WO2001057073A2 - Clone infectieux genetiquement modifie du genome du virus de l'hepatite b (vhe), production et utilisations de ce dernier - Google Patents
Clone infectieux genetiquement modifie du genome du virus de l'hepatite b (vhe), production et utilisations de ce dernier Download PDFInfo
- Publication number
- WO2001057073A2 WO2001057073A2 PCT/IN2001/000015 IN0100015W WO0157073A2 WO 2001057073 A2 WO2001057073 A2 WO 2001057073A2 IN 0100015 W IN0100015 W IN 0100015W WO 0157073 A2 WO0157073 A2 WO 0157073A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hev
- rna
- genome
- clone
- virus
- Prior art date
Links
- 241000724675 Hepatitis E virus Species 0.000 title claims abstract description 69
- 208000015181 infectious disease Diseases 0.000 title claims abstract description 41
- 230000002458 infectious effect Effects 0.000 title claims abstract description 25
- 238000004519 manufacturing process Methods 0.000 title claims description 13
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 107
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 37
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 37
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 37
- 238000000034 method Methods 0.000 claims abstract description 32
- 108091092724 Noncoding DNA Proteins 0.000 claims abstract description 21
- 108010067390 Viral Proteins Proteins 0.000 claims abstract description 17
- 230000014509 gene expression Effects 0.000 claims abstract description 14
- 108091026890 Coding region Proteins 0.000 claims abstract description 12
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 claims abstract description 11
- 101710130262 Probable Vpr-like protein Proteins 0.000 claims abstract description 11
- 230000008569 process Effects 0.000 claims abstract description 11
- 239000012472 biological sample Substances 0.000 claims abstract description 6
- 238000002405 diagnostic procedure Methods 0.000 claims abstract description 5
- 210000005229 liver cell Anatomy 0.000 claims abstract description 5
- 239000002245 particle Substances 0.000 claims abstract description 5
- 230000003362 replicative effect Effects 0.000 claims abstract description 5
- 229960005486 vaccine Drugs 0.000 claims abstract description 5
- 238000003255 drug test Methods 0.000 claims abstract description 3
- 101000768957 Acholeplasma phage L2 Uncharacterized 37.2 kDa protein Proteins 0.000 claims abstract 4
- 101000823746 Acidianus ambivalens Uncharacterized 17.7 kDa protein in bps2 3'region Proteins 0.000 claims abstract 4
- 101000916369 Acidianus ambivalens Uncharacterized protein in sor 5'region Proteins 0.000 claims abstract 4
- 101000769342 Acinetobacter guillouiae Uncharacterized protein in rpoN-murA intergenic region Proteins 0.000 claims abstract 4
- 101000823696 Actinobacillus pleuropneumoniae Uncharacterized glycosyltransferase in aroQ 3'region Proteins 0.000 claims abstract 4
- 101000786513 Agrobacterium tumefaciens (strain 15955) Uncharacterized protein outside the virF region Proteins 0.000 claims abstract 4
- 101000618005 Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) Uncharacterized protein BpOF4_00885 Proteins 0.000 claims abstract 4
- 102100020724 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Human genes 0.000 claims abstract 4
- 101000967489 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) Uncharacterized protein AZC_3924 Proteins 0.000 claims abstract 4
- 101000823761 Bacillus licheniformis Uncharacterized 9.4 kDa protein in flaL 3'region Proteins 0.000 claims abstract 4
- 101000819719 Bacillus methanolicus Uncharacterized N-acetyltransferase in lysA 3'region Proteins 0.000 claims abstract 4
- 101000789586 Bacillus subtilis (strain 168) UPF0702 transmembrane protein YkjA Proteins 0.000 claims abstract 4
- 101000792624 Bacillus subtilis (strain 168) Uncharacterized protein YbxH Proteins 0.000 claims abstract 4
- 101000790792 Bacillus subtilis (strain 168) Uncharacterized protein YckC Proteins 0.000 claims abstract 4
- 101000819705 Bacillus subtilis (strain 168) Uncharacterized protein YlxR Proteins 0.000 claims abstract 4
- 101000948218 Bacillus subtilis (strain 168) Uncharacterized protein YtxJ Proteins 0.000 claims abstract 4
- 101000718627 Bacillus thuringiensis subsp. kurstaki Putative RNA polymerase sigma-G factor Proteins 0.000 claims abstract 4
- 101000641200 Bombyx mori densovirus Putative non-structural protein Proteins 0.000 claims abstract 4
- 101000947633 Claviceps purpurea Uncharacterized 13.8 kDa protein Proteins 0.000 claims abstract 4
- 101000948901 Enterobacteria phage T4 Uncharacterized 16.0 kDa protein in segB-ipI intergenic region Proteins 0.000 claims abstract 4
- 101000805958 Equine herpesvirus 4 (strain 1942) Virion protein US10 homolog Proteins 0.000 claims abstract 4
- 101000790442 Escherichia coli Insertion element IS2 uncharacterized 11.1 kDa protein Proteins 0.000 claims abstract 4
- 101000788354 Escherichia phage P2 Uncharacterized 8.2 kDa protein in gpA 5'region Proteins 0.000 claims abstract 4
- 101000770304 Frankia alni UPF0460 protein in nifX-nifW intergenic region Proteins 0.000 claims abstract 4
- 101000797344 Geobacillus stearothermophilus Putative tRNA (cytidine(34)-2'-O)-methyltransferase Proteins 0.000 claims abstract 4
- 101000748410 Geobacillus stearothermophilus Uncharacterized protein in fumA 3'region Proteins 0.000 claims abstract 4
- 101000772675 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) UPF0438 protein HI_0847 Proteins 0.000 claims abstract 4
- 101000631019 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uncharacterized protein HI_0350 Proteins 0.000 claims abstract 4
- 101000768938 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 8.9 kDa protein in int-C1 intergenic region Proteins 0.000 claims abstract 4
- 101000785414 Homo sapiens Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Proteins 0.000 claims abstract 4
- 101000782488 Junonia coenia densovirus (isolate pBRJ/1990) Putative non-structural protein NS2 Proteins 0.000 claims abstract 4
- 101000811523 Klebsiella pneumoniae Uncharacterized 55.8 kDa protein in cps region Proteins 0.000 claims abstract 4
- 101000818409 Lactococcus lactis subsp. lactis Uncharacterized HTH-type transcriptional regulator in lacX 3'region Proteins 0.000 claims abstract 4
- 101000878851 Leptolyngbya boryana Putative Fe(2+) transport protein A Proteins 0.000 claims abstract 4
- 101000758828 Methanosarcina barkeri (strain Fusaro / DSM 804) Uncharacterized protein Mbar_A1602 Proteins 0.000 claims abstract 4
- 101001122401 Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) Non-structural protein ORF3 Proteins 0.000 claims abstract 4
- 101001055788 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) Pentapeptide repeat protein MfpA Proteins 0.000 claims abstract 4
- 101000740670 Orgyia pseudotsugata multicapsid polyhedrosis virus Protein C42 Proteins 0.000 claims abstract 4
- 101000769182 Photorhabdus luminescens Uncharacterized protein in pnp 3'region Proteins 0.000 claims abstract 4
- 101000961392 Pseudescherichia vulneris Uncharacterized 29.9 kDa protein in crtE 3'region Proteins 0.000 claims abstract 4
- 101000731030 Pseudomonas oleovorans Poly(3-hydroxyalkanoate) polymerase 2 Proteins 0.000 claims abstract 4
- 101001065485 Pseudomonas putida Probable fatty acid methyltransferase Proteins 0.000 claims abstract 4
- 101000711023 Rhizobium leguminosarum bv. trifolii Uncharacterized protein in tfuA 3'region Proteins 0.000 claims abstract 4
- 101000948156 Rhodococcus erythropolis Uncharacterized 47.3 kDa protein in thcA 5'region Proteins 0.000 claims abstract 4
- 101000917565 Rhodococcus fascians Uncharacterized 33.6 kDa protein in fasciation locus Proteins 0.000 claims abstract 4
- 101000790284 Saimiriine herpesvirus 2 (strain 488) Uncharacterized 9.5 kDa protein in DHFR 3'region Proteins 0.000 claims abstract 4
- 101000936719 Streptococcus gordonii Accessory Sec system protein Asp3 Proteins 0.000 claims abstract 4
- 101000788499 Streptomyces coelicolor Uncharacterized oxidoreductase in mprA 5'region Proteins 0.000 claims abstract 4
- 101001102841 Streptomyces griseus Purine nucleoside phosphorylase ORF3 Proteins 0.000 claims abstract 4
- 101000708557 Streptomyces lincolnensis Uncharacterized 17.2 kDa protein in melC2-rnhH intergenic region Proteins 0.000 claims abstract 4
- 101000649826 Thermotoga neapolitana Putative anti-sigma factor antagonist TM1081 homolog Proteins 0.000 claims abstract 4
- 101000827562 Vibrio alginolyticus Uncharacterized protein in proC 3'region Proteins 0.000 claims abstract 4
- 101000778915 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Uncharacterized membrane protein VP2115 Proteins 0.000 claims abstract 4
- 102000004169 proteins and genes Human genes 0.000 claims description 92
- 230000027455 binding Effects 0.000 claims description 55
- 238000009739 binding Methods 0.000 claims description 55
- 239000002299 complementary DNA Substances 0.000 claims description 45
- 230000003612 virological effect Effects 0.000 claims description 40
- 238000000338 in vitro Methods 0.000 claims description 38
- 230000010076 replication Effects 0.000 claims description 38
- 239000000523 sample Substances 0.000 claims description 30
- 241000700605 Viruses Species 0.000 claims description 26
- 230000001413 cellular effect Effects 0.000 claims description 25
- 239000012634 fragment Substances 0.000 claims description 23
- 230000000692 anti-sense effect Effects 0.000 claims description 22
- 108020004414 DNA Proteins 0.000 claims description 17
- 238000013518 transcription Methods 0.000 claims description 17
- 230000035897 transcription Effects 0.000 claims description 17
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 11
- 102000040650 (ribonucleotides)n+m Human genes 0.000 claims description 11
- 239000003112 inhibitor Substances 0.000 claims description 11
- 238000010367 cloning Methods 0.000 claims description 10
- 230000000295 complement effect Effects 0.000 claims description 10
- 210000002966 serum Anatomy 0.000 claims description 10
- 238000004458 analytical method Methods 0.000 claims description 9
- 230000001419 dependent effect Effects 0.000 claims description 9
- 241000726306 Irus Species 0.000 claims description 8
- 108700026244 Open Reading Frames Proteins 0.000 claims description 7
- 108020000999 Viral RNA Proteins 0.000 claims description 7
- 230000029812 viral genome replication Effects 0.000 claims description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 6
- 238000012408 PCR amplification Methods 0.000 claims description 6
- 230000001105 regulatory effect Effects 0.000 claims description 6
- 108010076039 Polyproteins Proteins 0.000 claims description 5
- 108091027544 Subgenomic mRNA Proteins 0.000 claims description 5
- 230000003321 amplification Effects 0.000 claims description 5
- 201000010284 hepatitis E Diseases 0.000 claims description 5
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 5
- 101000595467 Homo sapiens T-complex protein 1 subunit gamma Proteins 0.000 claims description 4
- 102100036049 T-complex protein 1 subunit gamma Human genes 0.000 claims description 4
- 210000000941 bile Anatomy 0.000 claims description 4
- 210000004369 blood Anatomy 0.000 claims description 4
- 239000008280 blood Substances 0.000 claims description 4
- 239000013604 expression vector Substances 0.000 claims description 4
- 230000002068 genetic effect Effects 0.000 claims description 4
- 238000012163 sequencing technique Methods 0.000 claims description 4
- 239000002253 acid Substances 0.000 claims description 3
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine group Chemical group [C@@H]1([C@H](O)[C@H](O)[C@@H](CO)O1)N1C=NC=2C(N)=NC=NC12 OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 claims description 3
- 108700008625 Reporter Genes Proteins 0.000 claims description 2
- 239000002671 adjuvant Substances 0.000 claims description 2
- 238000001574 biopsy Methods 0.000 claims description 2
- 238000012203 high throughput assay Methods 0.000 claims description 2
- 230000005764 inhibitory process Effects 0.000 claims description 2
