strand D
- a loop DE a beta strand F
- a loop FG and a beta or beta- like strand G.
- any or all of loops AB, BC, CD, DE, EF and FG may participate in VEGFR-2 binding, although preferred loops are BC, DE and FG.
- a preferred Fn3 domain is an Fn3 domain derived from human fibronectin, particularly the 10 th Fn3 domain of fibronectin, referred to as 10 Fn3. It should be noted that none of VEGFR-2 binding polypeptides disclosed herein have an amino acid sequence that is identical to native 10 Fn3; the sequence has been modified to obtain VEGFR-2 binding proteins, but proteins having the basic structural features of 10 Fn3, and particularly those retaining recognizable sequence homology to the native l Fn3 are nonetheless referred to herein as " 10 Fn3 polypeptides”.
- a 10 Fn3 polypeptide may be at least 60%, 65%, 70%, 75%, 80%, 85%, or 90% identical to the human 10 Fn3 domain, shown in SEQ ID NO:5. Much of the variability will generally occur in one or more of the loops.
- Each of the beta or beta-like strands of a 10 Fn3 polypeptide may consist essentially of an amino acid sequence that is at least 80%, 85%, 90%, 95% or 100%) identical to the sequence of a corresponding beta or beta-like strand of SEQ ID NO: 5, provided that such variation does not disrupt the stability of the polypeptide in physiological conditions.
- a 10 Fn3 polypeptide may have a sequence in each of the loops AB, CD, and EF that consists essentially of an amino acid sequence that is at least 80%), 85%, 90%, 95% or 100% identical to the sequence of a corresponding loop of SEQ ID NO:5. In many instances, any or all of loops BC, DE, and FG will be poorly conserved relative to SEQ ID NO:5.
- all of loops BC, DE, and FG may be less than 20% ⁇ , 10%, or 0% identical to their corresponding loops in SEQ ID NO:5.
- the disclosure provides a non-antibody polypeptide comprising a domain having an immunoglobulin-like fold that binds to VEGFR-2.
- the non-antibody polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a reference, or "scaffold", protein, such as an Fn3 scaffold.
- the non- antibody polypeptide may bind VEGFR-2 with a K D less than 10 "6 M, or less than 10 " 7 M, less than 5xl0 "8 M, less than 10 "8 M or less than 10 "9 M.
- the unaltered reference protein either will not meaningfully bind to VEGFR-2 or will bind with a K D of greater than 10 "6 M.
- the non-antibody polypeptide may inhibit VEGF signaling, particularly where the non-antibody polypeptide has a K D of less than 5xlO "8 M, less than 10 "8 M or less than 10 "9 M, although higher K D values may be tolerated where the k 0ff is sufficiently low (e.g., less than 5xl0 "4 s "1 ).
- the immunoglobulin-like fold may be a 10 Fn3 polypeptide.
- the disclosure provides a polypeptide comprising a single domain having an immunoglobulin fold that binds to VEGFR-2.
- the polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a variable domain of an immunoglobulin.
- the polypeptide may bind VEGFR-2 with a K D less than 10 "6 M, or less than 10 "7 M, less than 5xl0 "8 M, less than 10 "8 M or less than 10 "9 M.
- the polypeptide may inhibit VEGF signaling, particularly where the polypeptide has a K D of less than 5xl0 "8 M, less than 10 "8 M or less than 10 "9 M, although higher K D values may be tolerated where the k 0ff is sufficiently low or where the k on is sufficiently high.
- a single domain polypeptide having an immunoglobulin fold derived from an immunoglobulin light chain variable domain and capable of binding to VEGFR-2 may comprise an amino acid sequence selected from the group consisting of: SEQ ID NOs:241-310.
- the disclosure provides VEGFR-2 binding polypeptides comprising the amino acid sequence of any of SEQ ID NOs:192-194.
- a PEG moiety or other moiety of interest may be covalently bound to the cysteine at position 93.
- the PEG moiety may also be covalently bonded to an amine moiety in the polypeptide.
- the amine moiety may be, for example, a primary amine found at the N- terminus of a polypeptide or an amine group present in an amino acid, such as lysine or arginine.
- the PEG moiety is attached at a position on the polypeptide selected from the group consisting of: a) the N-terminus; b) between the N- terminus and the most N-terminal beta strand or beta-like strand; c) a loop positioned on a face of the polypeptide opposite the target-binding site; d) between the C-terminus and the most C-terminal beta strand or beta-like strand; and e) at the C-terminus.
- the disclosure provides short peptide sequences that mediate VEGFR-2 binding. Such sequences may mediate VEGFR-2 binding in an isolated form or when inserted into a particular protein structure, such as an immunoglobulin or immunoglobulin-like domain.
- sequences include those disclosed as SEQ ID NOs: 1-4 and other sequences that are at least 85%, 90%, or 95% identical to SEQ ID NOs: 1-4 and retain VEGFR-2 binding activity. Accordingly, the disclosure provides substantially pure polypeptides comprising an amino acid sequence that is at least 85% identical to the sequence of any of SEQ ID NOs: 1 -4, wherein said polypeptide binds to a VEGFR-2 and competes with a VEGF species for binding to VEGFR-2.
- polypeptides examples include a polypeptide comprising an amino acid sequence that is at least 80%, 85%, 90%, 95% or 100% identical to an amino acid sequence at least 85% identical to the sequence of any of SEQ LD NOs:6-183, 186-197, and 199.
- polypeptide will inhibit a biological activity of VEGF and may bind to VEGFR-2 with a K D less than 10 "6 M, or less than 10 "7 M, less than 5x10 " 8 M, less than 10 "8 M or less than 10 "9 M.
- any of the VEGFR-2 binding polypeptides described herein may be bound to one or more additional moieties, including, for example, a moiety that also binds to VEGFR-2 (e.g., a second identical or different VEGFR-2 binding polypeptide), a moiety that binds to a different target (e.g., to create a dual- specificity binding agent), a labeling moiety, a moiety that facilitates protein purification or a moiety that provides improved pharmacokinetics. Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing.
- Moieties that tend to slow clearance of a protein from the blood include polyethylene glycol, sugars (e.g. sialic acid), and well-tolerated protein moieties (e.g., Fc fragment or serum albumin).
- the single domain polypeptide may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptide.
- Other measures of improved pharmacokinetics may include serum half- life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety.
- polyethylene glycol is employed, one or more PEG molecules may be attached at different positions in the protein, and such attachment may be achieved by reaction with amines, thiols or other suitable reactive groups.
- Pegylation may be achieved by site-directed pegylation, wherein a suitable reactive group is introduced into the protein to create a site where pegylation preferentially occurs.
- the protein is modified so as to have a cysteine residue at a desired position, permitting site directed pegylation on the cysteine.
- PEG may vary widely in molecular weight and may be branched or linear.
- the present disclosure establishes that pegylation is compatible with target binding activity of 10 Fn3 polypeptides and, further, that pegylation does improve the pharmacokinetics of such polypeptides.
- the disclosure provides pegylated forms of 10 Fn3 polypeptides, regardless of the target that can be bound by such polypeptides.
- the disclosure provides a formulation comprising any of the VEGFR-2 binding polypeptides disclosed herein.
- a formulation may be a therapeutic formulation comprising a VEGFR-2 binding polypeptide and a pharmaceutically acceptable carrier.
- a formulation may also be a combination formulation, comprising an additional active agent, such as an anti-cancer agent or an anti-angiogenic agent.
- the disclosure provides methods for using a VEGFR-2 binding protein to inhibit a VEGF biological activity in a cell or to inhibit a biological activity mediated by VEGFR-2.
- the cell may be situated in vivo or ex vivo, and may be, for example, a cell of a living organism, a cultured cell or a cell in a tissue sample.
- the method may comprise contacting said cell with any of the VEGFR-2-inhibiting polypeptides disclosed herein, in an amount and for a time sufficient to inhibit such biological activity.
- the disclosure provides methods for treating a subject having a condition which responds to the inhibition of VEGF or VEGFR-2.
- Such a method may comprise administering to said subject an effective amount of any of the VEGFR- 2 inhibiting polypeptides described herein.
- a condition may be one that is characterized by inappropriate angiogenesis.
- a condition may be a hyperproliferative condition. Examples of conditions (or disorders) suitable for treatment include autoimmune disorders, inflammatory disorders, retinopathies (particularly proliferative retinopathies), and cancers.
- VEGFR-2 inhibiting polypeptides described herein may be used for the preparation of a medicament for the treatment of a disorder, particularly a disorder selected from the group consisting of: an autoimmune disorder, an inflammatory disorder, a retinopathy, and a cancer.
- the disclosure provides methods for detecting VEGFR-2 in a sample.
- a method may comprise contacting the sample with a VEGFR-2 binding polypeptide described herein, wherein said contacting is carried out under conditions that allow polypeptide- VEGFR-2 complex formation; and detecting said complex, thereby detecting said VEGFR-2 in said sample.
- Detection may be carried out using any technique known in the art, such as, for example, radiography, immunological assay, fluorescence detection, mass spectroscopy, or surface plasmon resonance.
- the sample will often by a biological sample, such as a biopsy, and particularly a biopsy of a tumor, a suspected tumor or a tissue suspected of undergoing unwanted angiogenesis.
- the sample may be from a human or other mammal.
- the VEGFR-2 binding polypeptide may be labeled with a labeling moiety, such as a radioactive moiety, a fluorescent moiety, a chromogenic moiety, a chemiluminescent moiety, or a hapten moiety.
- the VEGFR-2 binding polypeptide may be immobilized on a solid support.
- nucleic acid comprising a nucleic acid sequence encoding a polypeptide disclosed herein.
- a nucleic acid may comprise a nucleic acid sequence encoding a polypeptide selected from the group consisting of any of SEQ LD Nos. 6-183, 186-197, 199 and 241-528.
- a nucleic acid comprises a nucleic acid sequence that hybridizes in stringent conditions to a nucleic acid sequence of SEQ ID NO: 184 and encodes a polypeptide that binds to human KDR with a KD of less than Ixl0-6M.
- nucleic acid may comprise a nucleic acid sequence selected from the group consisting of SEQ ID NO:184 and SEQ ID NO:185.
- a further aspect of the disclosure relates to an expression vector comprising a nucleic acid operably linked with a promoter, wherein the nucleic acid encodes a polypeptide disclosed herein.
- Another aspect of the disclosure relates to a cell comprising a nucleic acid disclosed herein.
- a method of producing the polypeptide that binds VEGFR-2, e.g., KDR comprising: expressing a nucleic acid encoding a polypeptide of the disclosure.
- the nucleic acid may comprise a sequence that encodes a polypeptide selected from the group consisting of any of SEQ ID Nos. 6-183, 186-197, 199 and 241-528.
- the nucleic acid comprises a sequence that hybridizes in stringent conditions to a nucleic acid sequence of SEQ LD NO: 184.
- the nucleic acid comprises a nucleic acid sequence selected from the group consisting of SEQ ID NO: 184 and SEQ ID NO: 185.
- the nucleic acid is expressed in a cell. Alternatively, the nucleic acid is expressed in a cell-free system.
- the disclosure provides discoveries that may be applicable to any 10 Fn3 polypeptide, regardless of which target the polypeptide is engineered to bind.
- the disclosure demonstrates that PEG can be used successfully to improve the pharmacokinetics of a 10 Fn3 polypeptide, while not interfering meaningfully with target binding.
- the disclosure provides pegylated 10 Fn3 polypeptides that bind to target and have improved pharmacokinetics relative to the non-pegylated polypeptide.
- the disclosure demonstrates that a deletion of the first eight amino acids of a 10 Fn3 polypeptide can increase target binding affinity.
- the disclosure provides 10 Fn3 polypeptides lacking the initial eight amino acids (amino acids numbered in reference to the sequence of SEQ LD No:5). It is understood that one or two amino acids may be added back to the deleted form of the polypeptide so as to facilitate translation and proper processing.
- the disclosure demonstrates that subcutaneous administration of a 10 Fn3 polypeptide results in a delayed release of polypeptide into the bloodstream and a decreased maximum serum concentration of the 10 Fn3 polypeptide. Accordingly, the disclosure provides methods for administering a 10 Fn3 polypeptide to a patient by a subcutaneous administration.
- This route of administration may be useful to achieve a delayed release relative to intravenous administration, and/or to decrease the maximum serum concentration of the 10 Fn3 polypeptide by at least 25% or at least 50% relative to the maximum serum concentration achieved by intravenous administration of an equal dosage.
- the administered 10 Fn3 polypeptide may be attached to a moiety that increases the serum half-life (or decreases clearance rate, or similarly affects another pharmacokinetic parameter) of the 10 Fn3 polypeptide, such as a polyethylene glycol moiety.
- the administered 10 Fn3 polypeptide comprises an amino acid sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90% identical to SEQ LD NO:5.
- the disclosure provides single domain polypeptides that bind to a preselected target protein from a first mammal and to a homolog thereof from a second mammal.
- Such single domain polypeptides are particularly useful where the first mammal is a human and the second mammal is a desirable mammal in which to conduct preclinical testing, such as a mouse, rat, guinea pig, dog, or non-human primate.
- preclinical testing such as a mouse, rat, guinea pig, dog, or non-human primate.
- the disclosure demonstrates that single domain polypeptides can be engineered to have such dual specificity, and that the dual specificity simplifies drug development by allowing testing of the same polypeptide in human cells, human subjects and animal models.
- the preselected target protein of the first mammal and the homolog thereof from the second mammal are sufficiently similar in amino acid sequence to allow generation of dual specificity polypeptides.
- the preselected target protein and the homolog from the second mammal may share at least 80%, 90%, or 95%) identity across a region of at least 50 amino acids, and optionally may share at least 80%, 90%, or 95 % identity across the entire protein sequence or across the sequence of the extracellular domain, in the case of a membrane protein.
- a single domain polypeptide with this type of dual specificity binding characteristic may comprise an immunoglobulin or immunoglobulin-like domain, and will preferably bind to both the preselected human target protein and to the homolog thereof with a dissociation constant of less than lxlO "6 M, lxlO "7 M, 5xl0 "8 M, lxlO "8 M or lxlO "9 M.
- Figures 1 A- ID are graphs and images depicting the characterization of KDR- binding single clones from Round 6 of KDR selection.
- Figure 1 A is a graph showing the specific binding of fibronectin-based binding proteins to 25 nM of KDR-Fc analyzed in radioactive equilibrium binding assay.
- Figure IB is a graph showing the inhibition of specific binding of KDR-Fc and selected fibronectin based binding proteins in the presence of 100-fold excess of VEGF ]65 .
- certain binding proteins bound KDR-Fc competitively with VEGF ⁇ 65 while others, exemplified by clone 8, did not compete with VEGF ⁇ 65 .
- Figure IC is a graph showing the inhibition of KDR-Fc interaction with immobilized VEGF ⁇ 65 in presence of selected fibronectin based binding proteins analyzed in BIAcore.
- Figure ID is an image showing binding of VR28 to KDR-expressing and control cells detected by immunofluorescence.
- Figure 2 is a graph showing the selection profile for the affinity maturation of VR28 KDR binder. Shown at left is binding of the VR28 clone to KDR-Fc and Flkl- Fc (very low, unlabeled bar). Shown at center is binding of a crude mutagenized pool and subsequent enrichment rounds to KDR-Fc. Shown at right is binding of further enrichment rounds to Flk-l-Fc.
- FIGS. 3 A and 3B are graphs depicting the characterization of KDR-binding single clones from Round 4 of anti-KDR affinity maturation of VR28 binder.
- Figure 3 A shows the saturation binding of VR28 (- ⁇ -) and affinity matured KI (-A-), K6 (- T-), K9 (- ⁇ -), K10 (-•-), K12 (-D-), K13 (- ⁇ -), K14 (-V-), K15 (-0-) to KDR-Fc in radioactive equilibrium binding assay
- Figure 3B shows the binding of clones with and without N-terminal deletion to KDR-Fc.
- FIG. 4 is a graph showing the binding of the selected clones to KDR and Flk- 1. Specific binding of VR28 and selected clones after four rounds of affinity maturation to human KDR (K clones) and seven rounds of affinity maturation to human (KDR) and mouse (flk-1) (E clones). VEGFR-2 -Fc chimeras were compared in radioactive equilibrium binding assay. The data represents an average of 3 independent experiments.
- FIGS 5 A and 5B are graphs showing the characterization of VEGFR-2 - binding single clones from Round 7 of affinity maturation of VR28 binder. Saturation binding of VR28 (- ⁇ -) and specificity matured E3 (-A-), E5 (-T-), E6 (- ⁇ -), E9 (-•- ), E18 (-D-), E19 (- ⁇ -), E25 (-V-), E26 (-0-), E28 (-0-), E29 (- X -) clones to KDR ( Figure 5 A) and Flkl ( Figure 5B)-Fc chimeras was tested in radioactive equilibrium binding assay.
- Figures 6A and 6B are graphs showing the characterization of VEGFR-2 binding by single clones from Round 7 of affinity maturation of the VR28 binder.
- Figure 6B shows the importance of all three variable loops (BC, DE and FG) of KDR fibronectin- based binding proteins for binding to the target in these proteins.
- FIGS 7A and 7B are graphs showing the binding of selected fibronectin-based binding proteins to CHO cells expressing human KDR receptor ( Figure 7A) and EpoR- Flkl chimera ( Figure 7B). E18 (- ⁇ -), E19 (-A-), E26 (-T-), E29 (- ⁇ -) and WT (-D-) fibronectin-based scaffold proteins were tested. No binding to control CHO cells was observed (data not shown).
- Figures 8 A and 8B are graphs showing the inhibition of VEGF-induced proliferation of Ba/F3-KDR ( Figure 8A) and Ba/F3-Flkl ( Figure 8B) cells, expressing KDR and Flkl in the presence of different amounts of fibronectin-based binding proteins: E18 (- ⁇ -), E19 (-A-), E26 (-T-), E29 (- ⁇ -), M5 (-•-), WT (-D-) and anti- KDR or anti-flk-1 Ab (- ⁇ -).
- the data represents an average of 2 independent experiments.
- Figure 9 is a graph showing the results of a HUVEC proliferation assay in the presence of different amounts of fibronectin-based scaffold proteins: E18 (- ⁇ -), E19 (- A-), E26 (-T-), E29 (- ⁇ -), M5 (-•-), WT (-D-).
- the data represents an average of 2 independent experiments.
- the KDR binding proteins caused a decrease in proliferation by approximately 40%.
- Figure 10 is a set of graphs showing the reversible refolding of M5FL in optimized buffer.
- Figure 11 is an image showing SDS-PAGE analysis ofpegylated forms of M5FL.
- FIG. 12 is a graph showing the inhibition of VEGF-induced proliferation of Ba/F3-KDR cells with differing amounts of M5FL (- ⁇ -), M5FL PEG20 (- ⁇ -) and M5FL PEG40(- -) , respectively. Pegylation has little or no effect on M5FL activity in this assay.
- Figure 13 shows western analysis of VEGFR-2 signaling in endothelial cells. Phospho VEGFR-2 - Visualization of phosphorylated VEGFR-2. VEGFR-2 - Sample loading control.
- FIG. 14 shows that various 10 Fn3-derived molecules (e.g. M5FL, F10, CT-01) can block VEGF-A and VEGF-D signaling.
- Figure 15 shows a comparison of ,25 I native, pegylated CT-01 administered i.v. & i.p. CT-01 is a 12 kDa protein. It is rapidly cleared from the blood. Addition of a 40 kDa PEG reduces its clearance rate and increases the AUC by 10 fold.
- CT-01 -PEG40 has an AUC that is only 50% of an i.v. administration.
- Figure 16 shows the tissue distribution of 125 I -CT01PEG40 in normal rats. Tissue distribution of 125 I-CT01PEG40 indicates secretion primarily via the liver and secondarily via the kidney. This is expected for the high molecular weight PEG form. No long term accumulation of CT-01 PEG40 is detected.
- Figure 17 is a schematic view of the Miles Assay that measures vascular permeability.
- Figure 18 shows that CT-01 blocks VEGF in vivo using the Miles Assay.
- FIG. 19 shows that CT-01 inhibits tumor growth using the B16-F10 Murine Melanoma Tumor Assay.
- Figure 20 shows that CT-01 inhibits tumor growth using U87 Human Glioblastoma.
- Figures 21 A and 2 IB show the sequences of VEGFR binding polypeptides that are based on an antibody light chain framework/scaffold (SEQ LD NOs:241-310).
- Figure 22 shows the structural organization for a single domain polypeptide having an immunoglobulin fold (a V H domain of an immunoglobulin, left side) and a single domain polypeptide having an immunoglobulin-like fold (a 10 Fn3 domain, right side).
- VEGFR-2 also called KDR in humans and Flk-1 in mice, is the primary mediator for the pro- angiogenic effects of VEGF signaling.
- VEGFR-2 is bound and activated by VEGF-A, VEGF-C and VEGF-D.
- VEGF-A vascular endothelial growth factor
- VEGF-C vascular endothelial growth factor-associated fibroblasts
- VEGF-D vascular endothelial cells
- VEGFR-2 activation stimulates cell proliferation and migration
- VEGFR-2 activation triggers angiogenesis and increases the permeability of the vasculature.
- Increased angiogenesis is well- established as an important feature of tumor growth and various retinopathies, while increased permeability of the vasculature is a significant event in many inflammatory responses.
- the present disclosure provides hundreds of single domain polypeptides that bind to VEGFR-2, many of which exhibit in vitro and/or in vivo VEGF antagonist activity. Single domain polypeptides having VEGF antagonist activity will be useful in numerous therapeutic applications.
- Anti-KDR antibodies have been established as having in vivo utility against diseases and conditions ranging from cancers and complications resulting from cancers to proliferative retinopathies, inflammatory disorders and fibrosis.
- VEGFR-2 -binding single domain polypeptides may be used in any circumstance where it is desirable to detect VEGFR-2.
- many stem cells express VEGFR-2, including particularly useful cells of hematopoietic lineages.
- KDR-binding polypeptides may be used, particularly in a labeled format, to detect stem cells and facilitate cell sorting.
- labeled VEGFR- 2-binding polypeptides may be used to image tissues in which VEGFR-2 is expressed.
- Elevated VEGFR-2 expression may be characteristic of tissues experiencing particularly high levels of angiogenic or inflammatory activity. Histological analyses of tissue samples may also benefit from detection of VEGFR-2. For example, it may be desirable to detect VEGFR-2 expression in a tumor biopsy in order to assess the likely effectiveness of an anti- VEGFR-2 or anti-VEGF therapy. Interestingly, many of the VEGFR-2 binding proteins disclosed herein bind to VEGFR-2 with nanomolar dissociation constants and yet fail to have a significant effect on VEGFR-2 mediated biological events.
- binding proteins may be useful for in vivo visualization techniques or cell-labeling techniques, where it will often be desirable to selectively label cells that express a VEGFR-2 without causing a significant perturbation of VEGFR-2 mediated events.