- 238000003780 insertion Methods 0.000 claims description 2
- 230000037431 insertion Effects 0.000 claims description 2
- 210000005228 liver tissue Anatomy 0.000 claims description 2
- 210000004698 lymphocyte Anatomy 0.000 claims description 2
- 210000002381 plasma Anatomy 0.000 claims description 2
- 238000003752 polymerase chain reaction Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 230000001939 inductive effect Effects 0.000 claims 1
- 238000001514 detection method Methods 0.000 abstract description 15
- 238000003556 assay Methods 0.000 abstract description 13
- 230000035772 mutation Effects 0.000 abstract description 11
- 229920002477 rna polymer Polymers 0.000 description 182
- 210000004027 cell Anatomy 0.000 description 120
- 108060004795 Methyltransferase Proteins 0.000 description 113
- 235000018102 proteins Nutrition 0.000 description 82
- 239000002773 nucleotide Substances 0.000 description 45
- 125000003729 nucleotide group Chemical group 0.000 description 44
- 230000003993 interaction Effects 0.000 description 29
- 239000000499 gel Substances 0.000 description 25
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 24
- 239000000284 extract Substances 0.000 description 21
- 230000007062 hydrolysis Effects 0.000 description 17
- 238000006460 hydrolysis reaction Methods 0.000 description 17
- 238000001890 transfection Methods 0.000 description 17
- 108091034057 RNA (poly(A)) Proteins 0.000 description 16
- 238000012217 deletion Methods 0.000 description 16
- 230000037430 deletion Effects 0.000 description 16
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 15
- 238000006243 chemical reaction Methods 0.000 description 15
- 238000002474 experimental method Methods 0.000 description 15
- 239000013598 vector Substances 0.000 description 15
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 14
- 238000004132 cross linking Methods 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- 238000009396 hybridization Methods 0.000 description 14
- 241000991587 Enterovirus C Species 0.000 description 13
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 13
- 108010083644 Ribonucleases Proteins 0.000 description 13
- 102000006382 Ribonucleases Human genes 0.000 description 13
- 230000015572 biosynthetic process Effects 0.000 description 12
- 230000029087 digestion Effects 0.000 description 12
- 238000005516 engineering process Methods 0.000 description 12
- 229920002401 polyacrylamide Polymers 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 239000011541 reaction mixture Substances 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 241000588724 Escherichia coli Species 0.000 description 11
- 241001465754 Metazoa Species 0.000 description 11
- 108020004566 Transfer RNA Proteins 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 238000003776 cleavage reaction Methods 0.000 description 11
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 10
- 241000282560 Macaca mulatta Species 0.000 description 10
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 10
- 238000010790 dilution Methods 0.000 description 10
- 239000012895 dilution Substances 0.000 description 10
- 230000007017 scission Effects 0.000 description 10
- 241000282693 Cercopithecidae Species 0.000 description 9
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 9
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 9
- 108091036407 Polyadenylation Proteins 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 229940024606 amino acid Drugs 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 229940009098 aspartate Drugs 0.000 description 9
- 241001493065 dsRNA viruses Species 0.000 description 9
- 238000001114 immunoprecipitation Methods 0.000 description 9
- 239000012528 membrane Substances 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 108091008146 restriction endonucleases Proteins 0.000 description 9
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 8
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 8
- 239000013078 crystal Substances 0.000 description 8
- 101710132601 Capsid protein Proteins 0.000 description 7
- 101710152005 Non-structural polyprotein Proteins 0.000 description 7
- 101710163270 Nuclease Proteins 0.000 description 7
- 241000283973 Oryctolagus cuniculus Species 0.000 description 7
- 101710114167 Polyprotein P1234 Proteins 0.000 description 7
- 101710124590 Polyprotein nsP1234 Proteins 0.000 description 7
- 241000710799 Rubella virus Species 0.000 description 7
- 108091081021 Sense strand Proteins 0.000 description 7
- 239000004202 carbamide Substances 0.000 description 7
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 7
- 210000004185 liver Anatomy 0.000 description 7
- 239000013642 negative control Substances 0.000 description 7
- 239000002953 phosphate buffered saline Substances 0.000 description 7
- 238000012545 processing Methods 0.000 description 7
- 210000003813 thumb Anatomy 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 101000833492 Homo sapiens Jouberin Proteins 0.000 description 6
- 101000651236 Homo sapiens NCK-interacting protein with SH3 domain Proteins 0.000 description 6
- 102100024407 Jouberin Human genes 0.000 description 6
- 102000016397 Methyltransferase Human genes 0.000 description 6
- 101710137397 Protein ORF3 Proteins 0.000 description 6
- 108020004518 RNA Probes Proteins 0.000 description 6
- 239000003391 RNA probe Substances 0.000 description 6
- 101710169459 Secreted protein ORF2 Proteins 0.000 description 6
- 230000009918 complex formation Effects 0.000 description 6
- 208000006454 hepatitis Diseases 0.000 description 6
- 231100000283 hepatitis Toxicity 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 238000011081 inoculation Methods 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 239000013641 positive control Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 241000724256 Brome mosaic virus Species 0.000 description 5
- 108010086093 Mung Bean Nuclease Proteins 0.000 description 5
- 101710172711 Structural protein Proteins 0.000 description 5
- 238000000376 autoradiography Methods 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000012228 culture supernatant Substances 0.000 description 5
- 238000005520 cutting process Methods 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 238000010348 incorporation Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 238000004153 renaturation Methods 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 238000012916 structural analysis Methods 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 108020005075 5S Ribosomal RNA Proteins 0.000 description 4
- 101000666833 Autographa californica nuclear polyhedrosis virus Uncharacterized 20.8 kDa protein in FGF-VUBI intergenic region Proteins 0.000 description 4
- 101000977027 Azospirillum brasilense Uncharacterized protein in nodG 5'region Proteins 0.000 description 4
- 101000962005 Bacillus thuringiensis Uncharacterized 23.6 kDa protein Proteins 0.000 description 4
- 108091062157 Cis-regulatory element Proteins 0.000 description 4
- 101000785191 Drosophila melanogaster Uncharacterized 50 kDa protein in type I retrotransposable element R1DM Proteins 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 101000747704 Enterobacteria phage N4 Uncharacterized protein Gp1 Proteins 0.000 description 4
- 101000861206 Enterococcus faecalis (strain ATCC 700802 / V583) Uncharacterized protein EF_A0048 Proteins 0.000 description 4
- 101000769180 Escherichia coli Uncharacterized 11.1 kDa protein Proteins 0.000 description 4
- 241000709721 Hepatovirus A Species 0.000 description 4
- 101000976301 Leptospira interrogans Uncharacterized 35 kDa protein in sph 3'region Proteins 0.000 description 4
- 101710125418 Major capsid protein Proteins 0.000 description 4
- 241000711466 Murine hepatitis virus Species 0.000 description 4
- 101000658690 Neisseria meningitidis serogroup B Transposase for insertion sequence element IS1106 Proteins 0.000 description 4
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 4
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 4
- -1 Pb2+ ions Chemical class 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 108010089430 Phosphoproteins Proteins 0.000 description 4
- 102000007982 Phosphoproteins Human genes 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 101000748660 Pseudomonas savastanoi Uncharacterized 21 kDa protein in iaaL 5'region Proteins 0.000 description 4
- 101000584469 Rice tungro bacilliform virus (isolate Philippines) Protein P1 Proteins 0.000 description 4
- 101000818096 Spirochaeta aurantia Uncharacterized 15.5 kDa protein in trpE 3'region Proteins 0.000 description 4
- 101000766081 Streptomyces ambofaciens Uncharacterized HTH-type transcriptional regulator in unstable DNA locus Proteins 0.000 description 4
- 101000804403 Synechococcus elongatus (strain PCC 7942 / FACHB-805) Uncharacterized HIT-like protein Synpcc7942_1390 Proteins 0.000 description 4
- 101000750910 Synechococcus elongatus (strain PCC 7942 / FACHB-805) Uncharacterized HTH-type transcriptional regulator Synpcc7942_2319 Proteins 0.000 description 4
- 101000644897 Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) Uncharacterized protein SYNPCC7002_B0001 Proteins 0.000 description 4
- 101000916336 Xenopus laevis Transposon TX1 uncharacterized 82 kDa protein Proteins 0.000 description 4
- 101001000760 Zea mays Putative Pol polyprotein from transposon element Bs1 Proteins 0.000 description 4
- 101000678262 Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) 65 kDa protein Proteins 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 210000003811 finger Anatomy 0.000 description 4
- 238000003119 immunoblot Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 239000000543 intermediate Substances 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- RVPVRDXYQKGNMQ-UHFFFAOYSA-N lead(2+) Chemical compound [Pb+2] RVPVRDXYQKGNMQ-UHFFFAOYSA-N 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 4
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 4
- 238000003757 reverse transcription PCR Methods 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 238000002864 sequence alignment Methods 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- 101000977023 Azospirillum brasilense Uncharacterized 17.8 kDa protein in nodG 5'region Proteins 0.000 description 3
- 101000961984 Bacillus thuringiensis Uncharacterized 30.3 kDa protein Proteins 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 208000001490 Dengue Diseases 0.000 description 3
- 206010012310 Dengue fever Diseases 0.000 description 3
- 101000644901 Drosophila melanogaster Putative 115 kDa protein in type-1 retrotransposable element R1DM Proteins 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 101000747702 Enterobacteria phage N4 Uncharacterized protein Gp2 Proteins 0.000 description 3
- 101000758599 Escherichia coli Uncharacterized 14.7 kDa protein Proteins 0.000 description 3
- 241000711549 Hepacivirus C Species 0.000 description 3
- 101000768930 Lactococcus lactis subsp. cremoris Uncharacterized protein in pepC 5'region Proteins 0.000 description 3
- 101000976302 Leptospira interrogans Uncharacterized protein in sph 3'region Proteins 0.000 description 3
- 101000778886 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) Uncharacterized protein LA_2151 Proteins 0.000 description 3
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 3
- 101001121571 Rice tungro bacilliform virus (isolate Philippines) Protein P2 Proteins 0.000 description 3
- 241000710960 Sindbis virus Species 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 101000818098 Spirochaeta aurantia Uncharacterized protein in trpE 3'region Proteins 0.000 description 3
- 101001026590 Streptomyces cinnamonensis Putative polyketide beta-ketoacyl synthase 2 Proteins 0.000 description 3
- 101000750896 Synechococcus elongatus (strain PCC 7942 / FACHB-805) Uncharacterized protein Synpcc7942_2318 Proteins 0.000 description 3
- 102000004357 Transferases Human genes 0.000 description 3
- 108090000992 Transferases Proteins 0.000 description 3
- 241000710886 West Nile virus Species 0.000 description 3
- 101000916321 Xenopus laevis Transposon TX1 uncharacterized 149 kDa protein Proteins 0.000 description 3
- 101000760088 Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) 20.9 kDa protein Proteins 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical class N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000003184 complementary RNA Substances 0.000 description 3
- 238000004925 denaturation Methods 0.000 description 3
- 230000036425 denaturation Effects 0.000 description 3
- 208000025729 dengue disease Diseases 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 208000005252 hepatitis A Diseases 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 239000012133 immunoprecipitate Substances 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 239000012723 sample buffer Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 210000002845 virion Anatomy 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 108020004465 16S ribosomal RNA Proteins 0.000 description 2
- 101000787132 Acidithiobacillus ferridurans Uncharacterized 8.2 kDa protein in mobL 3'region Proteins 0.000 description 2
- 101000827262 Acidithiobacillus ferrooxidans Uncharacterized 18.9 kDa protein in mobE 3'region Proteins 0.000 description 2
- 241000724328 Alfalfa mosaic virus Species 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- 101000811747 Antithamnion sp. UPF0051 protein in atpA 3'region Proteins 0.000 description 2
- 101000827607 Bacillus phage SPP1 Uncharacterized 8.5 kDa protein in GP2-GP6 intergenic region Proteins 0.000 description 2
- 101000961975 Bacillus thuringiensis Uncharacterized 13.4 kDa protein Proteins 0.000 description 2
- 241001429251 Beet necrotic yellow vein virus Species 0.000 description 2
- 101000964407 Caldicellulosiruptor saccharolyticus Uncharacterized 10.7 kDa protein in xynB 3'region Proteins 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 239000004971 Cross linker Substances 0.000 description 2
- 241000710188 Encephalomyocarditis virus Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 101000768777 Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) Uncharacterized 50.6 kDa protein in the 5'region of gyrA and gyrB Proteins 0.000 description 2
- 101000572796 Hepatitis E virus genotype 1 (isolate Human/China/HeBei/1987) RNA-directed RNA polymerase Proteins 0.000 description 2
- 101000607404 Infectious laryngotracheitis virus (strain Thorne V882) Protein UL24 homolog Proteins 0.000 description 2
- 241000710842 Japanese encephalitis virus Species 0.000 description 2
- 101000735632 Klebsiella pneumoniae Uncharacterized 8.8 kDa protein in aacA4 3'region Proteins 0.000 description 2
- 239000007993 MOPS buffer Substances 0.000 description 2
- 241000282553 Macaca Species 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 239000004677 Nylon Substances 0.000 description 2
- 208000025174 PANDAS Diseases 0.000 description 2
- 208000021155 Paediatric autoimmune neuropsychiatric disorders associated with streptococcal infection Diseases 0.000 description 2
- 240000004718 Panda Species 0.000 description 2
- 235000016496 Panda oleosa Nutrition 0.000 description 2
- 108010021757 Polynucleotide 5'-Hydroxyl-Kinase Proteins 0.000 description 2
- 102000008422 Polynucleotide 5'-hydroxyl-kinase Human genes 0.000 description 2
- 102000055027 Protein Methyltransferases Human genes 0.000 description 2
- 108700040121 Protein Methyltransferases Proteins 0.000 description 2
- 101710165374 Putative helicase Proteins 0.000 description 2
- 108090000944 RNA Helicases Proteins 0.000 description 2
- 102000004409 RNA Helicases Human genes 0.000 description 2
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 2
- 241001516645 Simian hemorrhagic fever virus Species 0.000 description 2
- 101000818100 Spirochaeta aurantia Uncharacterized 12.7 kDa protein in trpE 5'region Proteins 0.000 description 2
- 101001037658 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Glucokinase Proteins 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 241000723873 Tobacco mosaic virus Species 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 206010058874 Viraemia Diseases 0.000 description 2
- 108010087302 Viral Structural Proteins Proteins 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 244000309466 calf Species 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000001447 compensatory effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 210000004292 cytoskeleton Anatomy 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 238000009509 drug development Methods 0.000 description 2
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 2
- 229960005542 ethidium bromide Drugs 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 230000002440 hepatic effect Effects 0.000 description 2
- 108700008776 hepatitis C virus NS-5 Proteins 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 210000004201 immune sera Anatomy 0.000 description 2
- 229940042743 immune sera Drugs 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- 230000000869 mutational effect Effects 0.000 description 2
- 230000009871 nonspecific binding Effects 0.000 description 2
- 229920001778 nylon Polymers 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- 238000012808 pre-inoculation Methods 0.000 description 2
- 235000021251 pulses Nutrition 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000002901 radioactive waste Substances 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 229920006298 saran Polymers 0.000 description 2
- 229940083575 sodium dodecyl sulfate Drugs 0.000 description 2
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 2
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- OSBLTNPMIGYQGY-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetic acid;boric acid Chemical compound OB(O)O.OCC(N)(CO)CO.OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O OSBLTNPMIGYQGY-UHFFFAOYSA-N 0.000 description 1
- ZLHLYESIHSHXGM-UHFFFAOYSA-N 4,6-dimethyl-1h-imidazo[1,2-a]purin-9-one Chemical compound N=1C(C)=CN(C2=O)C=1N(C)C1=C2NC=N1 ZLHLYESIHSHXGM-UHFFFAOYSA-N 0.000 description 1
- 238000012232 AGPC extraction Methods 0.000 description 1
- 208000007788 Acute Liver Failure Diseases 0.000 description 1
- 206010000804 Acute hepatic failure Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- 101001057129 Bacillus cereus Enterotoxin Proteins 0.000 description 1
- 101000933555 Bacillus subtilis (strain 168) Biofilm-surface layer protein A Proteins 0.000 description 1
- 235000017166 Bambusa arundinacea Nutrition 0.000 description 1
- 235000017491 Bambusa tulda Nutrition 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 240000002791 Brassica napus Species 0.000 description 1
- 235000011293 Brassica napus Nutrition 0.000 description 1
- 235000000540 Brassica rapa subsp rapa Nutrition 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 229910052693 Europium Inorganic materials 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 206010019799 Hepatitis viral Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 108091006054 His-tagged proteins Proteins 0.000 description 1
- 101001128634 Homo sapiens NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial Proteins 0.000 description 1
- 241000430519 Human rhinovirus sp. Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 101710203526 Integrase Proteins 0.000 description 1
- 108010015268 Integration Host Factors Proteins 0.000 description 1
- 102100024319 Intestinal-type alkaline phosphatase Human genes 0.000 description 1
- 101710184243 Intestinal-type alkaline phosphatase Proteins 0.000 description 1
- 229920006063 Lamide® Polymers 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 240000004658 Medicago sativa Species 0.000 description 1
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 description 1
- 241000404146 Minois Species 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 101000700655 Mycobacterium leprae (strain TN) Serine-rich antigen Proteins 0.000 description 1
- 102100032194 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial Human genes 0.000 description 1
- 241000933095 Neotragus moschatus Species 0.000 description 1
- 101710113540 ORF2 protein Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 244000082204 Phyllostachys viridis Species 0.000 description 1
- 235000015334 Phyllostachys viridis Nutrition 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 101000879211 Pseudomonas phage PAJU2 Structural protein 2 Proteins 0.000 description 1
- 101710090523 Putative movement protein Proteins 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 230000007022 RNA scission Effects 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 101800001554 RNA-directed RNA polymerase Proteins 0.000 description 1
- 108091028733 RNTP Proteins 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 101000773449 Sinorhizobium fredii (strain NBRC 101917 / NGR234) Uncharacterized HTH-type transcriptional regulator y4sM Proteins 0.000 description 1
- 102000039471 Small Nuclear RNA Human genes 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- ABBQHOQBGMUPJH-UHFFFAOYSA-M Sodium salicylate Chemical compound [Na+].OC1=CC=CC=C1C([O-])=O ABBQHOQBGMUPJH-UHFFFAOYSA-M 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 101000987243 Streptomyces griseus Probable cadicidin biosynthesis thioesterase Proteins 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 239000008051 TBE buffer Substances 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000003929 Transaminases Human genes 0.000 description 1
- 108090000340 Transaminases Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 231100000836 acute liver failure Toxicity 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000005904 alkaline hydrolysis reaction Methods 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 108010058966 bacteriophage T7 induced DNA polymerase Proteins 0.000 description 1
- 239000011425 bamboo Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- YTRQFSDWAXHJCC-UHFFFAOYSA-N chloroform;phenol Chemical compound ClC(Cl)Cl.OC1=CC=CC=C1 YTRQFSDWAXHJCC-UHFFFAOYSA-N 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 238000002337 electrophoretic mobility shift assay Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 125000002796 nucleotidyl group Chemical group 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 238000007639 printing Methods 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- OCQZXMCGTAWGEQ-UHFFFAOYSA-N prop-2-enamide;n-[(prop-2-enoylamino)methyl]prop-2-enamide Chemical compound NC(=O)C=C.C=CC(=O)NCNC(=O)C=C OCQZXMCGTAWGEQ-UHFFFAOYSA-N 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 230000009822 protein phosphorylation Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 238000010583 slow cooling Methods 0.000 description 1
- 108091029842 small nuclear ribonucleic acid Proteins 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229960004025 sodium salicylate Drugs 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 229940063673 spermidine Drugs 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 230000007444 viral RNA synthesis Effects 0.000 description 1
- 201000001862 viral hepatitis Diseases 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/28011—Hepeviridae
- C12N2770/28111—Hepevirus, e.g. hepatitis E virus
- C12N2770/28121—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/28011—Hepeviridae
- C12N2770/28111—Hepevirus, e.g. hepatitis E virus
- C12N2770/28161—Methods of inactivation or attenuation
- C12N2770/28162—Methods of inactivation or attenuation by genetic engineering
Definitions
- the present invention relates to a unique genetically engineered nucleic acid cDNA clone of hepatitis E virus (HEV) genome found to be infectious in cell culture and to a process for the in-vitro synthesization of such a cDNA clone of HEV. Also included within the scope of the invention is the expression from said clone of viral proteins adapted for use in the detection of antibodies to HEV in biological samples and a diagnostic test kit for the presence of HEV infection essentially comprising the expressed proteins.