- This disclosure describes the use of an in vitro display technology, termed PROfusionTM, that exploits nucleic acid-protein fusions (RNA- and DNA-protein fusions) to identify novel single domain polypeptides and amino acid motifs that are important for binding to VEGFR-2.
- Nucleic acid-protein fusion technology is a display technology that covalently couples a protein to its encoding genetic information.
- PROfusionTM technology was used to screen collections of nucleic acids encoding single domain polypeptides constructed using a scaffold based on the human fibronectin type three domain ( 10 Fn3) or constructed from the variable domains of antibody light chains.
- the expressed polypeptides termed a "library" of scaffold proteins, was screened for polypeptides that could bind VEGFR-2 with high affinity.
- novel single domain polypeptides that bind to VEGFR-2 and that, in some instances, inhibit VEGF biological activities.
- many independently randomized loops situated in immunoglobulin or immunoglobulin-like scaffolds tended to converge to a related set of consensus sequences that participated in VEGFR-2 binding.
- polypeptides having these consensus sequences will be useful as VEGFR- 2 binding agents even when separated from the protein context in which they were identified. See, for example, SEQ ID Nos. 1-4.
- Such polypeptides may be used as independent, small peptide VEGFR-2 binding agents or may be situated in other proteins, particularly proteins that share an immunoglobulin or immunoglobulin-like fold.
- the present disclosure demonstrates that single domain polypeptides having certain desirable properties, such as high affinity binding to VEGFR-2, antagonist effects with respect to one or more of VEGF-A, -C or -D and improved pharmacokinetics, can be used as effective anti-cancer agents.
- ligand binding properties of an Fn3-based polypeptide will generally be determined by a relatively small number of amino acids situated in solvent accessible loop regions
- other features, such as pharmacokinetic features, of Fn3-based polypeptides will tend to be determined by the majority of the protein that is not directly involved in ligand binding and that is conserved from protein to protein regardless of the target protein. This has been the case with antibodies, where a few loops, called CDR regions, mediate antigen binding, while other features of in vivo antibody behavior are largely dictated by the conserved framework regions and constant domains.
- inhibitor is meant a measurable reduction in a phenomenon, often used herein in reference to any of the following: the interaction of VEGF with a VEGFR, VEGF- or VEGFR-mediated angiogenesis, angiogenesis, symptoms of angiogenesis, the viability of VEGFR-containing cells, the viability of VEGF-dependent Ba/F3 cells, or VEGF- or VEGFR-mediated cellular proliferation as compared to a control sample not treated with the polypeptide.
- a polypeptide will inhibit a VEGF- or VEGFR-2 mediated activity if the reduction in activity or interaction is at least 10%, preferably 20%, 30%, 40%, or 50%, and more preferably 60%, 70%, 80%, 90% or more.
- VEGF biological activity is meant any function of any VEGF family member acting through any VEGF receptor, but particularly signaling through a VEGFR-2 receptor.
- the VEGF family includes VEGF-A, VEGF-B, VEGF-C, VEGF- D, and placental growth factor (PIGF), as well as various alternatively spliced forms of VEGF including VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206 (Tischer et al., J. Biol. Chem, 266:11947-11954, 1991).
- VEGFR- 1 also known as Flt-1
- VEGFR-2 also known as KDR (human form) or Flk-1 (mouse form)
- VEGFR-3 also known as Flt-4
- VEGF ligands bind to the VEGF receptors to induce, for example, angiogenesis, vasculogenesis, endothelial cell proliferation, vasodilation, and cell migration.
- VEGF ligands can also inhibit apoptosis through binding to their cognate receptors.
- VEGFR-2 is believed to be the VEGFR most involved in angiogenesis.
- a VEGFR-2 or KDR- mediated biological activity is any biological function in which VEGFR-2 or KDR participates in significantly, such that antagonism of VEGFR-2 or KDR causes a measurable decrease in the biological activity.
- the biological activity of VEGF and VEGFR can be measured by standard assays known in the art. Examples include ligand binding assays and Scatchard plot analysis; receptor dimerization assays; cellular phosphorylation assays; tyrosine kinase phosphorylation assays (see for example Meyer et al., Ann. N.Y. Acad. Sci.
- angiogenesis can be assayed by measuring the number of non-branching blood vessel segments (number of segments per unit area), the functional vascular density (total length of perfused blood vessel per unit area), the vessel diameter, the formation of vascular channels, or the vessel volume density (total of calculated blood vessel volume based on length and diameter of each segment per unit area).
- VEGF-mediated proliferation and angiogenesis can be found in U.S.P.N. 6,559,126, Lyden et al, Nature Medicine 7:1194 (2001), Jacob et al, Exp. Pathol. 15:1234 (1978) and Bae et al, J. Biol. Chem. 275:13588 (2000).
- These assays can be performed using either purified receptor or ligand or both, and can be performed in vitro or in vivo.
- These assays can also be performed in cells using a genetically introduced or the naturally-occurring ligand or receptor or both.
- polypeptides The methodology described herein has been successfully used to develop single domain VEGFR-2 binding polypeptides derived from two related groups of protein structures: those proteins having an immunoglobulin fold and those proteins having an immunoglobulin-like fold.
- a polypeptide is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function.
- Polypeptide can include natural amino acids and non-natural amino acids such as those described in U.S.P.N. 6,559,126, incorporated herein by reference. Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy-terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life).
- an amino acid can be modified with a protecting group
- the carboxy-terminal amino acid can be made into a terminal amide group
- the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity
- the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life).
- Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D).
- the term "single domain polypeptide" is used to indicate that the target binding activity (e.g., VEGFR-2 binding activity) of the subject polypeptide is situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain. It is contemplated that a plurality of single domain polypeptides of the sort disclosed herein could be connected to create a composite molecule with increased avidity.
- a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides, such as fluorescent polypeptides, targeting polypeptides and polypeptides having a distinct therapeutic effect.
- Single domain polypeptides of either the immunoglobulin or immunoglobulin- like scaffold will tend to share certain structural features.
- the polypeptide may comprise between about 80 and about 150 amino acids, which amino acids are structurally organized into a set of beta or beta-like strands, forming beta sheets, where the beta or beta-like strands are connected by intervening loop portions. Examples of the structural organization for the heavy chain variable domain and the 10 Fn3 domain are shown in Figure 22.
- the beta sheets form the stable core of the single domain polypeptides, while creating two "faces" composed of the loops that connect the beta or beta-like strands. As described herein, these loops can be varied to create customized ligand binding sites, and, with proper control, such variations can be generated without disrupting the overall stability of the protein. In antibodies, three of these loops are the well-known Complementarity Determining Regions (or "CDRs"). Scaffolds for formation of a single domain polypeptides should be highly soluble and stable in physiological conditions.
- immunoglobulin scaffolds are the single domain V H or V L scaffold, as well as a single domain camelid V HH domain (a form of variable heavy domain found in camelids) or other immunoglobulin variable domains found in nature or engineered in the laboratory.
- an immunoglobulin polypeptide need not form a dimer with a second polypeptide in order to achieve binding activity. Accordingly, any such polypeptides that naturally contain a cysteine which mediates disulfide cross-linking to a second protein can be altered to eliminate the cysteine. Alternatively, the cysteine may be retained for use in conjugating additional moieties, such as PEG, to the single domain polypeptide.
- Other scaffolds may be non-antibody scaffold proteins.
- non-antibody scaffold protein or domain is meant a non-antibody polypeptide having an immunoglobulin-like fold.
- immunoglobulin-like fold is meant a protein domain of between about 80-150 amino acid residues that includes two layers of antiparallel beta-sheets, and in which the flat, hydrophobic faces of the two beta-sheets are packed against each other.
- fibronectin-based scaffold protein by which is meant a polypeptide based on a fibronectin type III domain (Fn3).
- Fibronectin is a large protein which plays essential roles in the formation of extracellular matrix and cell-cell interactions; it consists of many repeats of three types (types I, II, and III) of small domains (Baron et al., 1991).
- Fn3 itself is the paradigm of a large subfamily which includes portions of cell adhesion molecules, cell surface hormone and cytokine receptors, chaperoning, and carbohydrate-binding domains.
- the fibronectin-based scaffold protein is a " 10 FN3" scaffold, by which is meant a polypeptide variant based on the tenth module of the human fibronectin type III protein in which one or more of the solvent accessible loops has been randomized or mutated, particularly one or more of the three loops identified as the BC loop (amino acids 23-30), DE loop (amino acids 52-56) and FG loop (amino acids 77-87) (the numbering scheme is based on the sequence on the tenth Type III domain of human fibronectin, with the amino acids Val-Ser-Asp-Val-Pro representing amino acids numbers 1 - 5).
- the amino acid sequence of the wild-type tenth module of the human fibronectin type III domain is:
- the wild-type BC loop comprises the sequence of DAPAVTVR; the wild-type DE loop comprises the sequence of GSKST; the wild-type FG loop comprises the sequence of GRGDSPASSKP.
- the sequences flanking the BC, DE, and FG loops are also termed Frameworks 1, 2, 3, and 4, e.g., in Tables 1-3.
- a variety of improved mutant 10 Fn3 scaffolds have been identified.
- Both the variant and wild-type 10 Fn3 proteins are characterized by the same structure, namely seven beta-strand domain sequences (designated A through and six loop regions (AB loop, BC loop, CD loop, DE loop, EF loop, and FG loop) which connect the seven beta-strand domain sequences.
- the beta strands positioned closest to the N- and C-termini may adopt a beta-like conformation in solution.
- SEQ LD No:5 the AB loop corresponds to residues 15-16
- the BC loop corresponds to residues 22-30
- the CD loop corresponds to residues 39-45
- the DE loop corresponds to residues 51-55
- the EF loop corresponds to residues 60-66
- the FG loop corresponds to residues 76- 87.
- a single domain polypeptide disclosed herein may have at least five to seven beta or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta or beta-like strands, which loop portion participates in binding to VEGFR-2, particularly KDR, with the binding characterized by a dissociation constant that is less than lxlO "6 M, and preferably less than lxlO "8 M.
- polypeptides having a dissociation constant of less than 5xlO "9 M are particularly desirable for therapeutic use in vivo to inhibit VEGF signaling.
- Polypeptides having a dissociation constant of between lxlO "6 M and 5xlO "9 M may be desirable for use in detecting or labeling, ex vivo or in vivo, VEGFR-2 proteins.
- the VEGFR-2 binding protein will bind specifically to VEGFR-2 relative to other related proteins from the same species.
- specifically binds is meant a polypeptide that recognizes and interacts with a target protein (e.g., VEGFR-2) but that does not substantially recognize and interact with other molecules in a sample, for example, a biological sample.
- a polypeptide of the invention will specifically bind a VEGFR with a K D at least as tight as 500 nM.
- the polypeptide will specifically bind a VEGFR with a K D of 1 pM to 500 nM, more preferably 1 pM to 100 nM, more preferably 1 pM to 10 nM, and most preferably 1 pM to 1 nM or lower.
- a library of scaffold single domain polypeptides is screened to identify specific polypeptide variants that can bind to a chosen target. These libraries may be, for example, phage display libraries or PROfusionTM libraries.
- 10 Fn3 comprises approximately 94 amino acid residues, as shown in SEQ LD NO:5.
- amino acid sequences at the N-terminus of 10 Fn3 can also be mutated or deleted. For example, randomization of the BC, DE, and FG loops can occur in the context of a full-length 10Fn3 or in the context of a 10 Fn3 having a deletion or mutation of 1 - 8 amino acids of the N-terminus.
- the L at position 8 can be mutated to a Q.
- fibronectin-based scaffold proteins can be used in a screening assay to select for polypeptides with a high affinity for a protein, in this case the VEGFR.
- three regions of the 10 Fn3 at positions 23-29, 52-55 and 77-86 were randomized and used for in vitro selection against the extracellular domain of human VEGFR-2 (amino acids 1-764 of KDR fused to human IgGlFc).
- polypeptides that could bind to Flk-1 the mouse KDR homolog, from mutagenized populations of KDR binders that initially had no detectable binding affinity to Flk-1, resulting in the isolation of polypeptides that exhibit dual specificities to both human and mouse VEGFR-2.
- These polypeptides are shown to bind cells that display KDR or Flk-1 extracellular domains. They also inhibited cell growth in a VEGF-dependent proliferation assay.
- Polypeptides that bind to KDR and Flk-1 are shown in Table 2, while a selection of preferred KDR binders and KDR/Flk-1 binders are shown in Table 1.
- VEGFR-2 binding polypeptides such as those of SEQ LD NOs: 1-4, may be formulated alone (as isolated peptides), as part of a 10 Fn3 single domain polypeptide, as part of a full-length fibronectin, (with a full-length amino terminus or a deleted amino terminus) or a fragment thereof, in the context of an immunoglobulin (particularly a single domain immunoglobulin), in the context of another protein having an immunoglobulin-like fold, or in the context of another, unrelated protein.
- polypeptides can also be formulated as part of a fusion protein with a heterologous protein that does not itself bind to or contribute in binding to a VEGFR.
- polypeptides of the invention can also be fused to nucleic acids.
- the polypeptides can also be engineered as monomers, dimers, or multimers.
- [X can be any amino acid; ( / ) represents alternative amino acid for the same position]
- [X can be any amino acid; ( / ) represents alternative amino acid for the same position]
- [X can be any amino acid; ( / ) represents alternative amino acid for the same position]
- SEQ LD NO: 192 (A core form of the polypeptide referred to herein as CT-01):
- the CT-01 molecule above has a deletion of the first 8 amino acids and may include additional amino acids at the N- or C- termini.
- additional MG sequence may be placed at the N-terminus.
- the M will usually be cleaved off, leaving a GEV... sequence at the N-terminus.
- the re-addition of the normal 8 amino acids at the N-terminus also produces a KDR binding protein with desirable properties.
- the N- terminal methionine is generally cleaved off to yield a sequence: VSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPP TATISGLKPGVDYTITVYAVTDGRNGRLLSIPISLNYRT (SEQ LD NO: 193).
- a polypeptide disclosed herein may be modified by one or more conservative substitutions, particularly in portions of the protein that are not expected to interact with a target protein. It is expected that as many as 5%, 10%, 20% or even 30% or more of the amino acids in an immunoglobulin or immunoglobulin-like domain may be altered by a conservative substitution without substantially altering the affinity of the protein for target.
- conservative substitutions are residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.).
- conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
- Polypeptides disclosed herein may also be modified in order to improve potency, bioavailability, chemical stability, and/or efficacy.
- D-amino acid peptides, or retroenantio peptide sequences may be generated in order to improve the bioactivity and chemical stability of a polypeptide structure (see, e.g., Juwadi et al., J. Am. Chem. Soc. 118: 8989-8997, 1996; Freidinger et al., Science, 210: 656-658, 1980).
- Lactam constraints can also be utilized to improve the biological and pharmacological properties of the native peptides (see, e.g., Hanessian et al., Tetrahedron 53:12789-12854, 1997).
- Amide bond surrogates such as thioamides, secondary and tertiary amines, heterocycles among others (see review in Spatola, A. F. in "Chemistry and Biochemistry of Amino Acids, Peptides and Proteins" Wenstein, B. Ed. Marcel Dekker, New York, 1983 Vol. 7, pp 267-357) can also be utilized to prevent enzymatic degradation of the polypeptide backbone thereby resulting in improved activity.
- Conversion of linear polypeptides to cyclic polypeptide analogs can also be utilized to improve metabolic stability, since cyclic polypeptides are much less sensitive to enzymatic degradation (see generally, Veber, et al. Nature 292:55-58, 1981).
- Polypeptides can also be modified utilizing end group capping as esters and amides in order to slow or prevent metabolism and enhance hpophilicity. Dimers of the peptide attached by various linkers may also enhance activity and specificity (see for example: Y. Shimohigashi et al, in Peptide Chemistry 1988, Proceedings of the 26th Symposium on Peptide Chemistry, Tokyo, October 24-26, pgs. 47-50, 1989).
- polypeptide modifications such as non-natural amino acids
- polypeptide modifications see U.S.P.N. 6,559,126.
- a form suitable for pegylation may be generated.
- a C-terminal tail comprising a cysteine was added and expressed, as shown below for a CT-01 form lacking the eight N-terminal amino acids (ELDKPCQ is added at the C- terminus).
- GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTDGRNGRLLSLPISINYRTELDKPCQ SEQ LD NO: 194.
- the pegylated form of this molecule is used in the in vivo experiments described below.
- a control form with a serine instead of a cysteine was also used:
- the following core sequence has a somewhat different FG loop, and may be expressed with, for example, an N-terminal MG sequence, an N-terminal sequence that restores the 8 deleted amino acids, and/or a C-terminal tail to provide a cysteine for pegylation.
- EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLK PGVDYTITVYAVTEGPNERSLFIPISINYRT SEQ LD NO: 196.
- Another such variant has the core sequence:
- VSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPP TATISGLKPGVDYTITVYAVTEGPNERSLFLPISINYRT SEQ LD NO: 197.
- prefened single domain immunoglobulin polypeptides in a V L framework were isolated by similar methodology and are disclosed in Figure 21.
- a nucleic acid sequence encoding a polypeptide described herein may be modified slightly in sequence and yet still encode its respective gene product.
- the polypeptides of the present invention can be used as lead polypeptides that can be further mutated and screened for polypeptides that bind VEGFR with an even greater affinity.
- a polypeptide described herein is used as a lead polypeptide which is further mutated or randomized to produce polypeptides with amino acid mutations distinct from the lead polypeptide.
- the further randomized polypeptides can then be used to screen for polypeptides that inhibit VEGF biological activity as described herein (e.g., bind to a VEGFR and block binding of VEGF to the same receptor).
- Polypeptides of the present invention can be produced using any standard methods known in the art.
- the polypeptides are produced by recombinant DNA methods by inserting a nucleic acid sequence (e.g., a cDNA) encoding the polypeptide into a recombinant expression vector and expressing the DNA sequence under conditions promoting expression.
- a nucleic acid sequence e.g., a cDNA
- nucleic acid sequences encoding a CT-01 polypeptide disclosed herein are: SEQ LD NO: 184 atgggcgaagttgttgctgcgacccccaccagcctactgatcagctggcgccacccgcacttcccgactagatattacaggat cacttacggagaaacaggaggaatagccctgtccaggagttcactgtgcctctgcagccccccacagctaccatcagcgg ccttaaacctggagttgattataccatcactgtgtatgctgtcactgacggccggaacgggcgctctgagcatcccaatttcc attaattaccgcacagaaattgacaaaccatgccagccag SEQ LD NO: 185
- Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al., Proc Natl Acad Sci U S A. 2003 Jan 21;100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 Oct;26(l):96-105; Connell ND. Cun Opin Biotechnol. 2001 Oct;12(5):446-9; Makrides et al. Microbiol Rev. 1996 Sep;60(3):512-38; and Sharp et al. Yeast.
- Such regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
- the ability to replicate in a host, usually confened by an origin of replication, and a selection gene to facilitate recognition of transformants are additionally inco ⁇ orated.
- the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein. Examples of protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
- cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York, 1985), the relevant disclosure of which is hereby inco ⁇ orated by reference.
- the expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art.
- a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
- Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
- Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
- Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988).
- suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
- Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the prefened method for expression. The protein is then purified from culture media or cell extracts. Proteins disclosed herein can also be produced using cell- translation systems.
- the nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell- free translation system.
- VEGFR-binding polypeptides can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, IL). Modifications to the protein can also be produced by chemical synthesis.
- the polypeptide of the present invention can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry. Non-limiting examples include extraction, recrystallization, salting out
- polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
- the purified polypeptide is preferably at least 85% pure, more preferably at least 95%> pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
- the binding polypeptides of the invention may further comprise post-translational modifications.
- exemplary post-translational protein modification include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
- the modified soluble polypeptides may contain non-amino acid elements, such as lipids, poly- or mono- saccharide, and phosphates.
- a prefened fonn of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide.
- Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogeneticity of the protein. See, e.g., Raju et al. Biochemistry. 2001 Jul 31 ;40(30):8868-76. Effects of such non-amino acid elements on the functionality of a polypeptide may be tested for its antagonizing role in VEGFR-2 or VEGF function, e.g., its inhibitory effect on angiogenesis or on tumor growth.
- modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers.
- the polymer is polyethylene glycol ("PEG"), polypropylene glycol, or polyoxyalkylenes, in the manner as set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
- modified polypeptide of the invention include PEGylated M5FL and PEGylated CT-01.
- a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
- Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Pat. No. 5,932,462.
- One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini, C, et al., Bioconjugate Chem. 6 (1995) 62-69).
- PEG PEG side-chains
- the pegylated 10 Fn3 polypeptide is produced by site- directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus.
- the present disclosure provides a target-binding 10 Fn3 polypeptide with improved pharmacokinetic properties, the polypeptide comprising: a 10 Fn3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10 Fn3 domain participate in target binding; and a covalently bound PEG moiety, wherein said 10 Fn3 polypeptide binds to the target with a K D of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a mammal.
- the PEG moiety may be attached to the 10 Fn3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N- terminus of the 10 Fn3 polypeptide or between the N-terminus and the most N-terminal beta or beta-like strand or at the C-terminus of the 10 Fn3 polypeptide or between the C- terminus and the most C-terminal beta or beta-like strand.
- a Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding.
- a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
- PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski, A. et al, J. Biol. Chem., 252, 3571 (1977) and J Biol. Chem., 252, 3582 (1977), Zalipsky, et al., and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Hanis ed.) Plenum Press: New York, 1992; Chap.21 and 22).
- a binding polypeptide containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be refened to as unconjugated.
- a variety of molecular mass forms of PEG can be selected, e.g., from about
- the molecular mass of the PEG molecules does not exceed 100,000 Da. For example, if three PEG molecules are attached to a linker, where each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270), then the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
- the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
- a VEGFR-2 binding polypeptide is covalently linked to one poly(ethylene glycol) group of the formula: — CO — (CH 2 ) X — (OCH 2 CH 2 ) m — OR , with the — CO (i.e.
- an binding polypeptide's e-amino group of a lysine is the available (free) amino group.
- PEG molecules may be activated to react with amino groups on a binding polypeptide, such as with lysines (Bencham C. O. et al., Anal. Biochem., 131, 25 (1983); Veronese, F. M. et al., Appl.
- N,N' -disuccmimidylcarbonate may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a binding polypeptide (see U.S. Pat. No. 5,281,698 and U.S. Pat. No. 5,932,462).
- 1,1 '-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Pat. No. 5,382,657), respectively.
- Pegylation of a 10 Fn3 polypeptide can be performed according to the methods of the state of the art, for example by reaction of the binding polypeptide with electrophilically active PEGs (supplier: Shearwater Co ⁇ ., USA, www.shearwaterco ⁇ .com).