- HEV hepatitis E virus
- hepatitis A and hepatitis B Two types of the hepatitis virus were initially identified which were referred to as hepatitis A and hepatitis B. Other types of this virus which were known but until they were positively identified were lumped collectively under the identity "non A - non B" (NANB) hepatitis virus. Subsequently, as a result of epidemiological studies and animal transmission, the existence of two or more viruses within the so-called entity NANB hepatitis viruses were suspected. One type of these viruses was found to be parenterally transmittable and this was identified as a flavivirus referred to as hepatitis C. -[Alter et al., Lancet 1, 459-463 (1978); Hollinger et al., Intervirology 10, 60-68 ( 1978); Tabor et al., Lancet 1, 463-466 (1978)].
- HEV hepatitis E virus which is conveniently abbreviated as HEV. It is HEV which forms the study by the applicants and the subject of the present invention. HEV is now established as an etiological agent of both the epidemic and sporadic forms of water-borne hepatitis which is endemic to the Indian sub-continent and prevalent in most parts of the developing world. In fact, infection due to HEV accounts for one third of the sporadic acute viral hepatitis and almost all the described epidemics in the Indian subcontinent [26, 39]. It is a major health problem in tropical and sub- tropical parts of the world.
- HEV has been provisionally classified as the prototype member of the group of hepatitis-E viruses. HEV has been found to have a positive strand polyadenvlated ribonucleic acid (RNA) as genome with a size of -7.2 kb and possessing three open reading frames identified as ORF 1, ORF 2 and ORF 3.
- RNA polyadenvlated ribonucleic acid
- ORF 1 encodes the putative non-structural polyprotein including domains representative of (a) a viral methyltransferase, (b) a papain-like cysteine protease, (c) a RNA helicase, and (d) a viral RNA dependent RNA polymerase.
- ORF 2 encodes an -88 kDa glycoprotein that is the major viral capsid protein.
- ORF 3 encodes a 13.5 kDa phosphoprotein of unknown function.
- NCR's non-coding regions
- ORF1 is the largest in size, starts 27 nucleotides downstream of the 5' end and terminates at position 5079, resulting in a protein of 1683 amino acids.
- ORF 2 begins 37 nucleotides downstream of ORF1 and codes for a protein of 660 amino acids.
- the third ORF (ORF3) is the smallest in size, encoding a protein o( 123 amino acids and overlaps with ORF1 at its terminal base [55].
- Non-structural ORF 1 is believed to code for a putative polyprotein which has different motifs, such as those for a viral methyltransferase, a papain-like cysteine protease, a RNA helicase and a RNA dependant RNA polymerase [28]. However none of these putative functional regions have been characterized so far.
- the structural ORFs have been expressed in prokaryotic and eukaryotic systems and immunogenicity of the resulting proteins have been reported in a number of studies [20, 34, 40].
- the inventors have earlier expressed ORF2 and ORF3 in animal cells.
- the ORF2 protein (pORF2) is an 88 kDa glycoprotein that is expressed intracellularly as w ell as on the cell surface [23].
- the ORF3 protein (pORF3) is a 13.5 kDa phosphoprotein. which is phosphorylated by the cellular mitogen activated protein kinase and associates with the cytoskeleton [64].
- the hepatitis E virus has been cloned and sequenced from several countries, among them India, Pakistan, Sri Lanka, China and Mexico. However, only partial expression of the viral structural proteins has been described so far by other workers.
- the inventors have focussed on two major areas: a De eloping a complete virus genome clone which can be used to infect cells and thereby provide a valuable in-vitro system for designing and analysing the effects of drugs and other inhibitors and vaccines which can help in the piev ention 01 cure of HEV associated liver disease and or severe complications arising therefrom, and b Studying the potential of the 3' NCR of HEV in serving as the replication initiation site for HEV RNA genome
- the present invention provides a unique genetically engineered nucleic acid clone of hepatitis E virus (HEV) genome w hich comprises the complete structural and non-structural genes I e the complete coding sequence of HEV flanked by the 5' and 3' non-coding regions, along w ith a 3 polyadenylated tail to the 3' non-codmg region said clone being capable of infecting cultured vei cells and replicating, transcribing and assembling the HEV theiein
- the nucleic acid clone of the invention comprises a DNA which is complementary to the hepatitis E virus genome Con eniently, this clone is deriv ed using multiple PCR amplification followed by assembly strategy
- the complete coding sequence (Seq ID No 1 ) of the nucleic acid clone of HEV genome of the present invention is as follows SEQ ID No.l : atg gaggcccatc agtttctcaa ggctcccggc atcactactg ctgttgagca ggctgctcta gccacggcca actctgccct ggcgaatgct gtggtagtta ggccttttct ttctcaccag cagattgaga ttctcattaa cctaatgcaa cctcgccagc ttgttttccg ccccgaggttttctggaatc aacccatcca gcgtgtcatt cataacgagc tggagcttta ctgcgcttctggaacccatcca g
- the coding sequence in the HEV genome is flanked by 5' and 3' non- coding regions (NCRs) which are 27 and 68 nucleotides long, respectively [55]. These non-coding regions are projected as having the potential to play an important role as cis- acting elements for the genomic RNA replication of HEV as has been reported for other positive strand RNA viruses [21, 30, 49, 52, 56, 62].
- the 5' non-coding region of the nucleic acid clone of HEV genome of the present invention is homologous or complementary to an RNA sequence (Seq. ID No. 2) selected from:
- the 3' non-coding region of the nucleic acid clone of HEV genome of the present invention is homologous or complementary to an RNA sequence (Seq. ID No. 3) selected from:
- the complete sequence (Seq. ID No. 4) of the nucleic acid clone of HEV genome of the present invention comprises:
- the non-structural gene (ORF1) of the nucleic acid clone of HEV genome codes for the polyprotein having the following amino acid sequence Seq. ID No. 5:
- ORF1 MEAHQFLKAPGITTAVEQAALATANSALANAVVVRPFLSHQQIEILINLM
- the nucleic acid clone of HEV genome of the present invention comprises a DNA which is complementary to the hepatitis E virus genome.
- this DNA complementary to the hepatitis E genome is a DNA from an epidemic strain derived from Abrahampatnam, Andhra Pradesh, India.
- the inventors have analyzed the simulated structure of the 3' end and its interaction with the viral RdRp and cellular proteins, which w ere partially characterized by RNase protection and UV-crosslinking assays. Also analyzed were the structural aspects of the HEV RdRp by comparison with results from computer predictions of secondary and tertiary structures of various representative RdRps [38]. with special reference to the crystal structure of the poliovirus RdRp [19]. This in itself can serve as a target for drug development.
- the 3' non-coding region of the nucleic acid clone of HEV genome of the present invention is characterized by the presence of cis-acting regulatory elements capable of interacting with recombinant viral RNA-dependent RNA polymerase (RdRp) and cellular proteins for virus grow th, said elements being thus usable as targets for inhibitors of virus replication.
- inhibitors of virus replication include anti-sense ribonucleic acid (RNA). ribozymes. analogues and inhibitors of the viral replicase.
- the cis-acting regulatory elements of the 3' end which are usable as targets for inhibitors of virus replication possess the following sequence Seq ID No. 8: SEQ ID No. 8:
- the cis-acting regulatory elements of the 3' end which are usable as targets for inhibitors of virus replication possess the structure shown in Figure 8A of the accompanying drawings.
- the 3' polyadenylated tail of the 3' non-coding region preferably comprises at least 3 adenosine residues.
- a unique genetic engineered nucleic acid clone of hepatitis E virus genome of the invention which can be transcribed to produce infectious transcripts, has a sequence number AF076239.
- HEV RNA was used to study the replication of the virus v ia gene transfer.
- HEV genome was cloned downstream of the T7 promoter. transcribed in-vitro and transcripts were characterized.
- a process for the production of a unique genetic engineered nucleic acid clone of hepatitis E virus (HEV) genome which comprises:
- the full-length cDNA clone or the coding components thereof may be cloned in an expression vector system to induce therefrom the expression of viral proteins.
- the viral proteins thus expressed from the full-length cDNA clone or its coding components find use in the detection of antibodies to HEV in biological samples such as blood, serum, plasma, blood cells, lymphocytes, bile and liver tissue biopsy.
- the invention also includes within its scope an in-vitro method for detecting antibodies to HEV in a biological sample obtained from a subject, which method comprises:
- the present invention also includes a diagnostic test kit for the presence of HEV infection essentially comprising viral proteins expressed from the unique genetically engineered full-length cDNA clone of HEV genome of the invention.
- the unique nucleic acid clone of hepatitis E virus (HEV) genome can be mutated to produce non-infectious HEV particles. These non-infectious HEV particles so produced can be combined with a pharmaceutically acceptable adjuvant to produce an HEV vaccine.
- HEV hepatitis E virus
- the invention also envisages a high throughput assay system for rapid anti-HEY drug testing which comprises the nucleic acid clone of hepatitis E virus (HEV) genome described herein modified by the insertion therein of a reporter gene for the analysis o ⁇ ⁇ replication inhibition.
- HEV hepatitis E virus
- along with the non-codmg regions were cloned using sub-genomic PCR amplification followed by reconstruction strategy [2, 23]
- the cDNA clone complementary to the hepatitis E v irus genome was derived from an Indian isolate of HEV from an epidemic strain from Abrahampatnam, A P , India
- the clone in question was generated using multiple PCR amplification followed by assembly strategv and possess the following sequence Seq ID No 4 SEQ ID No. 4:
- RNA was resolved on a 0.8% formaldehyde denaturing agarose gel and transferred to nylon membrane (Hybond, Amersham Intl.. UK) m the presence of 20X SSC.
- the membrane was washed with 10X SSC solution, air-dried and subjected to UV-crosslinking in an ultraviolet crosslinker (Stratagene, Germany)
- the membrane was put in prehybridization solution (6X SSC, 5X Denhardt's solution, 0.5% Sodium dodecyl sulfate (SDS), 100 ⁇ g calf thymus DNA per ml of the solution) and incubated at 68°C foi 6 hours in hybridization oven (Shel Lab, Model 1004, USA).
- the hybridization was subsequently carried out in fresh pre-hyb ⁇ dization solution containing 1x10 cpm of an alpha J ⁇ P dCTP labelled probe generated from the full-length ORF2 clone of HEV [39].
- the probe was prepared by using a commercial random priming kit (Prime-it, Stratagene, Germany) as per manufacturer's protocol.
- the membrane was washed as follow s: a) 2x SSC, 0.1% SDS for 5 minutes at room temperature, b) 0 2x SSC, 0.1% SDS for 5 minutes at room temperature twice, c) 0 SSC, 0.1 % SDS for 15 minutes at 42°C, and d) 0 l x SSC, 0.1% SDS for 15 minutes at 68°C
- the membrane was wrapped in Saran Wrap and exposed for autoradiography using Kodak X-Omat AR film with Du-Pont intensifying screens (Du-Pont, USA).
- lane 1 shows the RNA on staining the gel w ith ethidium bromide
- Lane 2 shows the RNA as detected by northern hybridization using HEV specific probe
- Lane M shows the molecular size RNA markei in kilobases 01/57073 23
- HEV transcripts The majority of the HEV transcripts were bout 7.2 Kb in size corresponding to complete genome w hen compared with standard RNA molecular weight marker ( Life Technologies, USA).
- HepG2 cells were maintained in Dulbecco's modified Eagle's Medium (D EM ) containing 10% fetal calf serum (Life Technologies, USA). Cells at about -50% confluency were used for transfection of HEV RNA. Twenty microgram of in-vitro produced RNA was transfected by liposome induced method (Lipofectamine. Life Technologies, USA) as per the manufacturer's guidelines. The plasmid vector (pSGI) served as a control for the transfection. For each 60-mm diameter culture dish. 20 ⁇ g of the HEY RNA and 10 ⁇ l of lipofectamine were diluted in 1.5 ml of serum-free medium.
- D EM Dulbecco's modified Eagle's Medium
- pSGI plasmid vector
- the mixture was kept at room temperature for 30 minutes and gently overlaid on to the monolayer.
- Fresh medium with 10% fetal calf serum was replaced after 6 hours and the cells were kept in an atmosphere of 5% CO2- After 72 hours the cells were harvested for extraction of total RNA.
- Transfected cells were pulse labelled with (100 ⁇ Ci/ ml/ 60 mm plate) ⁇ " S methionine-cysteine (Promix, Amersham Intl., UK) for four hours at 72 hours post transfection in methionine-cysteine deficient DMEM (Sigma, USA).
- the metabolically labelled cells were harvested and proteins were immunoprecipitated using HEV speci fic polyclonal antibodies. Similar labelling experiments were also carried out at 12. 24. 36. 72 and 96 hours to determine the expression kinetics of the viral RNA dependent RN.A Polymerase (RdRp).
- a batch of the HEV RNA transfected cells were maintained in the culture and allowed to grow for next 45 days (8 passages). These cells w ere analyzed at 3. 7, 15, 33 and 45 days post transfection for the presence of anti-sense RNA replicativ e intermediates using strand-specific PCR.
- RNA transfected cells were positive for sense as well as anti-sense strands of the HEV genome at 3, 7, 15 and 33 days.
- RNA extracted at 72 hours (3 days) was carried out to determine an approximate ratio of sense and anti-sense strands.
- sense strand detection the HepG2 cells transfected with plasmid pSGI and serum from HEV infected monkey with viremia served as negative and positive controls respectively.
- anti-sense detection RNA isolated from HEV infected monkey liver containing anti- sense replicative intermediate served as positive control whereas the bile fluid or serum from the same viremic animal served as negative control.
- the reverse transcription was carried out using either sense or anti-sense primer.
- RNA in the reaction mix was degraded by digestion with RNase H (2 units) and RNase A (1 ⁇ g) (Promega, USA). Following RNase treatment the reaction mix was extracted once with phenol/ chloroform and ethanol precipitated. The precipitated cDNA was used for PCR amplification using both sense and anti-sense primers.
- Figure 3A in this figure represents detection of the negative-sense strand of HEV RNA and Figure 3B represents detection of the positive-sense strand of HEV RNA. Explanation of the other integers shown in Figure 3 are as follows: Figure 3A: Detection of negative strand of HEV RNA:
- RNA ( l ⁇ g) extracted from HepG2 cells transfected w ith in-vitw synthesized HEV RNA at 72 houis (Neat) 2 through 9 Log dilution of the transfected HepG2 cell RNA from 10 through 10
- total RNA (30 ⁇ g) extracted from the transfected cells was immobilized on a nylon membrane (Amersham Intl , UK) using a Hyb ⁇ slot manifold (Life Technologies, USA) RNA from cells transfected with plasmid pSGI was used as negative control
- Sense and anti-sense specific ⁇ boprobes were prepared by transcription with T7 and SP6 polymerases (Ribopiobc system-T7 and Riboprobe system-SP6, Promega, USA) using direct and rev eise onented clones of a HEV cDNA encompassing nucleotide 1-457 in pCR-Scnpt SK (-) (Stratagene, Germany) and pGEM-T (Promega, USA) vectors respectiv elv
- the transcription leaction was carried out in the presence of alpha 3 p UTP (2500 Ci mmol Ameisham Intl , UK) Prior to m-vi o transcription, the template DNA as lineaiized bv restriction enzyme digestion at the end of the fragment The reaction mixtuie w as tieated w ith DNasel. extracted with phenol/ chloroform and ethanol piecrpitated as
- Panel A of Figure 4 shows hybridisation with alpha 33 P UTP labelled riboprobe of anti-sense polarity.
- Slots 1, 2, 3 and 4 represent the following:
- Panel B of Figure 4 shows hybridisation with alpha " J P UTP riboprobe of sense polarity.
- Slots 1, 2, 3 and 4 represent the following: 1. In-vitro synthesized HEV RNA of negative sense polarity (Positive control)
- RNA isolated from HepG2 cells transfected with pSGI vector as control In-vitro synthesized sense and anti-sense HEV RNA were used to validate the specificity of hybridisation method in detecting the strands. The presence of anti-sense HEV RNA was reconfirmed by hybridisation.
- the cells transfected with HEV RNA according to the procedure of Example 3 were lysed in 750 ⁇ l of RIP A buffer (10 mM Tris-HCl pH 8.0, 140 mM NaCl. 5 mM Iodoacetamide, 0.5% Triton X-100, 1 % SDS. 1% sodium deoxycholate. 2 mM phenymethylsulfonyl fluoride).
- the clarified lysate was incubated with 7 ⁇ l of anti- ORF2.
- anti-ORF3 or anti-ORFl putative anti-Methyl transferase (anti-met).
- putativ e anti-Helicase anti-hel
- putative anti-RNA dependent RNA Polymerase RdRp
- the polyclonal antibodies were raised in rabbits against the structural proteins (pORF2, pORF3) and components of non-structural polyprotein pORFl (putative methyl transferase, helicase and RdRp regions) as described elsewhere [2. 40].
- the antigen-antibody complexes formed were further incubated w ith 100 ⁇ l 10% suspension of pre-swollen Protein A Sepharose-4B (Pharmacia. Upssala. Sweden) and the reaction mixture was kept at 4°C with slow end to end shaking.
- reaction mixture was centrifuged for one minute at 10,000 rpm in a refrigerated microcentrifuge (Hermle, Germany). Supernatant was discarded as radioactive waste and the beads were washed thrice with 1 ml of RIPA buffer for 10 minutes at 4°C with shaking.
- the complex was boiled with 50 ⁇ l of 2X SDS-PAGE sample buffer (50 mM Tris-HCl pH 6.8, 2% SDS, 5% 2-Beta mercaptoethanol. 0.1 % bromophenol blue) and analyzed on a SDS 6-15% gradient PAGE. The gel was treated with 0.5 M sodium salicylate, washed, dried and exposed for autoradiography as described above.
- HEV ORF2 and ORF3 proteins were detected by immunoprecipitation with their corresponding specific antibodies.
- An autoradiograph showin ⁇ immunoprecipitation of the structural proteins from the HEV RNA transfected HepG2 cells is depicted in Figure 5A of the drawings.
- the arrow marked signals in the lane 2 and 4 represent the pORF2 (-72 kDa) and pORF3 (13.5 kDa) respectively.
- the pSGI transfected cells were immunoprecipitated with anti-ORF2 and anti-ORF3 antibodies ( Figure 5A, lanes 1 and 3) to serve as control.
- the immunoprecipitates were analyzed on SDS 6-15% gradient PAGE and visualized by fluorography. The molecular sizes of C labelled markers (in kilodaltons) are indicated on the right (Amersham Int.. UK).
- the signals corresponding to putative domains of methyl transferase (-35 kDa) and helicase (-38 kDa) could be detected by immunoprecipitation. These are autoradiographically depicted in Figures 5B of the drawings. The putative helicase and methyl transferase were detected in samples prepared at 72 hours post transfection.
- the autoradiograph of Figure 5B shows immunoprecipitation of putative domains of non- structural polyprotein corresponding to methyl transferase and helicase from the HEV RNA transfected HepG2 cells.
- the arrow marked signals in lanes 2 and 3 represent the signals corresponding to putative methyl transferase (-35 kDa) and helicase (-38 kDa). respectively.
- the mock transfected pSGI cells were immunoprecipitated with anti-met and anti-hel antibodies ( Figure 5B, lanes 1 and 4) to serve as control.
- the immunoprecipitates were analyzed on SDS 6-15% gradient PAGE and visualized by fluorography. Molecular size markers (in kilodaltons) are indicated on the right (Rainbow markers. Amersham Int.. UK).
- RdRp RNA dependent RNA polymerase
- the autoradiograph of Figure 5C shows immunoprecipitation of putative domains of non- structural polyprotein corresponding to RNA dependent RNA polymerase (RdRp) from the HEV RNA transfected HepG2 cells.
- the immunoprecipitation was carried out using anti-RdRp antibodies at the stated 12, 24 and 36 hours post transfection.
- the HepG2 cells were transfected with pSGI vector and immunoprecipitated at 36 hours with the same antibody.
- the immunoprecipitates were analyzed on SDS 6-15% gradient PAGE and visualized by fluorography. Molecular size markers (in kilodaltons) are indicated on the right (Rainbow markers, Amersham Int., UK). Putative RdRp could not be detected in transfected cells at 72 and 96 hours (Data not shown).
- transfection was carried out on cells grow n on cover slips (30 mm diameter). After 72 hours, the cells on coverslips were washed tvv ice O 01/5
- H and K of Figure 6 represent the lmmunofluorescent staining of the HEV transfected HepG2 cells with ant ⁇ -pORF2, ant ⁇ -pORF3, anti-met, anti-hel and anti-RdRp antibodies, respectively
- Panels A, C, E, G and J represent the immunostaining of the control HepG2 cells w ith the same antibodies corresponding to the test panel All the immunostaining w as earned out at 72 houi post tiansfection except that with the anti-RdRp antibodies w hich w as performed on the 24 hours post transfection
- HEV RNA transcribed according to Example 2
- RNAse inhibitor Promega, USA
- HEV antibodies w ere detected by m-house ELISA system using recombinant HEV proteins (pORF2.
- HEV RNA was observ ed w ith the help of RT-PCR in the sera collected between days 24 to 37. During this period (24-37 days) the AST and ALT values increased to between 1.5 to 2.5 (53-100 IL liter) times normal level.
- ORF2 and ORF3 viral proteins were detected after 4 weeks and persisted for the next 14 davs
- the animals (M-1927. M-2197) which received in-vitro produced HEV RNA as well as the control monkey (M-1761) remained normal with no rise in ALT and AST v alues and no seroconv ersion for antibodies were observed. They also remained negative foi HEV RNA in semm (viremia) throughout the follow up period.