- PEG reagents of the present invention are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG- succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C, et al., Bioconjugate Chem. 6 (1995) 62-69).
- S uch methods may be used to pegylated at an e-amino group of a binding polypeptide lysine or the N-terminal amino group of the binding polypeptide.
- PEG molecules may be coupled to sulfhydryl groups on a binding polypeptide (Sartore, L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Mo ⁇ urgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Patent No. 5,766,897).
- 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
- the cysteine residues are native to the binding polypeptide, whereas in other embodiments, one or more cysteine residues are engineered into the binding polypeptide.
- Mutations may be introduced into an binding polypeptide coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
- Prefened amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
- the residue to be mutated to cysteine is a surface-exposed residue.
- Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
- surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (see Himanen et al., Nature. (2001) 20- 27;414(6866):933-8) and thus the surface-exposed residues identified.
- cysteine residues are introduced into binding polypeptides at or near the N- and/or C-terminus, or within loop regions.
- the pegylated binding polypeptide comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid.
- Site specific N-terminal reductive amination is described in Pepinsky et al., (2001) JPET, 297,1059, and U.S. Pat. No. 5,824,784.
- the use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Pat. No. 4,002,531, in Wieder et al., (1979) J. Biol. Chem. 254,12579, and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
- pegylated binding polypeptide comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide.
- a binding polypeptide is pegylated at the C-terminus.
- a protein is pegylated at the C-terminus by the introduction of C- terminal azido-methionine and the subsequent conjugation of a methyl-PEG- triarylphosphine compound via the Staudinger reaction.
- the steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N- terminal alpha-amine and C-terminal alpha-carboxyl.
- the polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified.
- the polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group.
- the unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent.
- the side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide.
- the number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
- the ratio of a binding polypeptide to activated PEG in the conjugation reaction can be from about 1 :0.5 to 1 :50, between from about 1:1 to 1:30, or from about 1 :5 to 1:15.
- Various aqueous buffers can be used in the present method to catalyze the covalent addition of PEG to the binding polypeptide.
- the pH of a buffer used is from about 7.0 to 9.0.
- the pH is in a slightly basic range, e.g., from about 7.5 to 8.5.
- Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
- Conventional separation and purification techniques known in the art can be used to purify PEGylated binding polypeptide, such as size exclusion (e.g. gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri- poly- and un- pegylated binding polypeptide, as well as free PEG.
- the percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition.
- About ninety percent mono- PEG conjugates represents a good balance of yield and activity.
- Compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired.
- the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
- PEGylated binding polypeptide of the invention contain one, two or more PEG moieties.
- the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts the target ligand.
- the combined or total molecular mass of PEG in PEG- binding polypeptide is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da.
- the PEG in pegylated binding polypeptide is a substantially linear, straight-chain PEG.
- the PEG in pegylated binding polypeptide is not hydrolyzed from the pegylated amino acid residue using a hydroxylamine assay, e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature, and is thus stable.
- a hydroxylamine assay e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature
- greater than 80% of the composition is stable mono- PEG-binding polypeptide, more preferably at least 90%, and most preferably at least 95%.
- the pegylated binding polypeptides of the invention will preferably retain at least 25%, 50%, 60%, 70%least 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
- biological activity refers to its ability to bind to VEGFR-2, as assessed by KD, k on or k off .
- the pegylated binding polypeptide protein shows an increase in binding to VEGFR relative to unpegylated binding polypeptide.
- the serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide.
- the PEG-modified polypeptide may have a half- life (t ⁇ /2 ) which is enhanced relative to the half-life of the unmodified protein.
- the half-life of PEG- binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400%) or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide.
- the protein half-life is determined in vitro, such as in a buffered saline solution or in serum.
- the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
- the present invention features methods for treating conditions or preventing pre-conditions which respond to an inhibition of VEGF biological activity.
- Prefened examples are conditions that are characterized by inappropriate angiogenesis.
- Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan.
- regulatory agencies require that a protein reagent to be used as a therapeutic is formulated so as to have acceptably low levels of pyrogens.
- therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency (e.g., FDA).
- compositions of the present invention may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form. Administration may be parenteral (e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples.
- any gene therapy technique using nucleic acids encoding the polypeptides of the invention, may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
- the composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, subcutaneous or parenteral administration; gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration.
- Methods well known in the art for making formulations are found, for example, in "Remington: The Science and Practice of Pharmacy” (20th ed., ed. A.R. Gennaro AR., 2000, Lippincott Williams & Wilkins, Philadelphia, PA).
- Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
- Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene-polyoxypropylene copolymers may be used to control the release of the compounds.
- Nanoparticulate formulations e.g., biodegradable nanoparticles, solid lipid nanoparticles, liposomes
- Other potentially useful parenteral delivery systems include ethylene- vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
- concentration of the compound in the formulation varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
- the polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry.
- acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like.
- Metal complexes include zinc, iron, and the like.
- the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
- Formulations for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients. These excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti-adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
- excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti-adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils,
- Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
- a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered. The exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques.
- the polypeptide is administered at about 0.01 ⁇ g/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg/kg per day.
- the polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or less frequently (e.g., once every other day, once or twice weekly, or monthly).
- adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
- VEGFR-2 binding proteins described herein and their related variants are useful in a number of therapeutic and diagnostic applications. These include the inhibition of the biological activity of VEGF by competing for or blocking the binding to a VEGFR-2 as well as the delivery of cytotoxic or imaging moieties to cells, preferably cells expressing VEGFR-2.
- the small size and stable structure of these molecules can be particularly valuable with respect to manufacturing of the drug, rapid clearance from the body for certain applications where rapid clearance is desired or formulation into novel delivery systems that are suitable or improved using a molecule with such characteristics.
- the polypeptides of the invention are effective against a number of conditions associated with inappropriate angiogenesis, including but not limited to autoimmune disorders (e.g., rheumatoid arthritis, inflammatory bowel disease or psoriasis); cardiac disorders (e.g., atherosclerosis or blood vessel restenosis); retinopathies (e.g., proliferative retinopathies generally, diabetic retinopathy, age-related macular degeneration or neovascular glaucoma), renal disease (e.g., diabetic nephropathy, malignant nephrosclerosis, thrombotic microangiopathy syndromes; transplant rejection; inflammatory renal disease; glomerulonephritis; mesangioproliferative glomerulonephritis; haemolytic-uraemic syndrome; and hypertensive nephrosclerosis); hemangioblastoma; hemangiomas; thyroid
- the VEGFR-binding polypeptides of the invention can be used for the treatment of prevention of hype ⁇ roliferative diseases or cancer and the metastatic spread of cancers.
- cancers include bladder, blood, bone, brain, breast, cartilage, colon kidney, liver, lung, lymph node, nervous tissue, ovary, pancreatic, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, or vaginal cancer. Additional treatable conditions can be found in U.S.P.N. 6,524,583, herein inco ⁇ orated by reference.
- VEGFR-2 binding polypeptides include: McLeod DS et al., Invest Ophthalmol Vis Sci. 2002 Feb;43(2):474-82; Watanabe et al. Exp Dermatol. 2004 Nov;13(l 1):671-81; Yoshiji H et al., Gut. 2003 Sep;52(9): 1347-54; Verheul et al., Oncologist. 2000;5 Suppl 1 :45-50; Boldicke et al., Stem Cells. 2001;19(l):24-36.
- angiogenesis-associated diseases include, but are not limited to, angiogenesis-dependent cancer, including, for example, solid tumors, blood born tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; inflammatory disorders such as immune and non-immune inflammation; chronic articular rheumatism and psoriasis; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis; Osier- Webber Syndrome; myocardial angiogenesis; plaque neovascularization; telangiectasia; hemophiliac joints; angiofibroma; and wound granulation and wound healing; telangiectasia ps
- a VEGFR-2 binding polypeptide can be administered alone or in combination with one or more additional therapies such as chemotherapy radiotherapy, immunotherapy, surgical intervention, or any combination of these. Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
- one or more polypeptide therapeutic agents can be administered, together (simultaneously) or at different times
- polypeptide therapeutic agents can be administered with another type of compounds for treating cancer or for inhibiting angiogenesis.
- the subject therapeutic agents of the invention can be used alone.
- the subject agents may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor).
- proliferative disorders e.g., tumor
- methods can be used in prophylactic cancer prevention, prevention of cancer recunence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
- the present invention recognizes that the effectiveness of conventional cancer therapies (e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery) can be enhanced through the use of a subject polypeptide therapeutic agent.
- a wide anay of conventional compounds have been shown to have anti- neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone manow malignancies.
- chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
- a polypeptide therapeutic agent of the present invention When a polypeptide therapeutic agent of the present invention is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may be found to enhance the therapeutic effect of the anti-neoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
- Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, geni
- chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthra
- pharmaceutical compounds that may be used for combinatory anti-angiogenesis therapy include: (1) inhibitors of release of "angiogenic molecules," such as bFGF (basic fibroblast growth factor); (2) neutralizers of angiogenic molecules, such as an anti-/3bFGF antibodies; and (3) inhibitors of endothelial cell response to angiogenic stimuli, including collagenase inhibitor, basement membrane turnover inhibitors, angiostatic steroids, fungal-derived angiogenesis inhibitors, platelet factor 4, thrombospondin, arthritis drugs such as D- penicillamine and gold thiomalate, vitamin D analogs, alpha-interferon, and the like.
- angiogenic molecules such as bFGF (basic fibroblast growth factor)
- neutralizers of angiogenic molecules such as an anti-/3bFGF antibodies
- inhibitors of endothelial cell response to angiogenic stimuli including collagenase inhibitor, basement membrane turnover inhibitors, angiostatic steroids, fungal-derived angiogenesis inhibitors, platelet factor 4,
- angiogenesis there are a wide variety of compounds that can be used to inhibit angiogenesis, for example, endostatin protein or derivatives, lysine binding fragments of angiostatin, melanin or melanin-promoting compounds, plasminogen fragments (e.g., Kringles 1-3 of plasminogen), tropoin subunits, antagonists of vitronectin ov/3 3 , peptides derived from Saposin B, antibiotics or analogs (e.g., tetracycline, or neomycin), dienogest-containing compositions, compounds comprising a MetAP-2 inhibitory core coupled to a peptide, the compound EM- 138, chalcone and its analogs, and naaladase inhibitors.
- endostatin protein or derivatives lysine binding fragments of angiostatin, melanin or melanin-promoting compounds
- plasminogen fragments e.g., Kringles 1-3 of plasminogen
- the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
- the VEGFR-2 binding proteins described herein can also be detectably labeled and used to contact cells expressing VEGFR-2 for imaging applications or diagnostic applications.
- the polypeptide of the invention is preferably immobilized on a solid support.
- Prefened solid supports include columns (for example, affinity columns, such as agarose-based affinity columns), microchips, or beads.
- a biological sample such as serum or a tissue biopsy, from a patient suspected of having a condition characterized by inappropriate angiogenesis is contacted with a detectably labeled polypeptide of the invention to detect levels of VEGFR-2.
- the levels of VEGFR-2 detected are then compared to levels of VEGFR-2 detected in a normal sample also contacted with the labeled polypeptide.
- An increase of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% in the levels of the VEGFR-2 may be considered a diagnostic indicator of a condition characterized by inappropriate angiogenesis.
- the VEGFR-2 binding polypeptides of the invention are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
- the active moiety may be a radioactive agent, such as: radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or manganese, positron emitters of oxygen, nitrogen, iron, carbon, or gallium, 43 K, 52 Fe, 57 Co, 67 Cu, 67 Ga, 68 Ga, 123 1, 125 I, ,3I I, 132 I, or 99 Tc.
- a binding agent affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected.
- the localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography.
- Immunoscintigraphy using VEGFR-2 binding polypeptides directed at VEGFR may be used to detect and/or diagnose cancers and vasculature. For example, any of the binding polypeptide against the VEGFR-2 marker labeled with "Technetium, ⁇ 'indium, or 125 Iodine may be effectively used for such imaging.
- compositions according to the present invention useful as imaging agents comprising a targeting moiety conjugated to a radioactive moiety comprise 0.1-100 millicuries, in some embodiments preferably 1- 10 millicuries, in some embodiments preferably 2-5 millicuries, in some embodiments more preferably 1-5 millicuries.
- the VEGFR-2 binding polypeptides of the present invention can also be used to deliver additional therapeutic agents (including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds) to a cell or tissue expressing VEGFR-2.
- the VEGFR-2 binding polypeptide is fused to a chemotherapeutic agent for targeted delivery of the chemotherapeutic agent to a tumor cell or tissue expressing VEGFR-2.
- the VEGFR-2 binding polypeptides of the present invention are useful in a variety of applications, including research, diagnostic and therapeutic applications. For instance, they can be used to isolate and/or purify receptor or portions thereof, and to study receptor structure (e.g., conformation) and function.
- the various binding polypeptides of the present invention can be used to detect or measure the expression of VEGFR-2, for example, on endothelial cells (e.g., venous endothelial cells), or on cells transfected with a VEGFR-2 gene.
- endothelial cells e.g., venous endothelial cells
- cells transfected with a VEGFR-2 gene e.g., venous endothelial cells
- they also have utility in applications such as cell sorting and imaging (e.g., flow cytometry, and fluorescence activated cell sorting), for diagnostic or research pu ⁇ oses.
- the binding polypeptides of fragments thereof can be labeled or unlabeled for diagnostic pu ⁇ oses.
- diagnostic assays entail detecting the formation of a complex resulting from the binding of a binding polypeptide to VEGFR-2.
- the binding polypeptides or fragments can be directly labeled, similar to antibodies.
- labels can be employed, including, but not limited to, radionuclides, fluorescers, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors and ligands (e.g., biotin, haptens).
- ligands e.g., biotin, haptens.
- Numerous appropriate immunoassays are known to the skilled artisan (see, for example, U.S. Pat. Nos. 3,817,827; 3,850,752; 3,901,654; and 4,098,876).
- the binding polypeptides can be used in assays, such as agglutination assays.
- Unlabeled binding polypeptides can also be used in combination with another (one or more) suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
- a suitable reagent which can be used to detect the binding polypeptide
- the binding polypeptides of the present invention can be utilized in enzyme immunoassays, wherein the subject polypeptides are conjugated to an enzyme.
- a sample containing cells expressing a VEGFR protein is combined with the subject antibodies, and binding occurs between the binding polypeptides and cells bearing a VEGFR-2 protein recognized by the binding polypeptide.
- VEGFR protein e.g., endothelial cells
- binding polypeptides and cells bearing a VEGFR-2 protein recognized by the binding polypeptide can be separated from unbound reagents and the presence of the binding polypeptide-enzyme conjugate specifically bound to the cells can be determined, for example, by contacting the sample with a substrate of the enzyme which produces a color or other detectable change when acted on by the enzyme.
- the subject binding polypeptides can be unlabeled, and a second, labeled polypeptide (e.g., an antibody) can be added which recognizes the subject binding polypeptide.
- kits for use in detecting the presence of a VEGFR-2 protein in a biological sample can also be prepared.
- Such kits will include an VEGFR-2 binding polypeptide which binds to a VEGFR-2 protein or portion of said receptor, as well as one or more ancillary reagents suitable for detecting the presence of a complex between the binding polypeptide and the receptor protein or portions thereof.
- the polypeptide compositions of the present invention can be provided in lyophilized form, either alone or in combination with additional antibodies specific for other epitopes.
- the binding polypeptides and/or antibodies which can be labeled or unlabeled, can be included in the kits with adjunct ingredients (e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin).
- adjunct ingredients e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin.
- the binding polypeptides and/or antibodies can be provided as a lyophilized mixture with the adjunct ingredients, or the adjunct ingredients can be separately provided for combination by the user.
- these adjunct materials will be present in less than about 5% weight based on the amount of active binding polypeptide or antibody, and usually will be present in a total amount of at least about 0.001%) weight based on polypeptide or antibody concentration.
- the present invention also relates to a method of detecting and/or quantitating expression of VEGFR-2 , wherein a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted with a binding polypeptide which binds to a VEGFR-2 or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored.
- a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted with a binding polypeptide which binds to a VEGFR-2 or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored.
- Binding of a polypeptide to the cell can be determined by standard methods, such as those described in the working examples.
- the method can be used to detect expression of VEGFR-2 on cells from an individual.
- a quantitative expression of VEGFR-2 on the surface of endothelial cells can be evaluated, for instance, by flow cytometry, and the staining intensity can be conelated with disease susceptibility, progression or risk.
- the present invention also relates to a method of detecting the susceptibility of a mammal to certain diseases.
- the method can be used to detect the susceptibility of a mammal to diseases which progress based on the amount of VEGFR- 2 present on cells and/or the number of VEGFR-2-positive cells in a mammal.
- the invention relates to a method of detecting susceptibility of a mammal to a tumor.
- a sample to be tested is contacted with a binding polypeptide which binds to a VEGFR-2 or portion thereof under conditions appropriate for binding thereto, wherein the sample comprises cells which express VEGFR-2 in normal individuals.
- the binding and/or amount of binding is detected, which indicates the susceptibility of the individual to a tumor, wherein higher levels of receptor conelate with increased susceptibility of the individual to a tumor.
- Example 1 Initial identification of KDR binding molecules A library of approximately 10 13 RNA-protein fusion variants was constructed based on the scaffold of the tenth type 3 domain of human fibronectin with three randomized regions at positions 23-29, 52-55 and 77-86 (amino acid nos. are referenced to SEQ ID NO:5) (three loop library; Xu et al, Chemistry & Biology 9:933- 942, 2002). Similar libraries were constructed containing randomized regions only at positions 23-29 and 77-86 (two loop library) or only at positions 77-86 (one loop library).
- VR28 also appeared to bind to KDR-expressing recombinant CHO cells, but not to control CHO cells ( Figure ID).
- the sequence of the binding loops of the VR28 clone is shown in the first row of Table 4. While VR28 was not the most abundant clone in the sequenced binding population (one copy out of 28 sequenced clone), its binding affinity to KDR was the best among the tested clones from this binding population, with a dissociation constant of 11 -13 nM determined in a radioactive equilibrium binding assay ( Figure 3 and Table 5) and BIAcore assays (Table 7).
- Example 2 Affinity Maturation of Clone VR28 A mutagenesis strategy focusing on altering sequences only in the binding loops was employed. To initially test which loops were more likely to result in improvement, loop-directed hypermutagenic PCR was carried out to introduce up to 30% mutations independently into each loop of VR28. After three rounds of selection against KDR, multiple clones with improved binding to KDR-Fc were observed. Sequence analysis of the selection pools revealed that the majority of mutations were accumulated in the FG loop while the BC and DE loops remained almost intact. This result indicated that the FG loop was the most suitable target for further modification.
- Example 3 Selection of binders with dual specificities to human (KDR) and mouse (Flk-1) VEGFR-2. VR28 and most of the affinity matured variants (K clones) failed to bind the mouse homolog of KDR, Flkl, as shown in Figure 4. However, since KDR and Flkl share a high level of sequence identity (85%, Claffey et al., J. Biol. Chem. 267:16317- 16322 (1992), Shima et al., J. Biol. Chem. 271 :3877-3883 (1996)), it is conceivable to isolate antibody mimics that can bind both KDR and Flkl .
- R79 and R82 appear to be particularly important for high affinity binding to Flk- 1, since binding to Flk-1, but not KDR, is greatly reduced when a different residue is present at this position (Figure 6A).
- the loops of clones E6 and E26 shown in Table 4 were substituted one loop at a time by NNS randomized sequence.
- Figure 6B after the substitution, the proteins are no longer able to bind either KDR or Flk-1.
- the ERNGR motif found in Flk-1 binding molecules selected from a mutagenized population of VR28, was also present in multiple clones derived from clone 159Q(8)L mutagenesis and selection, despite a full randomization of this region of the FG loop. The isolation of similar binding molecules from two independent libraries suggests that the affinity maturation process is robust for isolating optimal Flk-1 binding motifs located in the FG loop.
- Example 4 Cell surface binding and neutralization of VEGF activity in vitro
- the functionality of KDR and Flk-1 binding molecules in a cell culture model system was evaluated with E. coli produced binding molecules.
- E. coli produced binding molecules.
- a detection system consisting of anti-His6 tag murine antibody (the E. coli expressed proteins were expressed with a His tag) and an anti-murine fluorescently labeled antibody the binding molecules were shown to bind specifically to mammalian cells expressing KDR or Flk- 1 with low nanomolar EC50s, ( Figure 7 and Table 8).
- HUVEC cells are natural human cells that are closely related to cells in the body that respond to VEGF. As shown in Figure 9 and Table 10, the fibronectin-based binding proteins were also active in inhibiting VEGF activity in this human-derived cell system while the wild type fibronectin-based scaffold protein was inactive.
- Example 5 Thermal Stability and Reversible Refolding of M5FL Protein The thermal stability of KDR-binder M5FL was established using differential scanning calorimetry (DSC). Under standard PBS buffer conditions (sodium phosphate pH 7.4, 150 mM NaCl), M5FL was found to have a single non-reversible thermal melting transition at 56°C. Subsequently, sodium acetate pH 4.5 was identified as a favorable buffer for M5FL protein solubility.
- DSC differential scanning calorimetry
- Example 6 In Vitro Binding and Cell-Based Activity of PEGylated M5FL Protein
- the M5FL protein was produced in an E. coli expression system with a C- terminal extension to yield the following protein sequence (C-terminal extension underlined with CyslOO shaded; a significant percentage of protein is produced with the initial methionine removed):
- the single sulfhydryl of the cysteine residue at position 100 was used to couple to PEG variants using standard maleimide chemistry to yield two different PEGylated forms of M5FL.
- Both a linear 20 kD PEG and a branched 40 kD PEG (Shearwater Co ⁇ oration) were conjugated to M5FL to produce M5FL-PEG20 and M5FL-PEG40, respectively.
- the PEGylated protein forms were purified from unreacted protein and PEG by cation exchange chromatography. Covalent linkage of the two PEG forms of M5FL was verified by SDS-PAGE ( Figure 11) and mass spectroscopy. In vitro affinity measurements were made using surface plasmon resonance
- the k on , o ff and K D were analyzed for a subset of KDR-binding polypeptides and compared to the EC50 for the BaF3 cell-based VEGF inhibition assay. Scatter plots showed that the kon was well-conelated with the EC50, while koff was poorly conelated. Greater than 90% of KDR-binding proteins with a kon of 105s- 1 or greater had an EC50 of lOnM or less. KD is a ratio of kon and koff, and, as expected, exhibits an intermediate degree of conelation with EC50. Many of the KDR-binding proteins, including CT-01, were assessed for binding to VEGFR- 1 , VEGFR-2 and VEGFR-3. The proteins showed a high degree of selectivity for VEGFR-2.
- Example 6 Preparation of KDR Binding Protein CT-01 Blocks VEGFR-2 Signaling in Human Endothelial Cells. Following the methodologies described in the preceding Examples, additional
- CT-01 Fn3-based KDR binding proteins were generated. As described for the development of the M5FL protein in Example 5, above, proteins were tested for K D against human KDR and mouse Flk-1 using the BIAcore binding assay and for IC50 in a Ba/F3 assay. A protein termed CT-01 exhibited desirable properties in each of these assays and was used in further analysis.
- the initial clone from which CT-01 was derived had a sequence: GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTDGWNGRLLSLPISINYRT (SEQ LD NO:200).
- the FG loop sequence is underlined.
- Affinity maturation as described above produced a core form of CT-01 is underlined.
- the CT-01 molecule above has a deletion of the first 8 amino acids and may include additional amino acids at the N- or C- termini.
- additional MG sequence may be placed at the N-terminus.
- the M will usually be cleaved off, leaving a GEV... sequence at the N-terminus.
- the re-addition of the normal 8 amino acids at the N-terminus also produces a KDR binding protein with desirable properties.
- the N- terminal methionine is generally cleaved off to yield a sequence: VSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPP TATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRT (SEQ LD NO: 193).
- a form suitable for PEGylation may be generated.
- a C-terminal tail comprising a cysteine was added and expressed, as shown below for a form lacking the eight N-terminal amino acids.
- GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTDGIWGRLLSiPISINYRTELDKPCO SEQ ID NO: 194.
- the PEGylated form of this molecule is used in the in vivo experiments described below.
- a control form with a serine instead of a cysteine was also used:
- GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIDKPSO (SEQ LD NO: 195).
- the same C-terminal tails may also be added to CT-01 forms having the N- terminal eight amino acids, such as is shown in SEQ LD NO: 193. Additional variants with desirable KDR binding properties were isolated.
- the following core sequence has a somewhat different FG loop, and may be expressed with, for example, an N-terminal MG sequence, an N-terminal sequence that restores the 8 deleted amino acids, and or a C-terminal tail to provide a cysteine for PEGylation.
- VSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPP TATISGLKPGVDYTITVYAVTEGPNERSLFLPISINYRT (SEQ LD NO: 197).
- a comparison of these variants shows a consensus sequence for the FG loop of: D/E)GXNXRXXLP (SEQ JD NO:3).
- the consensus sequence may be expressed as (D/E)G(R/P)N(G/E)R(S/L)(S/F)LP (SEQ ID NO:4).
- Example 7 CT-01 Blocks VEGFR-2 Signaling in Human Endothelial Cells.
- VEGF-A signaling through VEGFR-2 is mediated by phosphorylation of the intracellular domain of VEGFR-2, followed by activation of pathway involving phospho lipase C gamma (PLC ⁇ ), Protein Kinase C (PKC), Raf-1, MEK1/2, ERK1/2, leading to endothelial cell proliferation.
- PLC ⁇ phospho lipase C gamma
- PKC Protein Kinase C
- Raf-1 Raf-1
- MEK1/2 MEK1/2
- ERK1/2 ERK1/2
- Total cell lysates were analyzed by SDS-PAGE and western analysis, using antibodies specific to phospho-VEGFR-2, non-phospho-VEGFR-2, phosphor-ERKl/2 and non-phospho-ERKl/2.
- 130 pM CT-01 inhibits formation of phosphor- VEGFR- 2 and also decreases the formation of the downstream phosphorylated ERKl/2.
- Phosphorylated ERKl/2 is not entirely eliminated, probably due to the fact that ERKl/2 receives signals from a number of additional signaling pathways.
- VEGFR-2 is a receptor for three VEGF species, VEGF-A, VEGF-C and VEGF- D.
- VEGF-A vascular endothelial growth factor
- VEGF-C vascular endothelial growth factor-D
- VEGF- D vascular endothelial growth factor-D
- Experiments were conducted to evaluate the effects of fibronectin-based KDR binding proteins on VEGF-A and VEGF-D mediated signaling through KDR.
- a Ba/F3 cell line dependent on Flk-1 mediated signaling was generated.
- cell viability could be maintained by treating the cells with VEGF-A or VEGF-D, although significantly higher levels of VEGF-D were required.
- VEGF-A As shown in the middle panel of Figure 14, cells were maintained in the presence of 15 ng/ml of VEGF-A and contacted with the M5FL or CT-01 proteins disclosed herein, or with the DC- 101 anti-Flk-1 antibody. Each reagent reversed the VEGF-A-mediated cell viability, indicating that VEGF-A signaling through Flk-1 was blocked. As shown in the right panel of Figure 14, cells were maintained in the presence of 300 ng/ml of VEGF-D and contacted with the M5FL or F10 proteins disclosed herein, or with an anti-VEGF- A antibody. M5FL and F10 reversed the VEGF-D- mediated cell viability, indicating that VEGF-D signaling through Flk-1 was blocked. The anti- VEGF-A antibody had no effect, demonstrating the specificity of the assay.
- Example 9 Pharmacokinetics Pharmacokinetic Studies: Native CT-01 or a pegylated form (40 kDa PEG, CT- 01 PEG40) were iodinated with 125 I. 10-20 mCi of iodinated proteins were injected into adult male rats either i.v. or i.p. and iodinated proteins levels were determined at the indicated times. For tissue distribution studies, rats were sacrificed at 15 min, 2 hr and 6 hr and radioactivity levels determined. See Figures 15 and 16. Unmodified CT-01 is a 12 kDa protein that is rapidly cleared from the blood.
- the area-under-curve value (AUC) value is 14.6 hr*mg/mL with a clearance of 69.9 mL/hr/kg, a maximum serum concentration of 9.1 mg/ml.
- the initial half-life (a) is 0.3 hours and the second phase half-life ( ⁇ ) is 13.5 hours.
- i.v. PEGylated CT-01 has greatly increased presence in the blood, mostly because of a dramatic decrease in the initial phase of clearance.
- the AUC is increased greater than 10 fold to 193, the clearance rate is decreased by greater than 10 fold to 5.2, the Cmax is 12.9 mg/mL.
- the half-life is increased to 1 hour, and the ⁇ is increased to 16.2 hours.
- Intraperitoneal (i.p.) administration of PEGylated CT-01 had reservoir-like pharmacokinetics. There was no initial spike in the blood concentration of CT-01. Instead, the amount of CT-01 built up more slowly and decreased slowly. Such pharmacokinetics may be desirable where there is concern about side effects from the initial spike in CT-01 concentration upon intravenous administration. It is likely that other 10 FN3-based agents would exhibit similar behavior in i.p. administration. Accordingly, this may be a generalizable mode for achieving a time-delayed dosing effect with 10 FN3 -based agents.
- Example 10 In Vivo Efficacy of CT-01
- the Miles assay as outlined in Figure 17, is used to evaluate Dose, Schedule and Administration parameters for the tumor efficacy studies.
- Balb/c female mice were injected i.p. with buffer or CT-01PEG40 at 1, 5 and 20 mg/kg 4 hr prior to VEGF challenge.
- Intradermal focal administration of VEGF-A into the back skin induces vessel leakage of Evans blue dye ( Figure 17 and 18).
- mice treated with a KDR binding agent showed a statistically significant decrease in the level of VEGF-mediated vessel leakage. Both 5mg/kg and 20mg/kg dosages with CT-01 showed significant results. Therefore, a 5mg/kg dosage was selected for mouse tumor model studies.
- Example 11 CT-01 Inhibits Tumor Growth
- B16-F10 Murine Melanoma Tumor Assay 2x 10 6
- B 16-F 10 murine melanoma tumor cells were implanted subcutaneously into C57/BL male mice at Day 1. At day 6 a palpable mass was detected. On day 8 when tumors were of measurable size, daily i.p. injections of either Vehicle control, 5, 15, or 40 mg/kg CT-01PEG40 were started. The lowest dose 5 mg/kg decreased tumor growth. At day 18, mice treated with 15 and 40 mg/kg showed 50 % and 66% reduction in tumor growth. See Figure 19.
- U87 Human Glioblastoma Assay 5 xlO 6 U87 human glioblastoma tumor cells were implanted subcutaneously into nude male mice. When tumor volume reached approximately 50 mm3 treatment started (day 0). Vehicle control, 3, 10, or 30 mg/kg CT-01PEG40 were injected i.v. every other day (EOD). The anti-Flk-1 antibody DC101 was injected at 40 mg/kg twice a week as published for its optimal dose schedule. The lowest dose 3 mg/kg decreased tumor growth. At day 12, mice treated with 10 and 30 mg/kg showed 50 % reduction in tumor growth. See Figure 20. Effectiveness is comparable to that of the anti-Flk-1 antibody.
- Recombinant proteins Recombinant human VEGF ⁇ 65 , murine VEGF I M, human neurotrophin-4 (NT4), human and mouse vascular endothelial growth factor receptor-2 Fc chimeras (KDR-Fc and Flk-l-Fc) were purchased from R&D systems (Minneapolis, MN). Biotinylation of the target proteins was carried out in lxPBS at 4 °C for 2 hours in the presence of EZ- LinkTM Sulfo-NHS-LC-LC-Biotin (Pierce, IL).
- Primers The following oligonucleotides were prepared by chemical synthesis for eventual use in library construction and mutagenesis of selected clones.
- T7 TMV Fn 5' GCG TAA TAC GAC TCA CTA TAG GGA CAA TTA CTA TTT ACA ATT ACA ATG GTT TCT GAT GTT CCG AGG 3' (SEQ LD NO:201)
- T7 TMV N-terminus deletion 5' GCG TAA TAC GAC TCA CTA TAG GGA CAA TTA CTA TTT ACA ATT ACA ATG GAA GTT GTT GCT GCG ACC CCC ACC AGC CTA 3' (SEQ JD NO:202)
- MK165-4 A20 5' TTT TTT TTT TTT TTT TTA AAT AGC GGA TGC CTT GTC GTC GTC GTC CTT GTA GTC 3' (SEQ ID NO:203)
- N-terminus forward 5' ATG GTT TCT GAT GTT CCG AGG GAC CTG GAA GTT GTT GCT GCG ACC CCC ACC AGC CTA CTG ATC AGC TGG 3' (SEQ LD NO:204)
- C-terminus polyA 5 ' TTT TTT TTT TTT TTT TTT TAA ATA GCG GAT GCC TTG TCG TCG TCG TCC TTG TAG TCT GTT CGG TAA TTA ATG GAA AT 3' (SEQ ID NO:209)
- Hu3'FLAGSTOP 5' TTT TAA ATA GCG GAT GCC TTG TCG TCG TCG TCC TTG TAG TCT GTT CGG TAA TTA ATG G 3 ' (SEQ LD NO:210)
- F1U2 5' TAA TAC GAC TCA CTA TAG GGA CAA TTA CTA TTT ACA ATT CTA TCA ATA CAA TGG TGT CTG ATG TG CCG 3' (SEQ LD NO:212)
- F3159 5' ACC TCC CTG CTG ATC TCC TGG CGC CAT CCG CAT TTT CCG ACC CGC TAT TAC CGC ATC ACT TAC G 3' (SEQ ID NO:214)
- F4 5' CAC AGT GAA CTC CTG GAC CGG GCT ATT GCC TCC TGT TTC GCC GTAAGT GAT GCG GTAATA GCG 3' (SEQ ID NO:215)
- F5-X5 5' CG GTC CAG GAG TTC ACT GTG CCGNNS NNS NNS NNS NNS GCT ACC ATC AGC GGC CTTAAACC 3' (SEQ IDNO:217)
- F7X6159 5' ACC ATC ACT GTG TAT GCT GTC ACT NNS NNS NNS NNS NNS NNS GAA CTG TTT ACC CCA ATT TCC ATC AAC TAC CGC ACA GAC TAC AAG3'(SEQLDNO:219)
- C2asaiA20 5' TTT TTT TTT TTT TTT TTT TTA AAT AGC GGA TGC GCG TTT GTT CTG ATC TTC 3' (SEQ LD NO:221)
- hfOl BC reverse 5' TGCC TCC TGT TTC GCC GTA AGT GAT GCG GTA ATA
- BCDE rev 5 ' CCT CCT GTT TCT CCG TAA GTG 3 ' (SEQ LD NO:226)
- BCDEfor 5' CAC TTA CGG AGA AAC AGG AGG 3' (SEQ ID NO:227)
- 5-RI-hKDR-lB 5' TAG AGA ATT CAT GGA GAG CAA GGT GCTG 3' (SEQ LD NO:231)
- 5-RI-mKDR-l 5' TAG AGA ATT CAT GGA GAG CAA GGC GCT G 3' (SEQ LD NO:233)
- 3-EPO/mKDR-2312 5' AGG GAG AGC GTC AGG ATG AGT TCC AAG TTG GTC TTT TCC 3' (SEQ ED NO:234)
- 5-hKDR/EPO-2274B 5' GGA AAA GAC GAA CTT GGA ACT CAT CCT GAC GCT CTC CCT 3' (SEQ LD NO:237)
- 5-mKDR EPO-2274 5' GGA AAA GAC CAA CTT GGA ACT CAT CCT GAC GCT CTC CCT 3' (SEQ ID NO:238)
- 5'hTrkB/EpoR-1274 5' TAA AAC CGG TCG GGA ACA TCT CAT CCT GAC GCT CTC CCT 3' (SEQ LD NO:240)
- Buffers The following buffers were utilized in the experiments described herein. Buffer A (100 mM TrisHCl, IM NaCl, 0.05% Tween-20, pH 8.0); Buffer B (IX PBS, 0.02% Triton X100); Buffer C (100 mM TrisHCl, 60 mM EDTA, IM NaCl, 0.05% Triton X100, pH 8.0); Buffer Ca (100 mM TrisHCl, IM NaCl, 0.05% Triton X100, pH 8.0); Buffer D (2M NaCl, 0.05% Triton); Buffer E (IX PBS, 0.05% Triton X100, pH 7.4); Buffer F (IX PBS, 0.05% Triton X100, 100 mM imidazole, pH 7.4); Buffer G (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1
- Mutagenic library construction Hypermutagenic PCR. Scaffold mutation T(69)I in VR28 clone was corrected back to wild type sequence by PCR (see below) and no change in binding characteristics of VR28 binder to KDR was observed. Mutations were introduced into the loop regions of VR28 using conditions described previously (Vartanian et al, Nwc. Acid Res. 24:2627-2631, 1996). Three rounds of hypermutagenic PCR were conducted on a VR28 template using primer pairs flanking each loop ( ⁇ -terminus forward/ BCDE reverse, BCDE forward/ DEFG reverse, DEFG forward/ C-terminus polyA). The resulting fragments were assembled using overlap extension and PCR with flanking primers T7TMV Fn and MK165-4 A20.
- Primer F7X6159 contained NNS at each of the first 6 coding positions of Clone 159 (Q8L) and was otherwise identical to Clone 159 (Q8L). Conect assembly of the library 159 (Q8L)-FGX6 was confirmed by DNA sequencing of clones from the final PCR reaction.
- the sub-library contained -lxl 0 9 clones.
- PR6 post round 6
- the F5X5 primer contained NNS at the four positions of the DE loop as well as at position 56. Then, the extended fragments ab and cd were combined and amplified for 20 cycles without any additional components.
- VR28 in the text was constructed using primers T7TMV Fn and MK165-4 A20.
- TTTMV Fn and MK165-4 A20 Introduction of deletion ⁇ l-8 into the N-terminus of fibronectin-based scaffold proteins was performed by amplification using primers T7 TMV N-terminus deletion and MK165-4 A20. Construction of the chimeras of E clones containing NNS loop sequences was performed by two-step PCR.
- Loop regions were amplified using primers T7 TMV N- terminus deletion/ BCDE rev (a: BC loop of E clones); N-terminus forward/ hfOl BC reverse (b: BC NNS); BCDE for/ Front FG reverse (c: DE loop of E clones); BCDE for/ hfOl DE reverse (d: DE NNS); hfOl DE-FG forward/ hfOl RT-Flag PolyA reverse (e: FG of E clones); hfOl DE-FG forward/ hfOl FG reverse (f: FG NNS).
- RNA-protein fusion production For each round of selection PCR DNA was transcribed using MegaScript transcription kit (Ambion) at 37°C for 4 hours. Template DNA was removed by DNase I (Ambion) digestion at 37°C for 20 minutes. RNA was purified by phenol/chloroform extraction followed by gel filtration on a NAP-25 column (Amersham).
- the linker was annealed to the library RNA in 0.1 M NaCl, 25 mM TrisHCl, pH 7.0, by gradient temperature decrease from 85°C to 4°C.
- the linker and RNA were then cross linked by exposing to UV light (365 nm) for 15 minutes.
- the cross-linked mixture 600 pmol RNA was included in an in vitro translation reaction using rabbit reticulocyte lysate translation kit (Ambion) in the presence of 35 S-labeled methionine at 30°C for 60 minutes.
- 0.5 M KCl and 0.05 M MgCl 2 were added to the reaction and incubated for 30 minutes at 4°C.
- Fusion molecules were purified using oligo-dT cellulose (Sigma) chromatography as follows.
- the translation and fusion mix was diluted into buffer A (100 mM TrisHCl, IM NaCl, 0.05% Tween-20, pH 8.0) and added to oligo dT cellulose.
- the sluny was rotated at 4°C for 1 hour and transfened to a spin column.
- Oligo dT cellulose beads were washed on the column with 10 column volumes of buffer A and eluted with 3 column volumes of H 2 O.
- Reverse transcription reaction was conducted with Superscript II Reverse Transcription kit (Invitrogen) for 1 hour at 42°C using primer Hu3 'FLAGSTOP.
- NTCB 2-nitro-5- thiocyanatobenzoic acid
- NEM N-ethylmaleimide
- RNA-protein fusion was prepared using a streamlined, semi-automated procedure in a KingfisherTM (ThermoLabSystems). The steps were similar to the procedure described above except for several steps described below.
- RNA-protein fusion molecules were prepared in buffer C (100 mM TrisHCl, 60 mM EDTA, IM NaCl, 0.05% Triton X100, pH 8.0) on magnetic oligo dT beads (GenoVision). The beads were washed with 10 reaction volumes of buffer Ca (100 mM TrisHCl, IM NaCl, 0.05% Triton X100, pH 8.0) and fusion proteins were eluted with one volume of H 2 O. Reverse transcription (RT) was conducted using primer C2RT. Fusion proteins were further purified by His-tag affinity chromatography using Ni-NTA magnetic beads (Qiagen).
- the RT reaction was incubated with Ni-NTA beads in buffer D (2M NaCl, 0.05% Triton) for 20 minutes at room temperature, the beads were then washed with 10 reaction volumes of buffer E (IX PBS, 0.05%) Triton X100, pH 7.4) and fusion molecules were eluted with one volume of buffer F (IX PBS, 0.05% Triton X100, 100 mM imidazole, pH 7.4).
- buffer D 2M NaCl, 0.05% Triton
- KDR-Fc Final concentrations of KDR-Fc were 250 nM for Round 1, 100 nM for rounds 2 - 4 and 10 nM for rounds 5 and 6.
- the target was captured on 300 ⁇ l of Protein A beads (Round 1) or 100 ⁇ l of Protein A beads (Rounds 2-6)for 30 minutes at 30°C with end-over-end rotation and beads were washed 5 times with 1 ml of buffer G (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, pH 7.4).
- Bound fusion molecules were eluted with 100 ⁇ l of 0.1 M KOH into 50 ⁇ l of 1 M TrisHCl, pH 8.0.
- DNA was amplified from elution by PCR using flanking primers T7TMV Fn and MK165-4 A20. Affinity and specificity maturation of KDR binder VR28. Clone VR28 was mutagenized by hypermutagenic PCR or oligo-directed mutagenesis as described above and fusion sub-libraries were constructed. Following pre-clear with Protein A beads selection was performed in buffer I (IxPBS, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4) for four rounds according to procedure described above. DNA was amplified from elution by PCR using primers T7TMV Fn and MK165-4 A20.
- buffer I IxPBS, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4
- DNA from the final elution pool was subjected to DE loop randomization (see above) and fusion sub-library was selected against 7 nM mouse VEGF-R2 for three rounds. At the fourth round an off-rate selection was applied with re-binding to 1 nM human VEGF-R2. Final DNA was amplified from elution by PCR using primers F1U2 and C2asaiA20.
- Radioactive Equilibrium Binding Assay To prepare 35 S-labeled binding proteins for analysis, mRNA was prepared as described above for RNA-protein fusion production but the linker ligation step was omitted. The mRNA was expressed using rabbit reticulocyte lysate translation kit
- VEGF-R2-Fc fusions in concentrations ranging from 0 to 200 nM were added to a constant concentration of the purified protein (0.2 or 0.5 nM) and incubated at 30°C for 1 hour in buffer B.
- the receptor-binder complexes were captured using Protein A magnetic beads for another 10 minutes at room temperature using a KingfisherTM. The beads were washed with six reaction volumes of buffer B.
- the protein was eluted from the beads with 100 ⁇ L of 0.1 M KOH. 50 ⁇ L of the reaction mixture and elution were dried onto a LumaPlate-96 (Packard) and the amount of S on the plate was measured using a TopCount NXT instrument (Packard). The amount of fibronectin-based scaffold protein bound to the target was estimated as a percent of radioactivity eluted from Protein A magnetic beads compare to radioactivity in the reaction mixture. Nonspecific binding of fibronectin-based scaffold proteins to the beads was determined by measuring binding in the absence of KDR-Fc and represented less than 1-2% of the input. Specific binding was obtained through subtraction of nonspecific binding from total binding. Data was analyzed using the GraphPad Prizm software (GraphPad Software, Inc, San Diego, CA), fitted using a one site, non-linear binding equation.
- soluble fibronectin-based scaffold protein binders For expression in E. coli residues 1-101 of each clone followed by the His 6 tag were cloned into a pET9d-derived vector and expressed in E. coli BL21 (DE3) pLysS cells (Invitrogen). 20 ml of overnight culture was used to inoculate 1 liter of LB medium containing 50 ⁇ g/mL kanamycin and 34 ⁇ g/mL chloromphenicol. The culture was grown at 37 °C until A 60 o 0.4-0.6.
- TALONTM SuperflowTM Metal Affinity Resin (Clontech) pre-equilibrated with wash buffer L (50 mM NaH 2 PO 4 , 0.5 M NaCl, 5% glycerol, 25 mM imidazole, pH 8.0). The resin was then washed with 10 column volumes of buffer L and 30 column volumes of buffer M (IxPBS, pH 7.4, 25 mM imidazole, pH 7.4). Protein was eluted with 5 column volumes of buffer N (IxPBS, 250 mM imidazole, pH 7.4) and dialyzed against IxPBS at 4 °C. Any precipitate was removed by filtering at 0.22 ⁇ m (Millipore).