- the IgG anti-HEV antibodies w eie detected in the infected monkey (M-1690) 3 months after the inoculation
- Figure 7 of the drawings represents a photograph of 2% agarose gel depicting the RT-nested PCR products (343bp) for HEV genome amplified from the sei uin of infected rhesus Macaca mulata (M-1690)
- Lane P indicates Positive control.
- Lane N indicates the control monkey (M-1761)
- Lane M represents 100 bp DNA laddei ( Li fe Technologies, USA)
- Lanes 1 , 2, 3, 4 and 5 represent the serum collected from the monkev M-1690 on days 24, 28. 33, 37 and 43, respectively, post injection
- the arrow indicates amplified fragments from HEV genome EXAMPLE 7
- Stem-loop structures 1 and 2 (SL1, SL2) comprise nucleotides 7173-7194 and 7089- 7163, respectively, separated by a single strand region (SS) of nt 7164-7172.
- the SL 1 structure involves the poly(A) stretch at its 3' end in base-pairing.
- PCR-based strategy was used to generate the cDNA clones for the production of RNA transcripts corresponding to the 3' end of the HEV genome and its various mutant forms.
- a schematic representation and description of the constructs is shown in Figure 9 of the drawings.
- Forward and reverse primers were designed using the OLIGO 4.0 software and synthesized on an automated DNA synthesizer (Model 392, Applied Biosystems). These primers are identified in Table I at the end of this description.
- Such primers were used to amplify regions of the 3' end using a HEV cDNA 6046-7194 nt pCRScript clone [40] as a template [which was later used for the construction of an infectious HEV cDNA clone pSGl-HEV(I) of the present invention] and a combination of Tag (Promega) and Pfu (Stratagene) DNA polymerases.
- the forward primer contained the T7 promoter sequence immediately upstream of the HEV sequence.
- the amplified products were gel purified, polished with Klenow fragment of DNA polymerase (Amersham International) and phosphorylated with polynucleotide kinase (Amersham International).
- plasmids were linearized by cutting with the appropriate restriction enzyme at the 3' end of the insert.
- Xlw I restriction enzyme site present in the 3' end primer was used to linearize the clones [3'(+)A ] and [s3'(+)A ] and Bam HI site of the vector MCS was used for other mutants (Table 1 ).
- Correct production of RNA transcripts was ensured by linearizing the clones with restriction enzymes giving rise to 5' overhangs and not 3' overhang, which might otherwise lead to the transcription of the wrong strand of DNA.
- In-vitro transcription reaction was performed with T7 RNA polymerase (Life Technologies Inc., USA) in the presence of 500 ⁇ M each of ATP.
- RNA synthesized [43]. Upto 60% incorporation of the [ J ⁇ P] UTP was routinely achieved resulting in labelled transcripts with a specific activity of typically 10 8 cpm/ ⁇ g.
- the transcription reaction generated expected size transcripts as visualized on a 8% denaturing polyacrylamide gel. Unlabelled RNA w as similarly transcribed using 500 ⁇ M of each of NTPs, phenol: chloroform extracted and ethanol precipitated.
- RNA transcript of the 3' end with a poly(A) stretch [3'(+)A n ] was performed.
- the in-vitro transcribed RNA from the Hind III linearised clone [3'(+)A ] was treated with calf intestinal alkaline phosphatase (Promega) and purified on 8% polyacrylamide/ 8 M urea gel.
- the RNA bands were visualized by UY shadowing using fluorescent TLC plate, cut and eluted overnight in a buffer containing 1% SDS and 2.5 M ammonium acetate.
- the transcripts were ethanol precipitated and 5' end labelled using T4 polynucleotide kinase (Promega) and [ ⁇ - " P] ATP (5000 Ci. mmol: BARC, India) and further purified on 8% polyacrylamide / 8 M urea gel to remove the unincorporated nucleotides. Autoradiographic exposure of 1 min enabled the visualization of the labelled bands.
- the 32 P-labeled RNA transcripts Prior to reaction, the 32 P-labeled RNA transcripts were supplemented with carrier tRNA (Calbiochem) to a final concentration of 8 ⁇ M and subjected to a denaturation / renaturation procedure by heating the samples at 65"C for 3 min and slow cooling to 25°C over 60 min.
- the renaturation step was performed in the buffer containing 10 mM Tris/HCl, pH 7.2, 10 mM MgCl 2 and 40 mM NaCl for lead ion induced cleavage and in the respective enzyme buffers for enzymatic cleavage reaction. Subsequently, Pb(OAc)? (Sigma) solution was added to the final concentration of 2.5 mM and 5 mM, and the digestion was conducted at 25°C for 15 min. For enzymatic cleavage.
- Ribonuclease I (0.1 U) (Promega), SI nuclease (0.4125 U) (Amersham International) and Mung Bean nuclease (0.1 U) (Amersham International) were independently added and the reaction proceeded at 25°C for 10 min. All the reactions were quenched by adding equal volume of 7M urea, 10 mM EDTA solution and loaded on 15 % polyacrylamide 7 M urea gel at -10 4 cpm / well. Electrophoresis was performed in 0.5X TBE buffer at 2000Y for -1.5 - 4 h for short and long runs, respectively. Autoradiograp v w as performed at -80°C with an intensifying screen (DuPont).
- RNA cleavage products were run along with the products of alkaline RNA hydrolysis and limited ribonuclease Tl (Calbiochem) digestion of the same RNA.
- Alkaline hydrolysis ladder was generated by incubating the RNA with formamide in boiling water for 15 min.
- Partial Tl digestion w as performed in denaturing conditions (50 mM sodium citrate, pH 4.5, 7 M urea) with 0.05 U of enzyme at 55°C for 10 min. The above mentioned procedure was carried out after the standardization of reaction, gel electrophoresis and autoradiography conditions.
- Figure 8B shows the nucleotides within the native RNA that were determined to be susceptible to Pb (II) and RNases. These are labelled p-Pb 2+ ; o-Ribonuclease ONE: s- S I nuclease; m-Mung Bean nuclease. Nucleotides prone to Pb(II) hydrolysis in the RN.A- RdRp complex are shown in brackets [ ].
- cleavage products obtained by hydrolysis of 5' end labeled RNA transcripts with Pb 2+ ions and digestion with single strand specific RNases were separated on 15% polyacrylamide gel and given short and long runs.
- RNases Single strand specific RNases
- the labeled RN.A transcripts were supplemented with tRNA and brought to a concentration of 8 ⁇ .VI and subjected to denaturation/ renaturation procedure.
- the results according to lanes shown in Figure 10 were as follows:
- Lane A control incubation of the RNA without Pb 2+ ions or RNases.
- Lane B limited RNase Tl hydrolysis under denaturing conditions: cutting at cv erv G residue. Some of the numbers of G residues in the RNA sequence are depicted on the left.
- Lane C formamide ladder. Lanes D & E: Pb (II) induced hydrolysis at 2.5 and 5 mM Pb(OAc) 2 .
- Lane F same as 5 but with the omission of the denaturation/ renaturation procedure.
- Lanes G. H & I digestion with Ribonuclease ONE. SI nuclease and Mung Bean nuclease. respectively.
- Pb " and RNases including SI nuclease and Mung Bean nuclease. cut at ev ery single nucleotide from nt 7164 to 7172 which forms a single strand region (SS ) in the computer predicted structure model. Occasional cuts within this region were observed by Ribonuclease ONE enzyme too.
- Pb 2+ ions could identify and thus confirm the loops and bulge regions in SL1 and SL2, the reactivities being shown by the nt 7177. 7182-83.
- HEV genome [28] was amplified as a larger fragment (3493-5163 nt) by PCR using a combination of Taq (Promega) and Pfu (Stratagene) DNA polymerases from a HEX ' cDNA clone comprising nucleotides 2346-5163 in the pCRScript vector [2] [which w s later used for the reconstruction of full-length HEV cDNA infectious clone pSGl -HEY(I) of the present invention].
- the primers used were: Forward primer.
- ACAGctcgagcccgggGCATGATTCAGTCG nucleotides 3493 to 3523 (Genbank AF076239); Reverse primer, GCGaagcttCg taccTGGTCGCGAACCCATGG nucleotides 5163 to 5131 (Genbank. AF076239).
- the forward primer sequence was modified at the 5' end to create the rest ⁇ ction enzyme sites for Xlio I and Snui I (low er case nt in the primer sequence) and the start codon ATG.
- the reverse primer was modified at the 5' end to incorporate the restriction enzyme sites for Kpn I and Hind III (lower case nt in the primer sequence).
- the amplified fragment was cloned into pGEM-T vector (Promega) and sequenced as described earlier. It was then subcloned into the expression vector pRSET (Invitrogen) as a Xlw 1-Kpn I fragment.
- the recombinant pRSET C-RdRp clone was transformed into E.coli BL21-DE3 (Stratagene) and its overnight culture (O N) grown in Luria-Bertani (LB) medium.
- the overnight culture w as inoculated at 1% in NZ-Amine medium supplemented with 0.4% Glucose, IX M9 salts, 1 mM MgSO ⁇ and 50 ⁇ g/ml Ampicillin and the culture incubated at 37°C with shaking.
- Iso- propyl ⁇ -D thiogalactopyranoside (IPTG) was added at 1 mM concentration when the culture attained an optical density of 0.5.
- the culture was further incubated at 37°C with shaking for 3 hours. Cells were pelleted, solubilised in 2X Laemmili sample buffer ( 100 mM Tris-HCl, pH 6.8, 2% ⁇ -mercaptoethanol, 4% SDS, 0.2% bromophenol blue.
- the protein was refolded while immobilized on the column to avoid the formation of misfolded aggregates. Renaturation was carried out over a period of 1.5 hours using a linear 6 M-l M urea gradient in 500 mM NaCl, 20% glycerol. Tris/HCl pH 7.4, containing phenyl-methyl-sulfonyl-fluoride (PMSF) (Sigma) as a protease inhibitor. After refolding, the bound protein was eluted by the addition of 250 mM imidazole
- E.coli BL21(DE3) cells w ere transformed w ith pRSET C vector containing HEV RdRp coding sequence (nt 3493-5163 ) in- frame and induced with 1 mM IPTG.
- P-lane show ing the band of purified RdRp protein.
- the 63 kDa band is composed of -59 kDa RdRp and - 4 kDa His tag from the vector sequence.
- Figure 12B shows the western blot of E.coli expressed recombinant HEV RdRp with patient sera and rabbit sera raised against RdRp.
- Lanes 1 & 2 immunoblot ith patient sera of the uninduced and induced lanes of RdRp, respectively.
- Lanes 3 & 4. immunoblot with preimmune rabbit sera of the un-induced and induced RdRp lanes. respectively.
- Lanes 5 & 6 immunoblot with rabbit sera raised against RdRp [2] of the uninduced and induced lanes of RdRp, respectively.