- BIAcore analysis of the soluble fibronectin-based scaffold proteins The binding kinetics of fibronectin-based scaffold proteins binding proteins to the target was measured using BIAcore 2000 biosensor (Pharmacia Biosensor). Human and mouse VEGF-R2-Fc fusions were immobilized onto a CM5 sensor chip and soluble binding proteins were injected at concentrations ranging from 0 to 100 nM in buffer O (10 mM HEPES, 150 mM NaCl, 0.005% Tween 20, pH 7.4).
- DSC Differential scanning calor ⁇ metry
- M5FL with the Ser at position 100 mutated to a Cysteine including the additional C- terminal His-tag used to purify the protein.
- the purified M5FL-C100 protein was modified at the single cysteine residue by conjugating various maleimide-derivatized PEG forms (Shearwater). The resulting reacted proteins were run on a 4-12%> polyacrylamide gel ( Figure 11).
- Plasmid construction Plasmids, encoding chimeric receptors composed of the transmembrane and cytoplasmic domains of the human erythropoietin receptor (EpoR) fused to the extracellular domains of KDR, Flk-1, or human TrkB were constructed by a two-step PCR procedure. PCR products encoding the extracellular domains were amplified from plasmids encoding the entire receptor gene: KDR (amino acids 1 to 764) was derived from clone PR1371_H11 (OriGene Technologies, Rockville, MD) with primers 5-RI-hKDR-lB/ 3-EPO/hKDR-2312B.
- flk-1 (amino acids 1 to 762) was derived from clone #4238984 (IMAGE) with primers 5-RI-mKDR-l/ 3-EPO/mKDR- 2312, and human TrkB (from amino acids 1 to 430) from clone #X75958 (Invitrogen Genestorm) with primers 5-RI-hTrkB-l/ 3-EpoR/hTrkB-l 310.
- PCR products encoding the EpoR transmembrane and cytoplasmic domains were amplified from clone #M60459 (Invitrogen Genestorm) with the common primer 3 ⁇ XHO-EpoR-3066 and one of three gene-specific primers 5-hKDR EPO-2274B (KDR), 5-mKDR/EPO-2274 (flk-1), and 5'hTrkB/EpoR-1274 (human TrkB), which added a short sequence complementary to the end of the receptor fragment PCR product.
- KDR 5-hKDR EPO-2274B
- flk-1 5-mKDR/EPO-2274
- 5'hTrkB/EpoR-1274 human TrkB
- PCR products encoding the two halves of the chimeric genes were mixed and amplified with 3-XHO-EpoR-3066 and the 5' primers (5-RI-hKDR-lB. 5-RI-mKDR-l. and 5-RI-hTrkB-l) specific for each gene used in the previous cycle of amplification.
- the resulting PCR products were digested with EcoRI and Xh ⁇ and cloned into pcDNA3.1(+) (Invitrogen) to generate the plasmids phK ⁇ 8 (human KDR/EpoR fusion), pmKE2 (flk-1 /EpoR fusion), and phTE (TrkB/EpoR fusion).
- CHO-K1 cells American Type Culture Collection, Manassas, VA
- Lipofectamine 2000 Invitrogen
- pcDNA 3.1 Invitrogen
- pmKE2 a mixture of pcDNA 3.1 and a plasmid encoding full-length human KDR
- Stable transfectants were selected and maintained in the presence of 0.5 mg/ml of Geneticin (Invitrogen).
- the human KDR-expressing clone designated CHO- KDR and the murine VEGFR-2/EpoR-chimera-expressing population designated CHO- Flk were obtained by fluorescence activated cell sorting of the transfected population following staining with an anti-KDR polyclonal antiserum (R&D Systems).
- CHO- KDR and CHO-Flk cell lines were grown routinely in Dulbecco's modified Eagle's medium (DMEM; Gibco) supplemented with 10% (v/v) fetal bovine serum (FBS), 0.5 mg/ml Geneticin, 100 U/ml penicillin, 0.25 ⁇ g/ml amphotericin B, 100 ⁇ g/ml streptomycin and 2 mM L-glutamine. Construction of Ba/F3 cell lines. Cell lines that would proliferate in response to
- VEGF binding by VEGFR-2 were constructed by transfection of the murine pre-B cell line Ba/F3 (DSMZ, Braunschweig, Germany) with phKE8 or pmKE2, receptor chimeras consisting of the extracellular domains of human or murine VEGFR-2 fused to the transmembrane and cytoplasmic domains of the human erythropoietin receptor (see above).
- Ba/F3 cells were maintained in minimal Ba/F3 medium (RPMI- 1640 (Gibco) containing 10% FBS, 100 U/ml penicillin, 0.25 ⁇ g/ml amphotericin B, 100 ⁇ g/ml streptomycin and 2 mM L-glutamine) supplemented with 10% conditioned medium from WEHI-3B cells (DSMZ; grown in Iscove's modified Dulbecco's medium (Gibco)/ 10%FBS/ 25 ⁇ M /3-mercaptoethanol) as a source of essential growth factors. Following electroporation with the plasmids pmKE2 or phKE8, stable transfectants were selected in 0.75 mg/ml Geneticin.
- VEGF-dependent populations were transfened to minimal Ba/F3 medium containing 100 ng/ml of human VEGF ]65 (R&D Systems), and the resulting VEGF-dependent populations were designated Ba/F3-Flk and Ba/F3-KDR.
- fibronectin-based scaffold proteins Binding of fibronectin-based scaffold protein to cell-surface KDR and Flk-1 was analyzed simultaneously on VEGF-R2-expressing and control cells by flow cytometry.
- CHO-pcDNA3 cells control were released from their dishes with trypsin- EDTA, washed in Dulbecco's PBS without calcium and magnesium (D-PBS " ; Invitrogen), and stained for 30 minutes at 37 °C with 1.5 ⁇ M CMTMR (5-(and-6)-(((4- chloromethyl)benzoyl)amino) -tetramethylrhodamine) (Molecular Probes).
- the cells were washed in D-PBS " and incubated for a further 30 minutes at 37 °C, and then resuspended in blocking buffer (D-PBS710% fetal bovine serum) on ice.
- blocking buffer D-PBS710% fetal bovine serum
- CHO-KDR or CHO-Flk cells were treated identically except that CMTMR was omitted. 75,000 of CMTMR-stained CHO-pcDNA3 cells were mixed with an equal number of unstained CHO-KDR or CHO-Flk cells in each well of a V-bottom 96-well plate. All antibodies and fibronectin-based scaffold proteins were diluted in 25 ⁇ l/well of blocking buffer, and each treatment was conducted for 1 hour at 4 °C.
- Ba F3 Cell Proliferation Assay Ba/F3 cells were washed three times in minimal Ba/F3 medium and resuspended in the same medium containing 15.8 ng/ml of proliferation factor (human VEGF ⁇ 65 , murine VEGF 164 , or hNT-4 for Ba F3-KDR, Ba/F3-Flk, or Ba/F3-TrkB cells, respectively), and 95 ⁇ l containing 5 x 10 4 Ba F3-KDR cells or 2 x 10 4 Ba F3-Flk or Ba/F3-TrkB cells were added per well to a 96-well tissue culture plate.
- proliferation factor human VEGF ⁇ 65 , murine VEGF 164 , or hNT-4 for Ba F3-KDR, Ba/F3-Flk, or Ba/F3-TrkB cells, respectively
- HUVEC Cell Proliferation Assay HUVEC cells (Clonetics, Walkersville, MD) from passage 2-6 were grown in EGM-2 medium (Clonetics). 5000 cells/well were resuspended in 200 ⁇ l starvation medium (equal volumes of DMEM (Gibco) and F-12K medium (ATCC), supplemented with 0.2%) fetal bovine serum and lx penicillin streptomycin/ fungizone solution (Gibco)), plated in 96-well tissue culture plates and incubated for 48 hours. Fibronectin-based binding proteins were added to the wells and incubated for 1 hour at 37°, and then human VEGF ⁇ 65 was added to a final concentration of 16 ng/ml.
- cell viability was measured by addition of 30 ⁇ l/well of a mixture of 1.9 mg/ml CellTiter96® AQueous MTS reagent (Promega) with 44 ⁇ g/ml phenazine methosulfate (Sigma) and measurement of absorbance at 490 nm as described above for Ba/F3 cells.
- FIGS. 21 A and 2 IB show amino acid sequences of VEGFR binding polypeptides (SEQ ID NOs:241-310) based on an antibody light chain variable region (VL) framework/scaffold.
- Light chain variable domain proteins were generated using the PROfusionTM system, as described above for use with 10 Fn3-derived proteins.
- Table 5 Affinities of the trinectin binders to KDR-Fc determined in radioactive equilibrium binding assay Clone KDR (Kd, nM) VR28 11.0+0.5 K1 ⁇ 0.6+0.1 K6 ⁇ 0.9+0.1 K9 ⁇ 1.8+0.4 K10 ⁇ 0.6+0.1 K12 ⁇ 0.6+0.1 K13 O.6+0.1 K14 O.6+0.1 K15 O.4+0.1
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- Pulmonology (AREA)
- Ophthalmology & Optometry (AREA)
- Diabetes (AREA)
- Dermatology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Endocrinology (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cardiology (AREA)
Abstract
Description
Claims
Priority Applications (15)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA002552435A CA2552435A1 (en) | 2003-12-05 | 2004-12-06 | Inhibitors of type 2 vascular endothelial growth factor receptors |
EP04813230A EP1711196A4 (en) | 2003-12-05 | 2004-12-06 | Inhibitors of type 2 vascular endothelial growth factor receptors |
MXPA06006406A MXPA06006406A (en) | 2003-12-05 | 2004-12-06 | Inhibitors of type 2 vascular endothelial growth factor receptors. |
JP2006542876A JP5006651B2 (en) | 2003-12-05 | 2004-12-06 | Inhibitor of type 2 vascular endothelial growth factor receptor |
BRPI0417302-3A BRPI0417302A (en) | 2003-12-05 | 2004-12-06 | type 2 vascular endothelial growth factor receptor inhibitors |
AU2004296376A AU2004296376B2 (en) | 2003-12-05 | 2004-12-06 | Inhibitors of type 2 vascular endothelial growth factor receptors |
IL176135A IL176135A0 (en) | 2003-12-05 | 2006-06-05 | Inhibitors of type 2 vascular endothelial growth factor receptors |
US11/448,171 US7858739B2 (en) | 2003-12-05 | 2006-06-05 | Inhibitors of type 2 vascular endothelial growth factor receptors |
US11/482,641 US7847062B2 (en) | 2003-12-05 | 2006-07-07 | Pharmacokinetic modulation and compositions for modified FN3 polypeptides |
US11/894,045 US20080220049A1 (en) | 2003-12-05 | 2007-08-17 | Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins |
US12/788,240 US8324362B2 (en) | 2003-12-05 | 2010-05-26 | Nucleic acid encoding 10FN3 polypeptide inhibitors of Type 2 vascular endothelial growth factor receptors |
US13/552,398 US8609613B2 (en) | 2003-12-05 | 2012-07-18 | Methods of inhibiting type 2 vascular endothelial growth factor receptors using polypeptides |
US14/071,069 US9328157B2 (en) | 2003-12-05 | 2013-11-04 | Inhibitors of type 2 vascular endothelial growth factor receptors |
US15/070,572 US9862758B2 (en) | 2003-12-05 | 2016-03-15 | Inhibitors of type 2 vascular endothelial growth factor receptors |
US15/826,196 US10995131B2 (en) | 2003-12-05 | 2017-11-29 | Libraries of modified fibronectin type III tenth domain-containing polypeptides |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US52788603P | 2003-12-05 | 2003-12-05 | |
US60/527,886 | 2003-12-05 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10195405A Continuation | 2003-12-05 | 2005-04-07 | |
US11/448,171 Continuation US7858739B2 (en) | 2003-12-05 | 2006-06-05 | Inhibitors of type 2 vascular endothelial growth factor receptors |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2005056764A2 true WO2005056764A2 (en) | 2005-06-23 |
WO2005056764A3 WO2005056764A3 (en) | 2006-05-11 |
Family
ID=34676785
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2004/040885 WO2005056764A2 (en) | 2003-12-05 | 2004-12-06 | Inhibitors of type 2 vascular endothelial growth factor receptors |
Country Status (14)
Country | Link |
---|---|
US (7) | US7858739B2 (en) |
EP (1) | EP1711196A4 (en) |
JP (2) | JP5006651B2 (en) |
KR (1) | KR20060129246A (en) |
CN (1) | CN1946417A (en) |
AU (1) | AU2004296376B2 (en) |
BR (1) | BRPI0417302A (en) |
CA (1) | CA2552435A1 (en) |
IL (1) | IL176135A0 (en) |
MX (1) | MXPA06006406A (en) |
RU (1) | RU2402567C2 (en) |
SG (1) | SG149004A1 (en) |
TW (1) | TW200531979A (en) |
WO (1) | WO2005056764A2 (en) |
Cited By (143)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7078490B2 (en) | 1997-06-12 | 2006-07-18 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
US7195880B2 (en) | 1998-12-02 | 2007-03-27 | Adnexus Therapeutics, Inc. | DNA-protein fusions and uses thereof |
WO2007136103A1 (en) * | 2006-05-18 | 2007-11-29 | Eisai R & D Management Co., Ltd. | Antitumor agent for thyroid cancer |
EP1943521A2 (en) * | 2005-11-02 | 2008-07-16 | Bayer HealthCare LLC | Methods for prediction and prognosis of cancer, and monitoring cancer therapy |
WO2008097497A2 (en) | 2007-02-02 | 2008-08-14 | Adnexus, A Bristol-Myers Squibb R & D Company | Vegf pathway blockade |
WO2009025806A2 (en) * | 2007-08-20 | 2009-02-26 | Adnexus, A Bristol-Myers Squibb R & D Company | Use of vegfr-2 inhibitors for treating metastatic cancer |
WO2008066752A3 (en) * | 2006-11-22 | 2009-03-05 | Adnexus A Bristol Meyers Squib | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir |
WO2009073115A1 (en) * | 2007-11-28 | 2009-06-11 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with mtor inhibitors |
WO2009102421A2 (en) | 2008-02-14 | 2009-08-20 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind egfr |
WO2009133208A1 (en) | 2008-05-02 | 2009-11-05 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
WO2010060748A1 (en) * | 2008-11-03 | 2010-06-03 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
WO2010070094A1 (en) | 2008-12-19 | 2010-06-24 | Glaxo Group Limited | Myostatin binding proteins |
EP2215246A2 (en) * | 2007-10-31 | 2010-08-11 | MedImmune, LLC | Protein scaffolds |
WO2010093771A1 (en) * | 2009-02-11 | 2010-08-19 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with temozolomide |
WO2010097386A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
WO2010097385A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
WO2010097394A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Multivalent and/or multispecific rankl-binding constructs |
US7838541B2 (en) | 2002-02-11 | 2010-11-23 | Bayer Healthcare, Llc | Aryl ureas with angiogenesis inhibiting activity |
US20110008345A1 (en) * | 2007-11-30 | 2011-01-13 | Claire Ashman | Antigen-binding constructs |
WO2011012646A2 (en) | 2009-07-28 | 2011-02-03 | F. Hoffmann-La Roche Ag | Non-invasive in vivo optical imaging method |
US7897623B2 (en) | 1999-01-13 | 2011-03-01 | Bayer Healthcare Llc | ω-carboxyl aryl substituted diphenyl ureas as p38 kinase inhibitors |
WO2011051327A2 (en) | 2009-10-30 | 2011-05-05 | Novartis Ag | Small antibody-like single chain proteins |
WO2011051466A1 (en) | 2009-11-02 | 2011-05-05 | Novartis Ag | Anti-idiotypic fibronectin-based binding molecules and uses thereof |
US7973160B2 (en) | 2000-10-20 | 2011-07-05 | Eisai R&D Management Co., Ltd. | Nitrogen-containing aromatic derivatives |
WO2011092233A1 (en) | 2010-01-29 | 2011-08-04 | Novartis Ag | Yeast mating to produce high-affinity combinations of fibronectin-based binders |
WO2011094259A2 (en) | 2010-01-28 | 2011-08-04 | Glaxo Group Limited | Cd127 binding proteins |
WO2011138462A1 (en) | 2010-05-07 | 2011-11-10 | F. Hoffmann-La Roche Ag | Diagnostic method for the detection of cells ex vivo |
US8058474B2 (en) | 2003-11-11 | 2011-11-15 | Eisai R&D Management Co., Ltd. | Urea derivative and process for preparing the same |
WO2011151432A1 (en) | 2010-06-03 | 2011-12-08 | Glaxo Group Limited | Humanised antigen binding proteins to myostatin6 |
US8124630B2 (en) | 1999-01-13 | 2012-02-28 | Bayer Healthcare Llc | ω-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors |
EP2441447A1 (en) | 2008-05-06 | 2012-04-18 | Glaxo Group Limited | Encapsulation of biologically active agents |
WO2012069557A1 (en) | 2010-11-24 | 2012-05-31 | Glaxo Group Limited | Multispecific antigen binding proteins targeting hgf |
WO2012069433A2 (en) | 2010-11-23 | 2012-05-31 | Glaxo Group Limited | Antigen binding proteins |
US8221765B2 (en) | 2008-05-22 | 2012-07-17 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
US8258265B2 (en) | 2002-06-06 | 2012-09-04 | Research Corporation Technologies, Inc. | Reconstituted polypeptides |
US8263741B2 (en) | 2000-07-11 | 2012-09-11 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
WO2012140627A1 (en) | 2011-04-15 | 2012-10-18 | Compugen Ltd. | Polypeptides and polynucleotides, and uses thereof for treatment of immune related disorders and cancer |
US20120270797A1 (en) * | 2009-08-13 | 2012-10-25 | Massachusetts Institute Of Technology | Engineered proteins including mutant fibronectin domains |
WO2012158678A1 (en) | 2011-05-17 | 2012-11-22 | Bristol-Myers Squibb Company | Methods for maintaining pegylation of polypeptides |
US8343501B2 (en) | 2008-11-24 | 2013-01-01 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
WO2013059886A1 (en) | 2011-10-28 | 2013-05-02 | Patrys Limited | Pat-lm1 epitopes and methods for using same |
JP2014074064A (en) * | 2007-06-22 | 2014-04-24 | Hanmei Xu | Inhibitor of angiogenesis, and method of manufacturing the same, method of modifying the same and its application in manufacture of antineoplastic |
WO2014072306A1 (en) | 2012-11-08 | 2014-05-15 | F. Hoffmann-La Roche Ag | Her3 antigen binding proteins binding to the beta-hairpin of her3 |
EP2696203A3 (en) * | 2007-08-16 | 2014-05-28 | The Royal Institution for the Advancement of Learning/McGill University | Tumor cell-derived microvesicles |
US8796250B2 (en) | 2003-05-20 | 2014-08-05 | Bayer Healthcare Llc | Diaryl ureas for diseases mediated by PDGFR |
US8853154B2 (en) | 2012-09-13 | 2014-10-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US8969379B2 (en) | 2004-09-17 | 2015-03-03 | Eisai R&D Management Co., Ltd. | Pharmaceutical compositions of 4-(3-chloro-4-(cyclopropylaminocarbonyl)aminophenoxy)-7=methoxy-6-quinolinecarboxide |
US8969289B2 (en) | 2010-05-03 | 2015-03-03 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
WO2015089585A1 (en) | 2013-12-18 | 2015-06-25 | Csl Limited | Method of treating wounds |
US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
US9212231B2 (en) | 2010-04-13 | 2015-12-15 | Medimmune, Llc | TRAIL R2-specific multimeric scaffolds |
WO2016054315A1 (en) | 2014-10-01 | 2016-04-07 | Medimmune, Llc | Method of conjugating a polypeptide |
WO2016059602A2 (en) | 2014-10-16 | 2016-04-21 | Glaxo Group Limited | Methods of treating cancer and related compositions |
US9328157B2 (en) | 2003-12-05 | 2016-05-03 | Bristol-Myers Squibb Company | Inhibitors of type 2 vascular endothelial growth factor receptors |
US9388222B2 (en) | 2013-10-06 | 2016-07-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Modified Pseudomonas exotoxin A |
US9416170B2 (en) | 2011-10-31 | 2016-08-16 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US9469676B2 (en) | 2011-04-13 | 2016-10-18 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
US9562089B2 (en) | 2010-05-26 | 2017-02-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
WO2017055398A2 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for a costimulatory tnf receptor |
WO2017055404A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for pd1 and tim3 |
WO2017060144A1 (en) | 2015-10-07 | 2017-04-13 | F. Hoffmann-La Roche Ag | Bispecific antibodies with tetravalency for a costimulatory tnf receptor |
WO2017167672A1 (en) | 2016-03-29 | 2017-10-05 | F. Hoffmann-La Roche Ag | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
US9803008B2 (en) | 2013-11-28 | 2017-10-31 | Csl Limited | Method of treating diabetic nephropathy by administering antibodies to vascular endothelial growth factor B (VEGF-B) |
EP3243832A1 (en) | 2016-05-13 | 2017-11-15 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer and pd1 binding moiety |
WO2017194442A1 (en) | 2016-05-11 | 2017-11-16 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer and a tenascin binding moiety |
WO2018050902A2 (en) | 2016-09-15 | 2018-03-22 | Quadrucept Bio Limited | Multimers, tetramers & octamers |
WO2018053597A1 (en) | 2016-09-23 | 2018-03-29 | Csl Limited | Coagulation factor binding proteins and uses thereof |
US9945862B2 (en) | 2011-06-03 | 2018-04-17 | Eisai R&D Management Co., Ltd. | Biomarkers for predicting and assessing responsiveness of thyroid and kidney cancer subjects to lenvatinib compounds |
WO2018127473A1 (en) | 2017-01-03 | 2018-07-12 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-4-1bb clone 20h4.9 |
US10065987B2 (en) | 2013-02-12 | 2018-09-04 | Bristol-Myers Squibb Company | High pH protein refolding methods |
WO2018178076A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
WO2018178074A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules specific for a costimulatory tnf receptor |
WO2018178055A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
WO2018185043A1 (en) | 2017-04-05 | 2018-10-11 | F. Hoffmann-La Roche Ag | Bispecific antibodies specifically binding to pd1 and lag3 |
WO2018185045A1 (en) | 2017-04-04 | 2018-10-11 | F. Hoffmann-La Roche Ag | Novel bispecific antigen binding molecules capable of specific binding to cd40 and to fap |
US10167335B2 (en) | 2012-02-13 | 2019-01-01 | Agency For Science, Technology And Research | IL-1β neutralizing human monoclonal antibodies |
US10259791B2 (en) | 2014-08-28 | 2019-04-16 | Eisai R&D Management Co., Ltd. | High-purity quinoline derivative and method for manufacturing same |
WO2019086499A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Novel tnf family ligand trimer-containing antigen binding molecules |
WO2019086500A2 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Bispecific 2+1 contorsbodies |
EP3489256A1 (en) | 2014-11-14 | 2019-05-29 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer |
WO2019104385A1 (en) | 2017-11-29 | 2019-06-06 | Csl Limited | Method of treating or preventing ischemia-reperfusion injury |
EP3502140A1 (en) | 2017-12-21 | 2019-06-26 | F. Hoffmann-La Roche AG | Combination therapy of tumor targeted icos agonists with t-cell bispecific molecules |
US10352935B2 (en) | 2007-08-16 | 2019-07-16 | The Royal Institution For The Advancement Of Learning/Mcgill University | Tumor cell-derived microvesicles |
US10370455B2 (en) | 2014-12-05 | 2019-08-06 | Immunext, Inc. | Identification of VSIG8 as the putative VISTA receptor (V-R) and use thereof to produce VISTA/VSIG8 agonists and antagonists |
US10442851B2 (en) | 2014-03-20 | 2019-10-15 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
WO2019197600A1 (en) | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
US10517861B2 (en) | 2013-05-14 | 2019-12-31 | Eisai R&D Management Co., Ltd. | Biomarkers for predicting and assessing responsiveness of endometrial cancer subjects to lenvatinib compounds |
WO2020007817A1 (en) | 2018-07-04 | 2020-01-09 | F. Hoffmann-La Roche Ag | Novel bispecific agonistic 4-1bb antigen binding molecules |
US10568934B2 (en) | 2012-05-07 | 2020-02-25 | Allergan, Inc. | Method of treating AMD in patients refractory to anti-VEGF therapy |
WO2020070041A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-fap clone 212 |
WO2020070035A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules with trivalent binding to cd40 |
WO2020127618A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted agonistic cd28 antigen binding molecules |
WO2020127628A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted superagonistic cd28 antigen binding molecules |
EP3693394A1 (en) | 2011-05-27 | 2020-08-12 | Glaxo Group Limited | Antigen binding proteins |
US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
US10766946B2 (en) | 2015-09-23 | 2020-09-08 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
EA036055B1 (en) * | 2010-04-13 | 2020-09-21 | Бристол-Майерс Сквибб Компани | Use of a polypeptide that binds pcsk9 for treating atherosclerosis or hypercholesterolemia |
US10781254B2 (en) | 2010-03-26 | 2020-09-22 | The Trustees Of Dartmouth College | VISTA regulatory T cell mediator protein, VISTA binding agents and use thereof |
WO2020187711A1 (en) | 2019-03-19 | 2020-09-24 | Quadrucept Bio Limited | Multimers |
US10787498B2 (en) | 2013-02-06 | 2020-09-29 | Bristol-Myers Squibb Company | Fibronectin type III domain proteins with enhanced solubility |
WO2020208049A1 (en) | 2019-04-12 | 2020-10-15 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising lipocalin muteins |
WO2020260329A1 (en) | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Fusion of an antibody binding cea and 4-1bbl |
WO2020260326A1 (en) | 2019-06-27 | 2020-12-30 | F. Hoffmann-La Roche Ag | Novel icos antibodies and tumor-targeted antigen binding molecules comprising them |
US10899836B2 (en) | 2016-02-12 | 2021-01-26 | Janssen Pharmaceutica Nv | Method of identifying anti-VISTA antibodies |
US10919947B2 (en) | 2015-09-01 | 2021-02-16 | Il Dong Pharmaceutical Co., Ltd. | Pharmaceutical composition containing, as active ingredient, fusion protein in which tumor-penetrating peptide and anti-angiogenesis agent are fused, for preventing and treating cancer or angiogenesis-related diseases |
US10933115B2 (en) | 2012-06-22 | 2021-03-02 | The Trustees Of Dartmouth College | VISTA antagonist and methods of use |
US11009509B2 (en) | 2015-06-24 | 2021-05-18 | Janssen Pharmaceutica Nv | Anti-VISTA antibodies and fragments |
US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
US11090386B2 (en) | 2015-02-25 | 2021-08-17 | Eisai R&D Management Co., Ltd. | Method for suppressing bitterness of quinoline derivative |
US11123426B2 (en) | 2014-06-11 | 2021-09-21 | The Trustees Of Dartmouth College | Use of vista agonists and antagonists to suppress or enhance humoral immunity |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
WO2021198333A1 (en) | 2020-04-01 | 2021-10-07 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules targeting ox40 and fap |
US11173219B2 (en) | 2014-11-25 | 2021-11-16 | Bristol-Myers Squibb Company | PD-L1 binding polypeptides for imaging |
US11180557B2 (en) | 2012-06-22 | 2021-11-23 | King's College London | Vista modulators for diagnosis and treatment of cancer |
WO2021259890A1 (en) | 2020-06-23 | 2021-12-30 | F. Hoffmann-La Roche Ag | Agonistic cd28 antigen binding molecules targeting her2 |
WO2021260064A1 (en) | 2020-06-25 | 2021-12-30 | F. Hoffmann-La Roche Ag | Anti-cd3/anti-cd28 bispecific antigen binding molecules |
US11229713B2 (en) | 2014-11-25 | 2022-01-25 | Bristol-Myers Squibb Company | Methods and compositions for 18F-radiolabeling of biologics |
US11242392B2 (en) | 2013-12-24 | 2022-02-08 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
EP3973977A1 (en) | 2015-03-31 | 2022-03-30 | Ildong Pharm Co., Ltd. | Pharmaceutical composition for preventing and treating eye diseases, containing, as active ingredient, fusion protein in which tissue-penetrating peptide and anti-vascular endothelial growth factor preparation are fused |
WO2022101458A1 (en) | 2020-11-16 | 2022-05-19 | F. Hoffmann-La Roche Ag | Combination therapy with fap-targeted cd40 agonists |
US11344639B2 (en) | 2016-06-01 | 2022-05-31 | Bristol-Myers Squibb Company | PET imaging with PD-L1 binding polypeptides |
US11369623B2 (en) | 2015-06-16 | 2022-06-28 | Prism Pharma Co., Ltd. | Anticancer combination of a CBP/catenin inhibitor and an immune checkpoint inhibitor |
WO2022148732A1 (en) | 2021-01-06 | 2022-07-14 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
US11447538B2 (en) | 2013-02-01 | 2022-09-20 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins |
US11466073B2 (en) | 2017-10-18 | 2022-10-11 | Csl Limited | Human serum albumin variants and uses thereof |
WO2022243261A1 (en) | 2021-05-19 | 2022-11-24 | F. Hoffmann-La Roche Ag | Agonistic cd40 antigen binding molecules targeting cea |
US11511000B2 (en) | 2016-06-01 | 2022-11-29 | Bristol-Myers Squibb Company | Imaging methods using 18F-radiolabeled biologics |
WO2022253867A1 (en) | 2021-06-02 | 2022-12-08 | F. Hoffmann-La Roche Ag | Agonistic cd28 antigen binding molecules targeting epcam |
US11525000B2 (en) | 2016-04-15 | 2022-12-13 | Immunext, Inc. | Anti-human VISTA antibodies and use thereof |
US11529416B2 (en) | 2012-09-07 | 2022-12-20 | Kings College London | Vista modulators for diagnosis and treatment of cancer |
WO2023279092A2 (en) | 2021-07-02 | 2023-01-05 | Genentech, Inc. | Methods and compositions for treating cancer |
US11547705B2 (en) | 2015-03-04 | 2023-01-10 | Merck Sharp & Dohme Llc | Combination of a PD-1 antagonist and a VEGF-R/FGFR/RET tyrosine kinase inhibitor for treating cancer |
EP4116427A1 (en) | 2012-05-17 | 2023-01-11 | Kymab Limited | In vivo guided selection & antibodies |
US11555062B2 (en) | 2011-10-11 | 2023-01-17 | Viela Bio, Inc. | Methods of administering a composition comprising a Tn3 scaffold and a CD40L-specific monomer |
WO2023010095A1 (en) | 2021-07-28 | 2023-02-02 | F. Hoffmann-La Roche Ag | Methods and compositions for treating cancer |
WO2023117834A1 (en) | 2021-12-20 | 2023-06-29 | F. Hoffmann-La Roche Ag | Agonistic ltbr antibodies and bispecific antibodies comprising them |
EP4223319A2 (en) | 2017-05-26 | 2023-08-09 | MedImmune, LLC | Method and molecules |
US11725048B2 (en) | 2019-12-20 | 2023-08-15 | Hudson Institute of Medical Research | CXCL10 binding proteins and compositions thereof |
WO2023186756A1 (en) | 2022-03-28 | 2023-10-05 | F. Hoffmann-La Roche Ag | Interferon gamma variants and antigen binding molecules comprising these |
WO2024056862A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for tumor-targeting of nk cells and use thereof |
WO2024094527A1 (en) | 2022-11-05 | 2024-05-10 | Quadrucept Bio Limited | Non-human vertebrates & cells |
Families Citing this family (47)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1604665B1 (en) | 2003-03-10 | 2011-05-11 | Eisai R&D Management Co., Ltd. | C-kit kinase inhibitor |
EP1925676A4 (en) | 2005-08-02 | 2010-11-10 | Eisai R&D Man Co Ltd | Method for assay on the effect of vascularization inhibitor |
WO2008026748A1 (en) | 2006-08-28 | 2008-03-06 | Eisai R & D Management Co., Ltd. | Antitumor agent for undifferentiated gastric cancer |
US8962655B2 (en) | 2007-01-29 | 2015-02-24 | Eisai R&D Management Co., Ltd. | Composition for treatment of undifferentiated gastric cancer |
AU2008325608B2 (en) | 2007-11-09 | 2013-03-14 | Eisai R & D Management Co., Ltd. | Combination of anti-angiogenic substance and anti-tumor platinum complex |
MX2010006854A (en) * | 2007-12-18 | 2010-09-09 | Schering Corp | Biomarkers for sensitivity to anti-igf1r therapy. |
US20100322930A1 (en) * | 2007-12-27 | 2010-12-23 | Frank Kolbinger | Fibronectin-based binding molecules and their use |
EP2342562B1 (en) * | 2008-09-30 | 2013-09-18 | AbbVie Inc. | Improved method of rna display |
WO2010048588A2 (en) * | 2008-10-23 | 2010-04-29 | Massachusetts Institute Of Technology | Directed engagement of activating fc receptors |
US8415291B2 (en) * | 2008-10-31 | 2013-04-09 | Centocor Ortho Biotech Inc. | Anti-TNF alpha fibronectin type III domain based scaffold compositions, methods and uses |
US8278419B2 (en) | 2008-10-31 | 2012-10-02 | Centocor Ortho Biotech Inc. | Fibronectin type III domain based scaffold compositions, methods and uses |
ES2684493T3 (en) | 2009-03-11 | 2018-10-03 | Promedior Inc. | An SAP polypeptide for use in the treatment of autoimmune disorders and graft disease against the host |
DK2405928T3 (en) | 2009-03-11 | 2017-01-30 | Promedior Inc | Treatment and diagnosis procedure for hypersensitive diseases |
US8067201B2 (en) * | 2009-04-17 | 2011-11-29 | Bristol-Myers Squibb Company | Methods for protein refolding |
US8927693B2 (en) | 2010-02-18 | 2015-01-06 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind IL-23 |
BR112012027863B1 (en) | 2010-04-30 | 2023-03-07 | Janssen Biotech, Inc | POLYPEPTIDES, PROTEIN SCRABOWS, LIBRARIES AND METHODS OF CONSTRUCTION THEREOF, METHOD FOR GENERATING A PROTEIN SCRAPE BINDING TO A SPECIFIC TARGET WITH A PREDEFINED BINDING AFFINITY, ISOLATED NUCLEIC ACID MOLECULES, VECTORS, HOST CELLS, MEDICAL COMPOSITIONS, DEVICES AND MANUFACTURING ARTICLES |
ES2573515T3 (en) | 2010-06-25 | 2016-06-08 | Eisai R&D Management Co., Ltd. | Anti-tumor agent that uses compounds with combined kinase inhibitory effect |
RU2580609C2 (en) | 2011-04-18 | 2016-04-10 | Эйсай Ар Энд Ди Менеджмент Ко., Лтд. | Anticancer therapeutic agent |
KR102142385B1 (en) | 2011-09-27 | 2020-08-10 | 얀센 바이오테크 인코포레이티드 | Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces |
US9603897B2 (en) | 2012-03-12 | 2017-03-28 | Massachusetts Institute Of Technology | Methods for treating tissue damage associated with ischemia with apolipoprotein D |
WO2013177187A2 (en) | 2012-05-22 | 2013-11-28 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-pk il-2 and therapeutic agents |
EP2937337A4 (en) | 2012-12-21 | 2016-06-22 | Eisai R&D Man Co Ltd | Amorphous form of quinoline derivative, and method for producing same |
EP2956468B1 (en) | 2013-02-12 | 2020-06-10 | Bristol-Myers Squibb Company | Tangential flow filtration based protein refolding methods |
RU2015140921A (en) * | 2013-02-26 | 2017-04-03 | Роше Гликарт Аг | ANTIBODIES TO MCSP |
WO2014165093A2 (en) | 2013-03-13 | 2014-10-09 | Bristol-Myers Squibb Company | Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto |
KR102049990B1 (en) | 2013-03-28 | 2019-12-03 | 삼성전자주식회사 | Fusion protein comprising anti-c-Met antibody and VEGF binding fragment |
EP3054959B1 (en) | 2013-10-08 | 2020-01-08 | Promedior Inc. | Methods for treating fibrotic cancers |
CA2943228C (en) | 2014-03-20 | 2023-03-14 | Bristol-Myers Squibb Company | Stabilized fibronectin based scaffold molecules |
US20170224777A1 (en) | 2014-08-12 | 2017-08-10 | Massachusetts Institute Of Technology | Synergistic tumor treatment with il-2, a therapeutic antibody, and a cancer vaccine |
CA3133162C (en) | 2014-08-12 | 2024-02-13 | Massachusetts Institute Of Technology | Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein |
US9616114B1 (en) | 2014-09-18 | 2017-04-11 | David Gordon Bermudes | Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity |
KR20160075107A (en) * | 2014-12-19 | 2016-06-29 | 주식회사 이노테라피 | PEGylated VEGF-Trap and Method for Preparation Thereof |
US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
US11129906B1 (en) | 2016-12-07 | 2021-09-28 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
EP3554535A4 (en) | 2016-12-14 | 2020-10-21 | Janssen Biotech, Inc. | Pd-l1 binding fibronectin type iii domains |
EP3554561B1 (en) | 2016-12-14 | 2023-06-28 | Janssen Biotech, Inc. | Cd137 binding fibronectin type iii domains |
BR112019012154A2 (en) | 2016-12-14 | 2019-11-12 | Janssen Biotech Inc | cd8a-binding fibronectin type iii domains |
CA3049656A1 (en) | 2017-01-10 | 2018-07-19 | Nodus Therapeutics | Combination tumor treatment with an integrin-binding-fc fusion protein and immune modulator |
US10350266B2 (en) | 2017-01-10 | 2019-07-16 | Nodus Therapeutics, Inc. | Method of treating cancer with a multiple integrin binding Fc fusion protein |
US11078254B2 (en) * | 2017-04-11 | 2021-08-03 | National Institute Of Advanced Industrial Science And Technology | Method for immobilizing lectin |
WO2019036605A2 (en) | 2017-08-17 | 2019-02-21 | Massachusetts Institute Of Technology | Multiple specificity binders of cxc chemokines and uses thereof |
EP3914289A1 (en) | 2019-01-23 | 2021-12-01 | Massachusetts Institute of Technology | Combination immunotherapy dosing regimen for immune checkpoint blockade |
EP4045061A4 (en) | 2019-10-14 | 2024-04-17 | Aro Biotherapeutics Company | Cd71 binding fibronectin type iii domains |
US11781138B2 (en) | 2019-10-14 | 2023-10-10 | Aro Biotherapeutics Company | FN3 domain-siRNA conjugates and uses thereof |
JP2023515633A (en) | 2020-02-28 | 2023-04-13 | ブリストル-マイヤーズ スクイブ カンパニー | Radiolabeled fibronectin-based scaffolds and antibodies and their theranostic uses |
CN113151126B (en) * | 2021-02-10 | 2023-08-08 | 大连大学 | Recombinant leaky strain for high-expression of N-glycosylation anti-VEGFR 2 monomer pseudoantibody, construction method and application thereof |
WO2024092717A1 (en) * | 2022-11-04 | 2024-05-10 | 庄伟哲 | Protein derived from fibronectin type iii domain, and use thereof |
Family Cites Families (97)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
US5641648A (en) | 1986-11-04 | 1997-06-24 | Protein Polymer Technologies, Inc. | Methods for preparing synthetic repetitive DNA |
US5514581A (en) | 1986-11-04 | 1996-05-07 | Protein Polymer Technologies, Inc. | Functional recombinantly prepared synthetic protein polymer |
US6018030A (en) | 1986-11-04 | 2000-01-25 | Protein Polymer Technologies, Inc. | Peptides comprising repetitive units of amino acids and DNA sequences encoding the same |
US5770697A (en) | 1986-11-04 | 1998-06-23 | Protein Polymer Technologies, Inc. | Peptides comprising repetitive units of amino acids and DNA sequences encoding the same |
US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
US4997652A (en) | 1987-12-22 | 1991-03-05 | Visionex | Biodegradable ocular implants |
US5164188A (en) | 1989-11-22 | 1992-11-17 | Visionex, Inc. | Biodegradable ocular implants |
JP3051145B2 (en) * | 1990-08-28 | 2000-06-12 | 住友製薬株式会社 | Novel polyethylene glycol derivative modified peptide |
US6255458B1 (en) * | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
KR0185215B1 (en) | 1990-11-30 | 1999-05-01 | 요시다 쇼오지 | A controlled-release pharmaceutical preparation for intra-ocular implant |
US5235041A (en) | 1990-12-28 | 1993-08-10 | Protein Polymer Technologies, Inc. | Purification of structurally ordered recombinant protein polymers |
US5792742A (en) | 1991-06-14 | 1998-08-11 | New York University | Fibrin-binding peptide fragments of fibronectin |
WO1994017097A1 (en) | 1993-01-19 | 1994-08-04 | Regents Of The University Of Minnesota | Synthetic fibronectin fragments as inhibitors of retroviral infections |
CA2118515A1 (en) | 1993-02-26 | 1994-02-23 | Yuichiro Ogura | Biodegradable scleral plug |
US5443505A (en) | 1993-11-15 | 1995-08-22 | Oculex Pharmaceuticals, Inc. | Biocompatible ocular implants |
US5516522A (en) | 1994-03-14 | 1996-05-14 | Board Of Supervisors Of Louisiana State University | Biodegradable porous device for long-term drug delivery with constant rate release and method of making the same |
US6369116B1 (en) | 1995-06-02 | 2002-04-09 | Oculex Pharmaceuticals, Inc. | Composition and method for treating glaucoma |
US5869079A (en) | 1995-06-02 | 1999-02-09 | Oculex Pharmaceuticals, Inc. | Formulation for controlled release of drugs by combining hydrophilic and hydrophobic agents |
GB9618960D0 (en) | 1996-09-11 | 1996-10-23 | Medical Science Sys Inc | Proteases |
US5922676A (en) * | 1996-09-20 | 1999-07-13 | The Burnham Institute | Methods of inhibiting cancer by using superfibronectin |
US6348333B1 (en) * | 1997-01-17 | 2002-02-19 | Toa Gosei Co., Ltd. | VEGF-binding KDR polypeptide |
US6261804B1 (en) | 1997-01-21 | 2001-07-17 | The General Hospital Corporation | Selection of proteins using RNA-protein fusions |
PT971946E (en) | 1997-01-21 | 2006-11-30 | Gen Hospital Corp | Selection of proteins using rna-protein fusions |
JP4187277B2 (en) | 1997-04-30 | 2008-11-26 | エンゾン ファーマシューティカルズ, インコーポレイテッド | Antigen-binding single chain proteins that can be glycosylated, their production and use |
ES2301198T3 (en) | 1997-06-12 | 2008-06-16 | Novartis International Pharmaceutical Ltd. | ARTIFICIAL POLYPEPTIDES OF ANTIBODIES. |
US6159722A (en) | 1997-12-03 | 2000-12-12 | Boehringer Mannheim Gmbh | Chimeric serine proteases |
WO1999051773A1 (en) | 1998-04-03 | 1999-10-14 | Phylos, Inc. | Addressable protein arrays |
JP4108827B2 (en) | 1998-05-28 | 2008-06-25 | 大日本印刷株式会社 | Inorganic decorative veneer |
AU775076B2 (en) | 1998-12-10 | 2004-07-15 | Bristol-Myers Squibb Company | Protein scaffolds for antibody mimics and other binding proteins |
US7115396B2 (en) | 1998-12-10 | 2006-10-03 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
JP4926320B2 (en) | 1999-04-28 | 2012-05-09 | ボード・オブ・リージエンツ,ザ・ユニバーシテイ・オブ・テキサス・システム | Compositions and methods for cancer treatment by selective inhibition of VEGF |
PT1196637E (en) | 1999-07-27 | 2007-07-04 | Adnexus Therapeutics Inc | Peptide acceptor ligation methods |
JP2003528632A (en) | 2000-03-31 | 2003-09-30 | インスティティ・パスツール | Peptide inhibiting vascular endothelial growth factor (VEGF) -mediated angiogenesis, polynucleotide encoding the peptide and methods of use |
EP1364009A2 (en) | 2000-06-15 | 2003-11-26 | Board of Regents, The University of Texas System | Regulatable, catalytically active nucleic acids |
CA2416219C (en) | 2000-07-11 | 2016-10-11 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
AU1325102A (en) | 2000-10-16 | 2002-04-29 | Phylos Inc | Protein scaffolds for antibody mimics and other binding proteins |
US7598352B2 (en) * | 2000-11-17 | 2009-10-06 | University Of Rochester | Method of identifying polypeptide monobodies which bind to target proteins and use thereof |
ES2250504T3 (en) | 2000-11-29 | 2006-04-16 | Allergan Inc. | PREVENTION OF REJECTION OF GRAFT IN THE EYE. |
US7556925B2 (en) | 2001-04-04 | 2009-07-07 | University Of Rochester | ανβ3 integrin-binding polypeptide monobodies and their use |
AU2002342672A1 (en) | 2001-09-11 | 2003-03-24 | Nascacell Gmbh | Method for screening for inhibitors of protein/protein interaction and corresponding ribozymes |
PT1916001E (en) | 2002-03-04 | 2011-07-18 | Imclone Llc | Human antibodies specific to kdr and uses thereof |
WO2003104418A2 (en) | 2002-06-06 | 2003-12-18 | Research Corporation Technologies, Inc. | Reconstituted polypeptides |
US7053701B2 (en) | 2003-11-04 | 2006-05-30 | Vice Michael W | Power amplifier output stage with multiple power states and improved efficiency |
US20080220049A1 (en) | 2003-12-05 | 2008-09-11 | Adnexus, A Bristol-Myers Squibb R&D Company | Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins |
TW200531979A (en) | 2003-12-05 | 2005-10-01 | Compound Therapeutics Inc | Inhibitors of type 2 vascular endothelial growth factor receptors |
US20060182783A1 (en) | 2004-04-30 | 2006-08-17 | Allergan, Inc. | Sustained release intraocular drug delivery systems |
US20050244469A1 (en) | 2004-04-30 | 2005-11-03 | Allergan, Inc. | Extended therapeutic effect ocular implant treatments |
US20050244472A1 (en) | 2004-04-30 | 2005-11-03 | Allergan, Inc. | Intraocular drug delivery systems containing excipients with reduced toxicity and related methods |