- HepG2, Cos-7 and Hep2 cells were cultured in Dulbecco's Modified Eagle's Medium (DMEM) (Life Technologies Inc., USA) supplemented w ith 10% fetal bov ine serum (Life Technologies Inc., USA) in a 5% CO2 ⁇ atmosphere.
- DMEM Dulbecco's Modified Eagle's Medium
- HepG2 cells grown in 25 cm " flasks were washed twice with ice cold phosphate buffered saline (PBS), then harvested with a rubber policeman and pelleted by cent ⁇ fugation at
- the cells were lysed w ith three cv cles of freezing and thawing at -80°C followed by incubation on ice, respecti ely.
- the cell debris w as removed by centrifugation at 12,000 rpm for 10 mm at 4°C in 220.87YO1 rotor
- Hermle 323K centrifuge Germany
- the supernatant with a protein concentration 5- 10 ⁇ g/ ⁇ l was used as the cell lysate.
- EMS A was standardized for protein concentration, buffei conditions leaction tempei dtui e and time, type of gel and electrophoresis conditions
- binding assav 10 ⁇ g of whole cell extract protein or 5 ⁇ g of purified RdRp and -1 ng of [ P] UTP labelled RNA probe (-10" cpm) were incubated at 28°C foi 20 mm in a buf fei containing 10 mM Hepes (pH 7 6), 0 3 mM MgC .
- RdRp-RNA complex in the binding mix was incubated w ith the l abbit seia laised against E coli expressed RdRp for 20 min at 30°C
- the rabbit sei a w s eai liei v erified foi the presence of anti-RdRp antibodies by lmmunoblotting [2]
- the RdRp- RNA complex was incubated with pre-immune sera also in a separate leaction mix to be used as a control
- the reaction mix was then subjected to nondenatu ⁇ ng polyaciv lamide gel electrophoresis as described above
- Quantitative estimation of binding was performed by measuring the latio of RN A probe bound to RdRp to the unbound probe under optimal binding conditions and a known RdRp concentration. This was accomplished by cutting the gel piece corresponding to the bound and unbound probe and measuring the counts by scintillation. Percent binding was determined as follows:
- mutant [s3'(+)A n ] was deleted of nt 7084-7138 and did not form SL2. Both these mutants showed less than 5% of the binding observed with the w ild type 3' end containing poly(A) sequences. Dose response experiments further indicated that amounts of RdRp lower than the optimal level (5 ⁇ g) failed to bind to even such a low- degree to these mutants (data not shown). This clearly suggested that the integrity of the SL1 and SL2 domains, along with the presence of the poly(A) tail is necessary for binding of the viral RdRp to the 3' end of HEV genome.
- a compensatory C ⁇ T point mutation at nucleotide 7176 in the [3'(+)M l ] background was introduced in mutant [3'(+)M2], which restored base-pairing.
- This mutant showed a slightly increased binding efficiency of -60%.
- the deletion mutant [3'(-)M3] lacking the interior loop showed only 13% binding, whereas the deletion mutant [3'(+)M4] lacking the hairpin loop still showed about 60% binding.
- HEY RNA binding studies were performed with extracts prepared from liver as well as non-liv er cells.
- the HepG2 cell line which has a human hepatoblastoma origin, was chosen as a representative liver cell and SV40-transformed monkey kidney Cos-7 and human epithelial Hep2 cells were used as representative non-liver cells.
- Total cell extracts were allowed to bind to the m-vitro transcribed [ ⁇ " P] UTP labelled RNA probes corresponding to the 3' end with added poly(A) sequences [3'(+)A ] in the presence of an excess of tRNA to reduce non-specific binding.
- the binding reaction was set up as described m Example 13 with 40 ⁇ g of cell extract protein and ⁇ 10 6 cpm of RNA probe.
- the reaction mixture containing the RNA-protein complexes was UV irradiated on ice for 30 min in CL-1000 Ultraviolet Crosslinker (UVP Products limited, UK) at a distance of 5 cm from the UV source.
- 20 ⁇ g of RNase A (Sigma. USA) and 20 U of RNase Tl (Calbiochem. USA) were added and the reaction mix was incubated at 37°C for 30 min to digest the unbound RNA completely.
- UV-crosslinked products were boiled in 2X Laemmili sample buffer for 3 min and analysed on a SDS-12% polyacrylamide gel.
- the 5' end labeled probe of [3'(+)A n ] was allowed to bind to RdRp as mentioned above and the complex was subjected to reaction with Pb(OAc) 2 at final concentration of 1.25. 2.5 and 5 mM at 25°C for 10 min.
- the reaction was stopped by the addition of EDTA to a final concentration of 10 mM, extracted with w ater-saturated phenol and RNA piecipitated with ethanol
- the samples were dissolved in 7 M urea/ 10 mM EDT A solution and loaded on the gel as desc ⁇ bed above.
- the putative HEV RdRp sequence was aligned with the poliov irus RdRp sequence to screen for homology and the presence of "palm" domain motifs A. B. C. D and E [38].
- the motif domains were also subjected to secondary structure predictions by the neural net method of Rost and Sander [50].
- the sequence alignment, secondary structure predictions, structure-based sequence alignment and partial crystal structure of the poliovirus RdRp was used to build a core structure of the "palm" domain for HEY RdRp.
- the mutations and loops were generated using Swiss PDB viewer [18] and the model was energy minimized with AMBER 5.0. [42].
- TBSY p92, HCV NS5B, Q ⁇ replicase subunit II, poliovirus and HIV RT are shown in bold letters with asterisks, high similarity residues in underlined letters with double dots and low similarity residues are depicted in italics with single dots.
- RdRp as is apparent from a superimposed picture of the two RdRps.
- the core structure of polymerase palm domain is also characterized b its similarity to RNA lecognition motif (RRM) found in splicing proteins and sev eral iibosomal proteins
- RRM RNA lecognition motif
- Motif B also forms one of the two helices that pack beneath the four-stranded antiparallel ⁇ sheet of the polymerase core structure
- the predicted extent of ⁇ helical region matches well with hepatitis C virus (HCV) NS5B [38]
- Motif E ( Figure 19B) - Motif E is unique to RdRps and RTs, which forms a short ⁇ strand-turn- ⁇ strand and is positioned between the palm and thumb.
- Ho ev er. the structure of motif E varies in different classes of polymerases and even in different crystals of HIV-RT. The hydrophobic residues in this motif seem to be important for the interaction with the palm core structure. The hydrogen bonding interactions with ⁇ strand of the thumb are thought to be crucial in proper positioning of the thumb on substrate binding.
- the in-vitro produced viral RN.A transcripts have to mimic the virion RNA as closely as possible. This is because the v iral genome has to interact with several viral as well as cellular proteins. These interactions determine the efficiency of replication, transcription and translation.
- the parameters, w hich affect infection by gene transfer are: heterogeneity of the transcript population, presence of point mutation and the sequences at 5' and 3 ' ends i.e. number of non-v iral nucleotides. presence of a cap structure at the 5' end and poly A tail at the 3 ' end.
- the problem of heterogeneity in transcript population is mainly due to poor fidelity of RNA polymerase [1, 15]. As a result it may hamper the infectivity of the transcripts [5].
- the HEV transcript used in the studies according to the present invention has 12 non- viral nucleotides at the 5' end in addition to the complete viral genome (Genbank Accession No. AF076239). These additional nucleotides in the transcript at the 5' (12 nucleotides) and 3' (1 nucleotide) ends did not abolish its competence for replication as observed in these studies. In recent studies by- other researchers, the presence of cap structure in HEV genome has been described [24]. However, the present invention demonstrates replication of HEV RNA w ithout a cap structure. Therefore, it may be presumed that the presence of cap structure is not obligatory for replication of HEV genome.
- the negative strand of viral RNA usually serves as the replicative intermediate in most of the positive stranded RNA viruses. Such a species was demonstrated for HEV in the transfected HepG2 cells, indicating active viral replication.
- the anti-sense strand was found to be in a lower amount than the sense strand like in other positive stranded virus systems [53]. While the sense strand was detected up to 10 " dilution of the template
- RNA the anti-sense strand was detected upto a dilution of 10 " . This is possibly because anti-sense pregenome tends to get converted into sense strand faster. In addition some of the RN . A used for transfection may persist ev en after thorough washing and may lead to very high level of sense strand detected. In most of the positive stranded RNA v iruses, the positiv e and negative strands are synthesized in unequimolar ratio, i.e. the positi e strand is produced in excess of the negative strand [53].
- the transfected viral genome was not only capable of replication but also expressed viral proteins in the transfected cells and released infectious v irus into the culture supernatant as evaluated by experimental infection into a Rhesus monkey Nearly
- the metabohcally labelled viral proteins were immunoprecipitated from transfected cells using their respective antibodies derived from both structural and putativ e non-structural regions.
- the components of non-structural polyprotein identified from the predicted homology to putative methyl transferase, helicase and RdRp domains w ere immunoprecipitated separately from the transfected cells.
- the putative RdRp w as detected up to 36 hours of transfection. This is possible because it is an early protein and undergoes rapid degradation. Therefore, no signal corresponding to RdRp could be detected at 72 and 96 hours. However, the other proteins were detected at 72 hours post transfection. which include putative methyl transferase and helicase. This indicates that the protein product from the ORFl region undergoes processing.
- the other viral proteins either directly or indirectly through cell dependent mechanisms may activate proteases responsible for such processing.
- a putative protease domain has been identified in the ORFl gene based on sequence comparison [28], However this has not been characte ⁇ zed yet. The possibility of the viral protease needing activation cannot be ruled out.
- the ORF3 protein is a phosphoprotein that binds to src homology domain III. It is phosphorylated by mitogen activated protein (M.AP) kinase. Therefore, this possibly can play a role in protein phosphorylation [64]. Whether this protein alters the activity of any cellular or viral protease to initiate the polyprotein processing needs further investigation.
- alfalfa mosaic virus [17]
- TCV turnip crinckle virus
- human rhinovirus [57]
- encephalomyocarditis virus [14]
- AAMV alfalfa mosaic virus
- TCV turnip crinckle virus
- encephalomyocarditis virus [14]
- AAMV alfalfa mosaic virus
- TCV turnip crinckle virus
- human rhinovirus human rhinovirus
- encephalomyocarditis virus [14]
- RNA dependent RNA polymerase enzyme RNA dependent RNA polymerase enzyme
- hepatitis A virus RNA preumed to form a pseudoknot structure [31 ].
- Sindbis virus [30].
- west nile virus [4] and conserved 11 nucleotide sequence at the 3" end of coronavirus mouse hepatitis [63] bind to their respective host cell proteins.
- the host cell proteins can also interact with the viral RNA replication complex, as in brome mosaic virus [45].
- RNA genomes has not been clarified so far. Most such proteins have been found to be associated with cellular RNA-processing pathways or translation machinery [33]. Some of these cell proteins may aid in replication of the viral genome in conjunction w ith the RdRp-replicase complex.
- the two major polypeptides interacting with the 3' end of HEV RNA genome were identified as doublets of -45 kDa and -95-105 kDa and 3-4 minor species represented by faint bands.