US20070059336A1 (en) | 2004-04-30 | 2007-03-15 | Allergan, Inc. | Anti-angiogenic sustained release intraocular implants and related methods |
CA2582374A1 (en) | 2004-10-04 | 2006-04-20 | Qlt Usa, Inc. | Ocular delivery of polymeric delivery formulations |
US20070072933A1 (en) | 2005-09-26 | 2007-03-29 | Peyman Gholam A | Delivery of an ocular agent |
CA2602577C (en) | 2005-10-18 | 2015-03-31 | Allergan, Inc. | Ocular therapy using glucocorticoid derivatives selectively penetrating posterior segment tissues |
WO2007053807A2 (en) | 2005-10-31 | 2007-05-10 | Wisconsin Alumni Research Foundation | Calcitriol for treating intraocular diseases associated with angiogenesis |
JP2009531283A (en) | 2006-02-02 | 2009-09-03 | アラーガン、インコーポレイテッド | Compositions and methods for the treatment of ophthalmic diseases |
WO2008031098A1 (en) | 2006-09-09 | 2008-03-13 | The University Of Chicago | Binary amino acid libraries for fibronectin type iii polypeptide monobodies |
US8470332B2 (en) | 2006-11-22 | 2013-06-25 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
EP2111228B1 (en) | 2007-02-02 | 2011-07-20 | Bristol-Myers Squibb Company | 10Fn3 domain for use in treating diseases associated with inappropriate angiogenesis |
US11078262B2 (en) | 2007-04-30 | 2021-08-03 | Allergan, Inc. | High viscosity macromolecular compositions for treating ocular conditions |
US8470966B2 (en) | 2007-08-10 | 2013-06-25 | Protelica, Inc. | Universal fibronectin type III binding-domain libraries |
AU2008287426B2 (en) | 2007-08-10 | 2014-06-26 | Protelica, Inc. | Universal fibronectin type III binding-domain libraries |
US8680019B2 (en) | 2007-08-10 | 2014-03-25 | Protelica, Inc. | Universal fibronectin Type III binding-domain libraries |
JP2010538972A (en) | 2007-08-20 | 2010-12-16 | ブリストル−マイヤーズ スクイブ カンパニー | Use of a VEGFR-2 inhibitor for the treatment of metastatic cancer |
ES2629440T5 (en) * | 2007-10-04 | 2020-11-20 | Zymogenetics Inc | zB7H6 member of the B7 family and related compositions and methods |
US8633297B2 (en) | 2007-10-31 | 2014-01-21 | Medimmune, Llc | Protein scaffolds |
WO2009073115A1 (en) | 2007-11-28 | 2009-06-11 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with mtor inhibitors |
EP2238247A2 (en) | 2007-12-19 | 2010-10-13 | Centocor Ortho Biotech Inc. | Alternative scaffold protein fusions phage display via fusion to plx of m13 phage |
US20100322930A1 (en) | 2007-12-27 | 2010-12-23 | Frank Kolbinger | Fibronectin-based binding molecules and their use |
MX2010008874A (en) | 2008-02-14 | 2010-09-22 | Bristol Myers Squibb Co | Targeted therapeutics based on engineered proteins that bind egfr. |
EP3173424A1 (en) | 2008-05-02 | 2017-05-31 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
CN102099373A (en) | 2008-05-22 | 2011-06-15 | 百时美施贵宝公司 | Multivalent fibronectin based scaffold domain proteins |
US8278419B2 (en) | 2008-10-31 | 2012-10-02 | Centocor Ortho Biotech Inc. | Fibronectin type III domain based scaffold compositions, methods and uses |
US8415291B2 (en) | 2008-10-31 | 2013-04-09 | Centocor Ortho Biotech Inc. | Anti-TNF alpha fibronectin type III domain based scaffold compositions, methods and uses |
TWI496582B (en) | 2008-11-24 | 2015-08-21 | 必治妥美雅史谷比公司 | Bispecific egfr/igfir binding molecules |
ES2410579T5 (en) | 2008-12-16 | 2021-10-04 | Novartis Ag | Yeast deployment systems |
EP2396000A1 (en) | 2009-02-11 | 2011-12-21 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with temozolomide |
DK2396011T3 (en) | 2009-02-12 | 2016-04-25 | Janssen Biotech Inc | Fibronectin TYPE III DOMAIN-BASED SCAFFOLD COMPOSITIONS, METHODS AND USES |
US8067201B2 (en) | 2009-04-17 | 2011-11-29 | Bristol-Myers Squibb Company | Methods for protein refolding |
EP2464663A4 (en) | 2009-08-13 | 2013-05-29 | Massachusetts Inst Technology | Engineered proteins including mutant fibronectin domains |
ES2691717T3 (en) | 2009-10-30 | 2018-11-28 | Novartis Ag | Universal libraries of the binding domain of the inferior side of type III fibronectin type III |
WO2011051466A1 (en) | 2009-11-02 | 2011-05-05 | Novartis Ag | Anti-idiotypic fibronectin-based binding molecules and uses thereof |
US20110123545A1 (en) | 2009-11-24 | 2011-05-26 | Bristol-Myers Squibb Company | Combination of vegfr2 and igf1r inhibitors for the treatment of proliferative diseases |
WO2011092233A1 (en) | 2010-01-29 | 2011-08-04 | Novartis Ag | Yeast mating to produce high-affinity combinations of fibronectin-based binders |
WO2011100700A2 (en) | 2010-02-12 | 2011-08-18 | University Of Rochester | Antigenic mimics of discontinuous epitopes of pathogen recognized by broadly neutralizing antibodies |
US8927693B2 (en) | 2010-02-18 | 2015-01-06 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind IL-23 |
US20130079280A1 (en) | 2010-04-13 | 2013-03-28 | Medlmmune, Llc | Fibronectin type iii domain-based multimeric scaffolds |
UY33331A (en) | 2010-04-13 | 2011-10-31 | Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware | FIBRONECTINE-BASED ARMAZON DOMAIN PROTEINS THAT JOIN PCSK9 |
BR112012027863B1 (en) | 2010-04-30 | 2023-03-07 | Janssen Biotech, Inc | POLYPEPTIDES, PROTEIN SCRABOWS, LIBRARIES AND METHODS OF CONSTRUCTION THEREOF, METHOD FOR GENERATING A PROTEIN SCRAPE BINDING TO A SPECIFIC TARGET WITH A PREDEFINED BINDING AFFINITY, ISOLATED NUCLEIC ACID MOLECULES, VECTORS, HOST CELLS, MEDICAL COMPOSITIONS, DEVICES AND MANUFACTURING ARTICLES |
TW201138808A (en) | 2010-05-03 | 2011-11-16 | Bristol Myers Squibb Co | Serum albumin binding molecules |
EP3091028A1 (en) | 2010-05-26 | 2016-11-09 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
KR20130136443A (en) | 2010-07-30 | 2013-12-12 | 노파르티스 아게 | Fibronectin cradle molecules and libraries thereof |
WO2012088006A1 (en) | 2010-12-22 | 2012-06-28 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind il-23 |
PT2697257T (en) | 2011-04-13 | 2016-12-28 | Bristol Myers Squibb Co | Fc fusion proteins comprising novel linkers or arrangements |
US20140187488A1 (en) | 2011-05-17 | 2014-07-03 | Bristol-Myers Squibb Company | Methods for maintaining pegylation of polypeptides |
EP2710382B1 (en) | 2011-05-17 | 2017-10-18 | Bristol-Myers Squibb Company | Improved methods for the selection of binding proteins |
KR102142385B1 (en) | 2011-09-27 | 2020-08-10 | 얀센 바이오테크 인코포레이티드 | Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces |
-
2004
- 2004-12-06 TW TW093137723A patent/TW200531979A/en unknown
- 2004-12-06 JP JP2006542876A patent/JP5006651B2/en not_active Expired - Fee Related
- 2004-12-06 MX MXPA06006406A patent/MXPA06006406A/en active IP Right Grant
- 2004-12-06 CA CA002552435A patent/CA2552435A1/en not_active Abandoned
- 2004-12-06 KR KR1020067013519A patent/KR20060129246A/en not_active Application Discontinuation
- 2004-12-06 BR BRPI0417302-3A patent/BRPI0417302A/en not_active IP Right Cessation
- 2004-12-06 RU RU2006123945/10A patent/RU2402567C2/en not_active IP Right Cessation
- 2004-12-06 AU AU2004296376A patent/AU2004296376B2/en not_active Ceased
- 2004-12-06 CN CNA200480041450XA patent/CN1946417A/en active Pending
- 2004-12-06 EP EP04813230A patent/EP1711196A4/en not_active Withdrawn
- 2004-12-06 WO PCT/US2004/040885 patent/WO2005056764A2/en active Application Filing
- 2004-12-06 SG SG200809039-1A patent/SG149004A1/en unknown
-
2006
- 2006-06-05 IL IL176135A patent/IL176135A0/en unknown
- 2006-06-05 US US11/448,171 patent/US7858739B2/en active Active
- 2006-07-07 US US11/482,641 patent/US7847062B2/en active Active
-
2010
- 2010-05-26 US US12/788,240 patent/US8324362B2/en active Active
-
2011
- 2011-11-18 JP JP2011252176A patent/JP2012100658A/en active Pending
-
2012
- 2012-07-18 US US13/552,398 patent/US8609613B2/en active Active
-
2013
- 2013-11-04 US US14/071,069 patent/US9328157B2/en active Active
-
2016
- 2016-03-15 US US15/070,572 patent/US9862758B2/en active Active
-
2017
- 2017-11-29 US US15/826,196 patent/US10995131B2/en active Active
Non-Patent Citations (1)
Title |
---|
See references of EP1711196A4 * |
Cited By (248)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8106162B2 (en) | 1997-06-12 | 2012-01-31 | Novartis Ag | Artificial antibody polypeptides |
US7119171B2 (en) | 1997-06-12 | 2006-10-10 | Research Corporation Technologies, Inc. | Binding polypeptides |
US7153661B2 (en) | 1997-06-12 | 2006-12-26 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
US7981620B2 (en) | 1997-06-12 | 2011-07-19 | Novartis International Pharmaceutical Ltd. | Artificial antibody polypeptides |
US7858090B2 (en) | 1997-06-12 | 2010-12-28 | Novartis International Pharmaceutical Ltd. | Artificial antibody polypeptides |
US9127090B2 (en) | 1997-06-12 | 2015-09-08 | Novartis Ag | Artificial antibody polypeptides |
US8062858B2 (en) | 1997-06-12 | 2011-11-22 | Novartis International Pharmaceutical Ltd. | Artificial antibody polypeptides |
US7078490B2 (en) | 1997-06-12 | 2006-07-18 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
US7195880B2 (en) | 1998-12-02 | 2007-03-27 | Adnexus Therapeutics, Inc. | DNA-protein fusions and uses thereof |
US8841330B2 (en) | 1999-01-13 | 2014-09-23 | Bayer Healthcare Llc | Omega-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors |
US7897623B2 (en) | 1999-01-13 | 2011-03-01 | Bayer Healthcare Llc | ω-carboxyl aryl substituted diphenyl ureas as p38 kinase inhibitors |
US8124630B2 (en) | 1999-01-13 | 2012-02-28 | Bayer Healthcare Llc | ω-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors |
US8263741B2 (en) | 2000-07-11 | 2012-09-11 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
US8372981B2 (en) | 2000-10-20 | 2013-02-12 | Eisai R&D Management Co., Ltd. | Nitrogen-containing aromatic derivatives |
US7973160B2 (en) | 2000-10-20 | 2011-07-05 | Eisai R&D Management Co., Ltd. | Nitrogen-containing aromatic derivatives |
US7838541B2 (en) | 2002-02-11 | 2010-11-23 | Bayer Healthcare, Llc | Aryl ureas with angiogenesis inhibiting activity |
US8618141B2 (en) | 2002-02-11 | 2013-12-31 | Bayer Healthcare Llc | Aryl ureas with angiogenesis inhibiting activity |
US8242147B2 (en) | 2002-02-11 | 2012-08-14 | Bayer Healthcare Llc | Aryl ureas with angiogenisis inhibiting activity |
US9051357B2 (en) | 2002-06-06 | 2015-06-09 | Research Corporation Technologies, Inc. | Reconstituted polypeptides |
US8258265B2 (en) | 2002-06-06 | 2012-09-04 | Research Corporation Technologies, Inc. | Reconstituted polypeptides |
US10370440B2 (en) | 2002-06-06 | 2019-08-06 | Research Corporation Technologies, Inc. | Reconstituted polypeptides |
US8796250B2 (en) | 2003-05-20 | 2014-08-05 | Bayer Healthcare Llc | Diaryl ureas for diseases mediated by PDGFR |
US8058474B2 (en) | 2003-11-11 | 2011-11-15 | Eisai R&D Management Co., Ltd. | Urea derivative and process for preparing the same |
US10995131B2 (en) | 2003-12-05 | 2021-05-04 | Bristol-Myers Squibb Company | Libraries of modified fibronectin type III tenth domain-containing polypeptides |
US9862758B2 (en) | 2003-12-05 | 2018-01-09 | Bristol-Myers Quibb Company | Inhibitors of type 2 vascular endothelial growth factor receptors |
US9328157B2 (en) | 2003-12-05 | 2016-05-03 | Bristol-Myers Squibb Company | Inhibitors of type 2 vascular endothelial growth factor receptors |
US8969379B2 (en) | 2004-09-17 | 2015-03-03 | Eisai R&D Management Co., Ltd. | Pharmaceutical compositions of 4-(3-chloro-4-(cyclopropylaminocarbonyl)aminophenoxy)-7=methoxy-6-quinolinecarboxide |
EP1943521A2 (en) * | 2005-11-02 | 2008-07-16 | Bayer HealthCare LLC | Methods for prediction and prognosis of cancer, and monitoring cancer therapy |
EP1943521A4 (en) * | 2005-11-02 | 2009-12-30 | Bayer Healthcare Llc | Methods for prediction and prognosis of cancer, and monitoring cancer therapy |
JP5190361B2 (en) * | 2006-05-18 | 2013-04-24 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | Antitumor agent for thyroid cancer |
WO2007136103A1 (en) * | 2006-05-18 | 2007-11-29 | Eisai R & D Management Co., Ltd. | Antitumor agent for thyroid cancer |
US10221232B2 (en) | 2006-11-22 | 2019-03-05 | Bristol-Myers Squibb Company | Methods of treating cancer by administering IGF-IR binding molecules |
EP2727936A1 (en) | 2006-11-22 | 2014-05-07 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
EP3156415A1 (en) | 2006-11-22 | 2017-04-19 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir |
US8470332B2 (en) | 2006-11-22 | 2013-06-25 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
JP2010510315A (en) * | 2006-11-22 | 2010-04-02 | アドネクサス・ア・ブリストル−マイヤーズ・スクイブ・アール・アンド・ディ・カンパニー | Targeted therapeutic agents based on modified proteins for tyrosine kinase receptors including IGF-IR |
US11149077B2 (en) | 2006-11-22 | 2021-10-19 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
WO2008066752A3 (en) * | 2006-11-22 | 2009-03-05 | Adnexus A Bristol Meyers Squib | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir |
WO2008097497A3 (en) * | 2007-02-02 | 2009-06-25 | Adnexus A Bristol Myers Squibb | Vegf pathway blockade |
WO2008097497A2 (en) | 2007-02-02 | 2008-08-14 | Adnexus, A Bristol-Myers Squibb R & D Company | Vegf pathway blockade |
JP2014074064A (en) * | 2007-06-22 | 2014-04-24 | Hanmei Xu | Inhibitor of angiogenesis, and method of manufacturing the same, method of modifying the same and its application in manufacture of antineoplastic |
US10317407B2 (en) | 2007-08-16 | 2019-06-11 | The Royal Institution For The Advancement Of Learning/Mcgill University | Tumor cell-derived microvesicles |
EP2696203A3 (en) * | 2007-08-16 | 2014-05-28 | The Royal Institution for the Advancement of Learning/McGill University | Tumor cell-derived microvesicles |
US9186405B2 (en) | 2007-08-16 | 2015-11-17 | The Royal Institution For The Advancement Of Learning/Mcgill University | Tumor cell-derived microvesicles |
US10352935B2 (en) | 2007-08-16 | 2019-07-16 | The Royal Institution For The Advancement Of Learning/Mcgill University | Tumor cell-derived microvesicles |
WO2009025806A2 (en) * | 2007-08-20 | 2009-02-26 | Adnexus, A Bristol-Myers Squibb R & D Company | Use of vegfr-2 inhibitors for treating metastatic cancer |
WO2009025806A3 (en) * | 2007-08-20 | 2009-06-18 | Adnexus A Bristol Myers Squibb | Use of vegfr-2 inhibitors for treating metastatic cancer |
EP2215246A2 (en) * | 2007-10-31 | 2010-08-11 | MedImmune, LLC | Protein scaffolds |
EP2215246A4 (en) * | 2007-10-31 | 2011-08-10 | Medimmune Llc | Protein scaffolds |
US8633297B2 (en) | 2007-10-31 | 2014-01-21 | Medimmune, Llc | Protein scaffolds |
US9176129B2 (en) | 2007-10-31 | 2015-11-03 | Medimmune, Llc | Protein scaffolds |
WO2009073115A1 (en) * | 2007-11-28 | 2009-06-11 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with mtor inhibitors |
US20110008345A1 (en) * | 2007-11-30 | 2011-01-13 | Claire Ashman | Antigen-binding constructs |
EP2615115A2 (en) | 2007-11-30 | 2013-07-17 | Glaxo Group Limited | Antigen-binding constructs |
EP2641919A2 (en) | 2007-11-30 | 2013-09-25 | Glaxo Group Limited | Antigen-binding constructs |
DE112008003232T5 (en) | 2007-11-30 | 2011-02-24 | Glaxo Group Limited, Greenford | Antigen-binding constructs |
US10781247B2 (en) | 2008-02-14 | 2020-09-22 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
JP2011517314A (en) * | 2008-02-14 | 2011-06-02 | ブリストル−マイヤーズ スクイブ カンパニー | Targeted therapeutics based on engineered proteins that bind to EGFR |
WO2009102421A2 (en) | 2008-02-14 | 2009-08-20 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind egfr |
US8524244B2 (en) | 2008-02-14 | 2013-09-03 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
US9920108B2 (en) | 2008-02-14 | 2018-03-20 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
US9234028B2 (en) | 2008-02-14 | 2016-01-12 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
WO2009102421A3 (en) * | 2008-02-14 | 2010-01-21 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind egfr |
WO2009133208A1 (en) | 2008-05-02 | 2009-11-05 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
US20110038866A1 (en) * | 2008-05-02 | 2011-02-17 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
EP3173424A1 (en) | 2008-05-02 | 2017-05-31 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
EP2383292A1 (en) | 2008-05-02 | 2011-11-02 | Novartis AG | Improved fibronectin-based binding molecules and uses thereof |
EP2439212A1 (en) | 2008-05-02 | 2012-04-11 | Novartis AG | Improved fibronectin-based binding molecules and uses thereof |
US9296810B2 (en) * | 2008-05-02 | 2016-03-29 | Novartis Ag | Fibronectin-based binding molecules and uses thereof |
EP2441447A1 (en) | 2008-05-06 | 2012-04-18 | Glaxo Group Limited | Encapsulation of biologically active agents |
US9902762B2 (en) | 2008-05-22 | 2018-02-27 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
US8728483B2 (en) | 2008-05-22 | 2014-05-20 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
US10774130B2 (en) | 2008-05-22 | 2020-09-15 | Bristol-Myers Squibb Company | Method of treating cancer by administering multivalent fibronectin based scaffold domain proteins |
EP2799448A1 (en) | 2008-05-22 | 2014-11-05 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
US8221765B2 (en) | 2008-05-22 | 2012-07-17 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
EP3785735A1 (en) * | 2008-11-03 | 2021-03-03 | Molecular Partners AG | Binding proteins inhibiting the vegf-a receptor interaction |
WO2010060748A1 (en) * | 2008-11-03 | 2010-06-03 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
KR20110082528A (en) * | 2008-11-03 | 2011-07-19 | 몰리큘라 파트너스 아게 | Binding proteins inhibiting the vegf-a receptor interaction |
US8901076B2 (en) | 2008-11-03 | 2014-12-02 | Molecular Partner AG | Binding proteins inhibiting the VEGF-A receptor interaction |
KR101698362B1 (en) | 2008-11-03 | 2017-01-20 | 몰리큘라 파트너스 아게 | Binding proteins inhibiting the VEGF-A receptor interaction |
JP2015133978A (en) * | 2008-11-03 | 2015-07-27 | モレキュラー・パートナーズ・アーゲーMolecular Partners Ag | Binding proteins that inhibit vegf-a receptor interaction |
US10954286B2 (en) | 2008-11-24 | 2021-03-23 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
US8343501B2 (en) | 2008-11-24 | 2013-01-01 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
US9017655B2 (en) | 2008-11-24 | 2015-04-28 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
US9771411B2 (en) | 2008-11-24 | 2017-09-26 | Bristol-Myers Squibb Company | Method of treating cancer by administering EGFR and EGFR/IGFIR binding molecules |
US10183987B2 (en) | 2008-11-24 | 2019-01-22 | Bristol-Myers Squibb Company | Polynucleotides encoding bispecific EGFR/IGF-IR binding molecules |
WO2010070094A1 (en) | 2008-12-19 | 2010-06-24 | Glaxo Group Limited | Myostatin binding proteins |
WO2010093771A1 (en) * | 2009-02-11 | 2010-08-19 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with temozolomide |
WO2010097385A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
WO2010097386A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Antigen-binding constructs |
WO2010097394A1 (en) | 2009-02-24 | 2010-09-02 | Glaxo Group Limited | Multivalent and/or multispecific rankl-binding constructs |
WO2011012646A2 (en) | 2009-07-28 | 2011-02-03 | F. Hoffmann-La Roche Ag | Non-invasive in vivo optical imaging method |
US20120270797A1 (en) * | 2009-08-13 | 2012-10-25 | Massachusetts Institute Of Technology | Engineered proteins including mutant fibronectin domains |
WO2011051327A2 (en) | 2009-10-30 | 2011-05-05 | Novartis Ag | Small antibody-like single chain proteins |
US10253313B2 (en) | 2009-10-30 | 2019-04-09 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
WO2011051466A1 (en) | 2009-11-02 | 2011-05-05 | Novartis Ag | Anti-idiotypic fibronectin-based binding molecules and uses thereof |
WO2011094259A2 (en) | 2010-01-28 | 2011-08-04 | Glaxo Group Limited | Cd127 binding proteins |
WO2011092233A1 (en) | 2010-01-29 | 2011-08-04 | Novartis Ag | Yeast mating to produce high-affinity combinations of fibronectin-based binders |
US10781254B2 (en) | 2010-03-26 | 2020-09-22 | The Trustees Of Dartmouth College | VISTA regulatory T cell mediator protein, VISTA binding agents and use thereof |
US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
US9212231B2 (en) | 2010-04-13 | 2015-12-15 | Medimmune, Llc | TRAIL R2-specific multimeric scaffolds |
EA036055B1 (en) * | 2010-04-13 | 2020-09-21 | Бристол-Майерс Сквибб Компани | Use of a polypeptide that binds pcsk9 for treating atherosclerosis or hypercholesterolemia |
US10934572B2 (en) | 2010-05-03 | 2021-03-02 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US10221438B2 (en) | 2010-05-03 | 2019-03-05 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US9540424B2 (en) | 2010-05-03 | 2017-01-10 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US8969289B2 (en) | 2010-05-03 | 2015-03-03 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
WO2011138462A1 (en) | 2010-05-07 | 2011-11-10 | F. Hoffmann-La Roche Ag | Diagnostic method for the detection of cells ex vivo |
US11161893B2 (en) | 2010-05-26 | 2021-11-02 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US9562089B2 (en) | 2010-05-26 | 2017-02-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US10273286B2 (en) | 2010-05-26 | 2019-04-30 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
WO2011151432A1 (en) | 2010-06-03 | 2011-12-08 | Glaxo Group Limited | Humanised antigen binding proteins to myostatin6 |
WO2012069433A2 (en) | 2010-11-23 | 2012-05-31 | Glaxo Group Limited | Antigen binding proteins |
WO2012069557A1 (en) | 2010-11-24 | 2012-05-31 | Glaxo Group Limited | Multispecific antigen binding proteins targeting hgf |
EP2853542A1 (en) | 2010-11-24 | 2015-04-01 | Glaxo Group Limited | Multispecific antigen binding proteins targeting HGF |
US10214579B2 (en) | 2011-04-13 | 2019-02-26 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
US9469676B2 (en) | 2011-04-13 | 2016-10-18 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
WO2012140627A1 (en) | 2011-04-15 | 2012-10-18 | Compugen Ltd. | Polypeptides and polynucleotides, and uses thereof for treatment of immune related disorders and cancer |
WO2012158678A1 (en) | 2011-05-17 | 2012-11-22 | Bristol-Myers Squibb Company | Methods for maintaining pegylation of polypeptides |
US10898538B2 (en) | 2011-05-17 | 2021-01-26 | Bristol-Myers Squibb Company | Methods for maintaining pegylation of polypeptides |
EP4338754A2 (en) | 2011-05-27 | 2024-03-20 | Glaxo Group Limited | Antigen binding proteins |
EP3693394A1 (en) | 2011-05-27 | 2020-08-12 | Glaxo Group Limited | Antigen binding proteins |
US11598776B2 (en) | 2011-06-03 | 2023-03-07 | Eisai R&D Management Co., Ltd. | Biomarkers for predicting and assessing responsiveness of thyroid and kidney cancer subjects to lenvatinib compounds |
US9945862B2 (en) | 2011-06-03 | 2018-04-17 | Eisai R&D Management Co., Ltd. | Biomarkers for predicting and assessing responsiveness of thyroid and kidney cancer subjects to lenvatinib compounds |
US11555062B2 (en) | 2011-10-11 | 2023-01-17 | Viela Bio, Inc. | Methods of administering a composition comprising a Tn3 scaffold and a CD40L-specific monomer |
WO2013059886A1 (en) | 2011-10-28 | 2013-05-02 | Patrys Limited | Pat-lm1 epitopes and methods for using same |
US9765132B2 (en) | 2011-10-31 | 2017-09-19 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US10604556B2 (en) | 2011-10-31 | 2020-03-31 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US10464995B2 (en) | 2011-10-31 | 2019-11-05 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US11279751B2 (en) | 2011-10-31 | 2022-03-22 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US9416170B2 (en) | 2011-10-31 | 2016-08-16 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US11408093B2 (en) | 2011-10-31 | 2022-08-09 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US9522951B2 (en) | 2011-10-31 | 2016-12-20 | Bristol-Myers Squibb Company | Fibronectin binding domains with reduced immunogenicity |
US11912761B2 (en) | 2012-02-13 | 2024-02-27 | Agency For Science, Technology And Research | IL-1β neutralizing human monoclonal antibodies |
EP3736289A1 (en) | 2012-02-13 | 2020-11-11 | Agency For Science, Technology And Research | Il-beta neutralizing human monoclonal antibodies |
US10167335B2 (en) | 2012-02-13 | 2019-01-01 | Agency For Science, Technology And Research | IL-1β neutralizing human monoclonal antibodies |
US11780913B2 (en) | 2012-02-13 | 2023-10-10 | Agency For Science, Technology And Research | IL-1β neutralizing human monoclonal antibodies |
US10919962B2 (en) | 2012-02-13 | 2021-02-16 | Agency For Science, Technology And Research | Method of reducing tumor growth with IL-1beta neutralizing human monoclonal antibodies |
US11702471B2 (en) | 2012-02-13 | 2023-07-18 | Agency For Science, Technology And Research | IL-1β neutralizing human monoclonal antibodies |
US10568934B2 (en) | 2012-05-07 | 2020-02-25 | Allergan, Inc. | Method of treating AMD in patients refractory to anti-VEGF therapy |
EP4116427A1 (en) | 2012-05-17 | 2023-01-11 | Kymab Limited | In vivo guided selection & antibodies |
US10933115B2 (en) | 2012-06-22 | 2021-03-02 | The Trustees Of Dartmouth College | VISTA antagonist and methods of use |
US11180557B2 (en) | 2012-06-22 | 2021-11-23 | King's College London | Vista modulators for diagnosis and treatment of cancer |
US11752189B2 (en) | 2012-06-22 | 2023-09-12 | The Trustees Of Dartmouth College | Vista antagonist and methods of use |
US11529416B2 (en) | 2012-09-07 | 2022-12-20 | Kings College London | Vista modulators for diagnosis and treatment of cancer |
US11813315B2 (en) | 2012-09-13 | 2023-11-14 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US8853154B2 (en) | 2012-09-13 | 2014-10-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US10245302B2 (en) | 2012-09-13 | 2019-04-02 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US8993265B2 (en) | 2012-09-13 | 2015-03-31 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US8933199B2 (en) | 2012-09-13 | 2015-01-13 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US9493546B2 (en) | 2012-09-13 | 2016-11-15 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US10406212B2 (en) | 2012-09-13 | 2019-09-10 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
US9662373B2 (en) | 2012-09-13 | 2017-05-30 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to myostatin |
WO2014072306A1 (en) | 2012-11-08 | 2014-05-15 | F. Hoffmann-La Roche Ag | Her3 antigen binding proteins binding to the beta-hairpin of her3 |
US11447538B2 (en) | 2013-02-01 | 2022-09-20 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins |
US11512124B2 (en) | 2013-02-06 | 2022-11-29 | Bristol-Myers Squibb Company | Fibronectin type III domain proteins with enhanced solubility |
US10787498B2 (en) | 2013-02-06 | 2020-09-29 | Bristol-Myers Squibb Company | Fibronectin type III domain proteins with enhanced solubility |
US10065987B2 (en) | 2013-02-12 | 2018-09-04 | Bristol-Myers Squibb Company | High pH protein refolding methods |
US11345722B2 (en) | 2013-02-12 | 2022-05-31 | Bristol-Myers Squibb Company | High pH protein refolding methods |
US10517861B2 (en) | 2013-05-14 | 2019-12-31 | Eisai R&D Management Co., Ltd. | Biomarkers for predicting and assessing responsiveness of endometrial cancer subjects to lenvatinib compounds |
US9388222B2 (en) | 2013-10-06 | 2016-07-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Modified Pseudomonas exotoxin A |
US11261243B2 (en) | 2013-11-28 | 2022-03-01 | Csl Limited | Methods of treating diabetic nephropathy by administering an anti-vegf-b (vascular endothelial growth factor-b) antibody |
US9803008B2 (en) | 2013-11-28 | 2017-10-31 | Csl Limited | Method of treating diabetic nephropathy by administering antibodies to vascular endothelial growth factor B (VEGF-B) |
US10407498B2 (en) | 2013-11-28 | 2019-09-10 | Csl Limited | Method of treating diabetic nephropathy in a subject suffering from type 2 diabetes by administering an antibody which inhibits VEGF-B signaling |
WO2015089585A1 (en) | 2013-12-18 | 2015-06-25 | Csl Limited | Method of treating wounds |
US11242392B2 (en) | 2013-12-24 | 2022-02-08 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
US10442851B2 (en) | 2014-03-20 | 2019-10-15 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
US11203630B2 (en) | 2014-03-20 | 2021-12-21 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
US11123426B2 (en) | 2014-06-11 | 2021-09-21 | The Trustees Of Dartmouth College | Use of vista agonists and antagonists to suppress or enhance humoral immunity |
US10407393B2 (en) | 2014-08-28 | 2019-09-10 | Eisai R&D Management Co., Ltd. | High-purity quinoline derivative and method for manufacturing same |
US10822307B2 (en) | 2014-08-28 | 2020-11-03 | Eisai R&D Management Co., Ltd. | High-purity quinoline derivative and method for manufacturing same |
US10259791B2 (en) | 2014-08-28 | 2019-04-16 | Eisai R&D Management Co., Ltd. | High-purity quinoline derivative and method for manufacturing same |
US11186547B2 (en) | 2014-08-28 | 2021-11-30 | Eisai R&D Management Co., Ltd. | High-purity quinoline derivative and method for manufacturing same |
WO2016054315A1 (en) | 2014-10-01 | 2016-04-07 | Medimmune, Llc | Method of conjugating a polypeptide |
WO2016059602A2 (en) | 2014-10-16 | 2016-04-21 | Glaxo Group Limited | Methods of treating cancer and related compositions |
EP3489256A1 (en) | 2014-11-14 | 2019-05-29 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer |
US11173219B2 (en) | 2014-11-25 | 2021-11-16 | Bristol-Myers Squibb Company | PD-L1 binding polypeptides for imaging |
US11229713B2 (en) | 2014-11-25 | 2022-01-25 | Bristol-Myers Squibb Company | Methods and compositions for 18F-radiolabeling of biologics |
US10370455B2 (en) | 2014-12-05 | 2019-08-06 | Immunext, Inc. | Identification of VSIG8 as the putative VISTA receptor (V-R) and use thereof to produce VISTA/VSIG8 agonists and antagonists |
US11090386B2 (en) | 2015-02-25 | 2021-08-17 | Eisai R&D Management Co., Ltd. | Method for suppressing bitterness of quinoline derivative |
US11547705B2 (en) | 2015-03-04 | 2023-01-10 | Merck Sharp & Dohme Llc | Combination of a PD-1 antagonist and a VEGF-R/FGFR/RET tyrosine kinase inhibitor for treating cancer |
EP3973977A1 (en) | 2015-03-31 | 2022-03-30 | Ildong Pharm Co., Ltd. | Pharmaceutical composition for preventing and treating eye diseases, containing, as active ingredient, fusion protein in which tissue-penetrating peptide and anti-vascular endothelial growth factor preparation are fused |
US11369623B2 (en) | 2015-06-16 | 2022-06-28 | Prism Pharma Co., Ltd. | Anticancer combination of a CBP/catenin inhibitor and an immune checkpoint inhibitor |
US11009509B2 (en) | 2015-06-24 | 2021-05-18 | Janssen Pharmaceutica Nv | Anti-VISTA antibodies and fragments |
US10919947B2 (en) | 2015-09-01 | 2021-02-16 | Il Dong Pharmaceutical Co., Ltd. | Pharmaceutical composition containing, as active ingredient, fusion protein in which tumor-penetrating peptide and anti-angiogenesis agent are fused, for preventing and treating cancer or angiogenesis-related diseases |
US11434275B2 (en) | 2015-09-23 | 2022-09-06 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
US10766946B2 (en) | 2015-09-23 | 2020-09-08 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
WO2017055398A2 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for a costimulatory tnf receptor |
WO2017055404A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for pd1 and tim3 |
WO2017060144A1 (en) | 2015-10-07 | 2017-04-13 | F. Hoffmann-La Roche Ag | Bispecific antibodies with tetravalency for a costimulatory tnf receptor |
US11987630B2 (en) | 2016-02-12 | 2024-05-21 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
US10899836B2 (en) | 2016-02-12 | 2021-01-26 | Janssen Pharmaceutica Nv | Method of identifying anti-VISTA antibodies |
WO2017167672A1 (en) | 2016-03-29 | 2017-10-05 | F. Hoffmann-La Roche Ag | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
EP3231813A1 (en) | 2016-03-29 | 2017-10-18 | F. Hoffmann-La Roche AG | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
US11649283B2 (en) | 2016-04-15 | 2023-05-16 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
US11603403B2 (en) | 2016-04-15 | 2023-03-14 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
US11525000B2 (en) | 2016-04-15 | 2022-12-13 | Immunext, Inc. | Anti-human VISTA antibodies and use thereof |
US11603402B2 (en) | 2016-04-15 | 2023-03-14 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
WO2017194442A1 (en) | 2016-05-11 | 2017-11-16 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer and a tenascin binding moiety |
EP3243832A1 (en) | 2016-05-13 | 2017-11-15 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer and pd1 binding moiety |
US11511000B2 (en) | 2016-06-01 | 2022-11-29 | Bristol-Myers Squibb Company | Imaging methods using 18F-radiolabeled biologics |
US11344639B2 (en) | 2016-06-01 | 2022-05-31 | Bristol-Myers Squibb Company | PET imaging with PD-L1 binding polypeptides |
US11806409B2 (en) | 2016-06-01 | 2023-11-07 | Bristol-Myers Squibb Company | Imaging methods using 18F-radiolabeled biologics |
WO2018050902A2 (en) | 2016-09-15 | 2018-03-22 | Quadrucept Bio Limited | Multimers, tetramers & octamers |
US11453726B2 (en) | 2016-09-15 | 2022-09-27 | Quadrucept Bio Limited | Multimers, tetramers and octamers |
WO2018053597A1 (en) | 2016-09-23 | 2018-03-29 | Csl Limited | Coagulation factor binding proteins and uses thereof |
WO2018127473A1 (en) | 2017-01-03 | 2018-07-12 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-4-1bb clone 20h4.9 |
WO2018178055A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
WO2018178076A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
WO2018178074A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules specific for a costimulatory tnf receptor |
WO2018185045A1 (en) | 2017-04-04 | 2018-10-11 | F. Hoffmann-La Roche Ag | Novel bispecific antigen binding molecules capable of specific binding to cd40 and to fap |
WO2018185043A1 (en) | 2017-04-05 | 2018-10-11 | F. Hoffmann-La Roche Ag | Bispecific antibodies specifically binding to pd1 and lag3 |
EP4223319A2 (en) | 2017-05-26 | 2023-08-09 | MedImmune, LLC | Method and molecules |
US11466073B2 (en) | 2017-10-18 | 2022-10-11 | Csl Limited | Human serum albumin variants and uses thereof |
WO2019086500A2 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Bispecific 2+1 contorsbodies |
WO2019086499A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Novel tnf family ligand trimer-containing antigen binding molecules |
WO2019104385A1 (en) | 2017-11-29 | 2019-06-06 | Csl Limited | Method of treating or preventing ischemia-reperfusion injury |
WO2019122049A1 (en) | 2017-12-21 | 2019-06-27 | F. Hoffmann-La Roche Ag | Combination therapy of tumor targeted icos agonists with t-cell bispecific molecules |
EP3502140A1 (en) | 2017-12-21 | 2019-06-26 | F. Hoffmann-La Roche AG | Combination therapy of tumor targeted icos agonists with t-cell bispecific molecules |
WO2019197600A1 (en) | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
WO2020007817A1 (en) | 2018-07-04 | 2020-01-09 | F. Hoffmann-La Roche Ag | Novel bispecific agonistic 4-1bb antigen binding molecules |
WO2020070041A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-fap clone 212 |
WO2020070035A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules with trivalent binding to cd40 |
WO2020127628A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted superagonistic cd28 antigen binding molecules |
WO2020127618A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted agonistic cd28 antigen binding molecules |
WO2020187711A1 (en) | 2019-03-19 | 2020-09-24 | Quadrucept Bio Limited | Multimers |
WO2020208049A1 (en) | 2019-04-12 | 2020-10-15 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising lipocalin muteins |
WO2020260329A1 (en) | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Fusion of an antibody binding cea and 4-1bbl |
WO2020260326A1 (en) | 2019-06-27 | 2020-12-30 | F. Hoffmann-La Roche Ag | Novel icos antibodies and tumor-targeted antigen binding molecules comprising them |
US11725048B2 (en) | 2019-12-20 | 2023-08-15 | Hudson Institute of Medical Research | CXCL10 binding proteins and compositions thereof |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
WO2021198333A1 (en) | 2020-04-01 | 2021-10-07 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules targeting ox40 and fap |
WO2021259890A1 (en) | 2020-06-23 | 2021-12-30 | F. Hoffmann-La Roche Ag | Agonistic cd28 antigen binding molecules targeting her2 |
WO2021260064A1 (en) | 2020-06-25 | 2021-12-30 | F. Hoffmann-La Roche Ag | Anti-cd3/anti-cd28 bispecific antigen binding molecules |
WO2022101458A1 (en) | 2020-11-16 | 2022-05-19 | F. Hoffmann-La Roche Ag | Combination therapy with fap-targeted cd40 agonists |
WO2022148732A1 (en) | 2021-01-06 | 2022-07-14 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
WO2022243261A1 (en) | 2021-05-19 | 2022-11-24 | F. Hoffmann-La Roche Ag | Agonistic cd40 antigen binding molecules targeting cea |
WO2022253867A1 (en) | 2021-06-02 | 2022-12-08 | F. Hoffmann-La Roche Ag | Agonistic cd28 antigen binding molecules targeting epcam |
WO2023279092A2 (en) | 2021-07-02 | 2023-01-05 | Genentech, Inc. | Methods and compositions for treating cancer |
WO2023010095A1 (en) | 2021-07-28 | 2023-02-02 | F. Hoffmann-La Roche Ag | Methods and compositions for treating cancer |
WO2023117834A1 (en) | 2021-12-20 | 2023-06-29 | F. Hoffmann-La Roche Ag | Agonistic ltbr antibodies and bispecific antibodies comprising them |
WO2023186756A1 (en) | 2022-03-28 | 2023-10-05 | F. Hoffmann-La Roche Ag | Interferon gamma variants and antigen binding molecules comprising these |
WO2024056862A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for tumor-targeting of nk cells and use thereof |
WO2024056861A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for stimulating nk cells and use thereof |
WO2024094527A1 (en) | 2022-11-05 | 2024-05-10 | Quadrucept Bio Limited | Non-human vertebrates & cells |
Also Published As
Publication number | Publication date |
---|---|
AU2004296376B2 (en) | 2010-03-04 |
US20070160533A1 (en) | 2007-07-12 |
KR20060129246A (en) | 2006-12-15 |
WO2005056764A3 (en) | 2006-05-11 |
IL176135A0 (en) | 2006-10-05 |
AU2004296376A1 (en) | 2005-06-23 |
CA2552435A1 (en) | 2005-06-23 |
US7858739B2 (en) | 2010-12-28 |
US20140179896A1 (en) | 2014-06-26 |
US8324362B2 (en) | 2012-12-04 |
BRPI0417302A (en) | 2007-03-06 |
EP1711196A2 (en) | 2006-10-18 |
US10995131B2 (en) | 2021-05-04 |
US9328157B2 (en) | 2016-05-03 |
RU2402567C2 (en) | 2010-10-27 |
US20100310549A1 (en) | 2010-12-09 |
US8609613B2 (en) | 2013-12-17 |
MXPA06006406A (en) | 2007-03-21 |
US20070148126A1 (en) | 2007-06-28 |
US20180162926A1 (en) | 2018-06-14 |
US20120283184A1 (en) | 2012-11-08 |
US20160297869A1 (en) | 2016-10-13 |
RU2006123945A (en) | 2008-01-10 |
JP5006651B2 (en) | 2012-08-22 |
US9862758B2 (en) | 2018-01-09 |
JP2012100658A (en) | 2012-05-31 |
CN1946417A (en) | 2007-04-11 |
EP1711196A4 (en) | 2011-09-14 |
US7847062B2 (en) | 2010-12-07 |
TW200531979A (en) | 2005-10-01 |
SG149004A1 (en) | 2009-01-29 |
JP2007516707A (en) | 2007-06-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10995131B2 (en) | Libraries of modified fibronectin type III tenth domain-containing polypeptides | |
JP6947642B2 (en) | Anti-cancer fusion polypeptide | |
JP5823870B2 (en) | Bispecific EGFR / IGFIR binding molecule | |
CA2796010C (en) | Trail r2-specific multimeric scaffolds | |
AU2007325838B2 (en) | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR | |
AU2009307249B2 (en) | Bipodal peptide binder | |
US20080220049A1 (en) | Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins | |
TW201000118A (en) | Multivalent fibronectin based scaffold domain proteins | |
AU2013202605A1 (en) | Bispecific egfr/igfir binding molecules |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 11101954 Country of ref document: US |
|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 176135 Country of ref document: IL Ref document number: PA/a/2006/006406 Country of ref document: MX Ref document number: 11448171 Country of ref document: US Ref document number: 2006542876 Country of ref document: JP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004296376 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 3827/DELNP/2006 Country of ref document: IN Ref document number: 2552435 Country of ref document: CA |
|
REEP | Request for entry into the european phase |
Ref document number: 2004813230 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004813230 Country of ref document: EP Ref document number: 1020067013519 Country of ref document: KR Ref document number: 2006123945 Country of ref document: RU |
|
ENP | Entry into the national phase |
Ref document number: 2004296376 Country of ref document: AU Date of ref document: 20041206 Kind code of ref document: A |
|
WWP | Wipo information: published in national office |
Ref document number: 2004296376 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 200480041450.X Country of ref document: CN |
|
WWP | Wipo information: published in national office |
Ref document number: 2004813230 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 1020067013519 Country of ref document: KR |
|
ENP | Entry into the national phase |
Ref document number: PI0417302 Country of ref document: BR |
|
WWP | Wipo information: published in national office |
Ref document number: 11448171 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 199915 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 205110 Country of ref document: IL |