- the 45 kDa protein might be an important specificit determining factor, as interaction with such a protein is absent with the Cos7 cell extract. Howev er, the Cos7 cell extract showed crosslinking of a smaller polypeptide.
- w hich might suggest that this protein(s) is somewhat smaller in monkey cells compared to human cells, or in kidney cells as compared to liver cells. Proteins with similar molecular weights have been identified in other systems.
- a host protein of 45 kDa bound to the RdRp was determined to be an analog of eIF-3 subunit p41 [45].
- the 3' end of hepatitis A RNA is also known to bind to a 45 kDa host protein [31].
- a 103 kDa cellular protein is reported to bind to the 3' end of mouse hepatitis virus [63] and another 105 kDa protein binds to sense and anti-sense strands of 3' non coding region of west nile virus [4].
- the 3' end of rubella virus negative strand RNA binds to 97 kDa cellular protein whose intensity is increased in infected cells [36]
- the doublet signals observed in the UV-crosslinking assays might be either due to RNA binding to different proteins of slightly different molecular weights, differentially modified forms of the same protein (e.g. glycosylated and the un-glycosylated forms) or due to differential digestion of the RNA after UV-crosslinking. Difference in the intensities of the detected bands do not necessarily exemplify the differences in the binding capabilities, but could also be due to the difference in their respective amounts in the cell extract or due to difference in the UV-crosslinking abilities.
- HEV RdRp HEV RdRp structural analysis comparisons with other RNA polymerases reveal the presence of conserved structured domains with discrete functions. Cellular proteins also form complexes at SLl and SL2 sequence regions and the interaction is independent of the presence of poly(A) stretch.
- T7 RNA polymeiase promotei sequence (TGTAATACGACTCACTATAGG ) 7084 and 7139 are the nucleotide positions in the HEV genome at which the foi w aid pi unei s begin REFERENCES
- RNA-protein interactions involvement of NS3, NS5 and 3' noncoding regions of Japanese encephalitis virus genomic RNA. J. Virol. 71:3466-3473.
- HEV hepatitis E virus
- RNA transcripts from Sindbis virus cDNA clones mapping of lethal mutations, rescue of a temperature-sensitive marker, and in vitro mutagenesis to generate defined mutants. J Virol. 61 :3809-19.
- HEV Hepatitis E virus
- ORF3 protein of HEV is a phosphoprotein that associates with cytoskeleton. .1. Virol.
- VYGVSPGLVHNLIGMLQAVA DGKAHFTESVKPVLDLTNSILCRVE.
- NQGWRSVETSGVAEE EATSGLVMLCIHGSPVNSYTNTPYTGALGLLDFAL
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Engineering & Computer Science (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP01917440A EP1169341A1 (fr) | 2000-02-07 | 2001-02-05 | Clone infectieux genetiquement modifie du genome du virus de l'hepatite b (vhe), production et utilisations de ce dernier |
AU44516/01A AU4451601A (en) | 2000-02-07 | 2001-02-05 | Genetically engineered clone of hepatitis e virus (hev) genome which is infectious, its production and uses |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
IN106DE2000 | 2000-02-07 | ||
IN106/DEL/2000 | 2000-02-07 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2001057073A2 true WO2001057073A2 (fr) | 2001-08-09 |
WO2001057073A3 WO2001057073A3 (fr) | 2002-04-18 |
Family
ID=11097025
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IN2001/000015 WO2001057073A2 (fr) | 2000-02-07 | 2001-02-05 | Clone infectieux genetiquement modifie du genome du virus de l'hepatite b (vhe), production et utilisations de ce dernier |
Country Status (3)
Country | Link |
---|---|
EP (1) | EP1169341A1 (fr) |
AU (1) | AU4451601A (fr) |
WO (1) | WO2001057073A2 (fr) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003063679A2 (fr) * | 2001-11-09 | 2003-08-07 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Clones du virus de l'hepatite e et leurs procedes d'utilisation |
US11926817B2 (en) | 2019-08-09 | 2024-03-12 | Nutcracker Therapeutics, Inc. | Microfluidic apparatus and methods of use thereof |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996010580A2 (fr) * | 1994-10-03 | 1996-04-11 | The Government Of The United States Of America, Re | Proteines de recombinaison d'une souche pakistanaise d'hepatite e et leur utilisation dans des procedes de diagnostic et des vaccins |
-
2001
- 2001-02-05 AU AU44516/01A patent/AU4451601A/en not_active Abandoned
- 2001-02-05 EP EP01917440A patent/EP1169341A1/fr not_active Withdrawn
- 2001-02-05 WO PCT/IN2001/000015 patent/WO2001057073A2/fr not_active Application Discontinuation
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996010580A2 (fr) * | 1994-10-03 | 1996-04-11 | The Government Of The United States Of America, Re | Proteines de recombinaison d'une souche pakistanaise d'hepatite e et leur utilisation dans des procedes de diagnostic et des vaccins |
Non-Patent Citations (8)
Title |
---|
BOYER J-C ET AL: "INFECTIOUS TRANSCRIPTS AND CDNA CLONES OF RNA VIRUSES" VIROLOGY, ACADEMIC PRESS,ORLANDO, US, vol. 198, 1994, pages 415-426, XP000652105 ISSN: 0042-6822 cited in the application * |
BRADLEY D W: "HEPATITIS E VIRUS: A BRIEF REVIEW OF THE BIOLOGY, MOLECULAR VIROLOGY, AND IMMUNOLOGY OF A NOVEL VIRUS" JOURNAL OF HEPATOLOGY, vol. 22, no. 1, SUPPL, 1995, pages 140-145, XP000565565 COPENHAGEN DK * |
DATABASE EM_VI [Online] EMBL; 20 July 1998 (1998-07-20) PANDA, S.K. ET AL.: "Hepatitis E virus from Hyderabad, Inda, complete genome" retrieved from EBI, accession no. AF076239 Database accession no. AF076239 XP002176001 * |
JAMEEL, S. ET AL.: "Expression in animal cells and characterization of the hepatitis E virus structural proteins" JOURNAL OF VIROLOGY., vol. 70, no. 1, 1996, pages 207-216, XP002175999 WASHINGTON, US cited in the application * |
PANDA S K ET AL: "THE IN VITRO-SYNTHESIZED RNA FROM A CDNA CLONE OF HEPATITIS E VIRUS IS INFECTIOUS" JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 74, no. 5, March 2000 (2000-03), pages 2430-2437, XP001012211 ISSN: 0022-538X * |
TAM A W ET AL: "HEPATITIS E VIRUS (HEV): MOLECULAR CLONING AND SEQUENCING OF THE FULL-LENGTH VIRAL GENOME" VIROLOGY, NEW YORK, NY, US, vol. 185, no. 1, November 1991 (1991-11), pages 120-131, XP001011402 ISSN: 0042-6822 * |
TAM ALBERT W ET AL: "In vitro infection and replication of hepatitis E virus in primary cynomolgus macaque hepatocytes." VIROLOGY., vol. 238, no. 1, 10 November 1997 (1997-11-10), pages 94-102, XP002176000 ORLANDO., US * |
UCHIDA, T. ET AL: "Hepatitis E virus: cDNA cloning and expression" MICROBIOLOGY AND IMMUNOLOGY, vol. 36, no. 1, 1992, pages 67-79, XP000926525 * |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003063679A2 (fr) * | 2001-11-09 | 2003-08-07 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Clones du virus de l'hepatite e et leurs procedes d'utilisation |
WO2003063679A3 (fr) * | 2001-11-09 | 2003-12-04 | Us Gov Health & Human Serv | Clones du virus de l'hepatite e et leurs procedes d'utilisation |
US11926817B2 (en) | 2019-08-09 | 2024-03-12 | Nutcracker Therapeutics, Inc. | Microfluidic apparatus and methods of use thereof |
Also Published As
Publication number | Publication date |
---|---|
AU4451601A (en) | 2001-08-14 |
WO2001057073A3 (fr) | 2002-04-18 |
EP1169341A1 (fr) | 2002-01-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Agrawal et al. | The 3′ end of hepatitis E virus (HEV) genome binds specifically to the viral RNA-dependent RNA polymerase (RdRp) | |
Ahmad et al. | Molecular virology of hepatitis E virus | |
Chen et al. | RNA-protein interactions: involvement of NS3, NS5, and 3'noncoding regions of Japanese encephalitis virus genomic RNA | |
Andino et al. | Poliovirus RNA synthesis utilizes an RNP complex formed around the 5′‐end of viral RNA. | |
CA2295552C (fr) | Genomes clones des virus de l'hepatite c infectieuse et leurs utilisations | |
Amineva et al. | Rhinovirus 3C protease precursors 3CD and 3CD′ localize to the nuclei of infected cells | |
Bi et al. | The sequence of hepatitis E virus isolated directly from a single source during an outbreak in China | |
Banerjee et al. | Specific interaction of hepatitis C virus protease/helicase NS3 with the 3′-terminal sequences of viral positive-and negative-strand RNA | |
US7611719B2 (en) | Enterovirus, vaccines, medicaments and diagnostic kits | |
Ropp et al. | Expression of the hepatitis E virus ORF1 | |
Yocupicio-Monroy et al. | Mosquito La protein binds to the 3′ untranslated region of the positive and negative polarity dengue virus RNAs and relocates to the cytoplasm of infected cells | |
JPH10500005A (ja) | C型肝炎ウイルス(hcv)のns3プロテアーゼの蛋白分解活性のインビトロにおける再生方法 | |
JP2006169233A (ja) | Nanbvの診断用薬およびワクチン | |
Lee et al. | Thermal aggregation of SARS-CoV membrane protein | |
WO2009011413A1 (fr) | Production et utilisation de particules du virus de l'hépatite c marquées par un épitope | |
Mitra et al. | Mutagenesis of tyrosine 24 in the VPg protein is lethal for feline calicivirus | |
WO2012096999A1 (fr) | Recombinés du génotype 3 du virus de l'hépatite e infectieuse | |
Chen et al. | Mutagenic analysis of the 3′ cis-acting elements of the rubella virus genome | |
Lu et al. | Complete sequence of a Kyrgyzstan swine hepatitis E virus (HEV) isolated from a piglet thought to be experimentally infected with human HEV | |
Sbardellati et al. | Generation of infectious and transmissible virions from a GB virus B full-length consensus clone in tamarins | |
Liu et al. | Recovery of infectious rabbit hemorrhagic disease virus from rabbits after direct inoculation with in vitro-transcribed RNA | |
WO2001057073A2 (fr) | Clone infectieux genetiquement modifie du genome du virus de l'hepatite b (vhe), production et utilisations de ce dernier | |
Sheng et al. | Characterization of interaction of classical swine fever virus NS3 helicase with 3′ untranslated region | |
Smedile et al. | Hepatitis D virus | |
Jameel et al. | Reevaluation of a North India isolate of hepatitis E virus based on the full-length genomic sequence obtained following long RT-PCR |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2001917440 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 2001917440 Country of ref document: EP |
|
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2001917440 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: JP |