WO2000053631A1 - Mammalian cytokines; related reagents and methods - Google Patents
Mammalian cytokines; related reagents and methods Download PDFInfo
- Publication number
- WO2000053631A1 WO2000053631A1 PCT/US2000/006182 US0006182W WO0053631A1 WO 2000053631 A1 WO2000053631 A1 WO 2000053631A1 US 0006182 W US0006182 W US 0006182W WO 0053631 A1 WO0053631 A1 WO 0053631A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- amino acids
- seq
- mature
- complex
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
Definitions
- the present invention pertains to compositions related to proteins which function in controlling biology and physiology of mammalian cells, e.g., cells of a mammalian immune system.
- mammalian cells e.g., cells of a mammalian immune system.
- it provides purified genes, proteins, antibodies, related reagents, and methods useful, e.g., to regulate activation, development, differentiation, and function of various cell types, including hematopoietic cells .
- BACKGROUND OF THE INVENTION refers generally to the technique of integrating genetic information from a donor source into vectors for subsequent processing, such as through introduction into a host, whereby the transferred genetic information is copied and/or expressed in the new environment.
- the genetic information exists in the form of complementary DNA (cDNA) derived from messenger RNA (mRNA) coding for a desired protein product.
- cDNA complementary DNA
- mRNA messenger RNA
- the carrier is frequently a plasmid having the capacity to incorporate cDNA for later replication in a host and, in some cases, actually to control expression of the cDNA and thereby direct synthesis of the encoded product in the host.
- G-CSF granulocyte colony stimulating factor
- Lymphokines apparently mediate cellular activities in a variety of ways . They have been shown to support the proliferation, growth, and/or differentiation of pluripotential hematopoietic stem cells into vast numbers of progenitors comprising diverse cellular lineages making up a complex immune system. Proper and balanced interactions between the cellular components are necessary for a healthy immune response. The different cellular lineages often respond in a different manner when lymphokines are administered in conjunction with other agents.
- B-cells which can produce and secrete immunoglobulins (proteins with the capability of recognizing and binding to foreign matter to effect its removal)
- T-cells of various subsets that secrete lymphokines and induce or suppress the B-cells and various other cells (including other T-cells) making up the immune network.
- lymphokines e.g., related to G-CSF and/or IL-6
- new lymphokines could contribute to new therapies for a wide range of degenerative or abnormal conditions which directly or indirectly involve the immune system and/or hematopoietic cells.
- lymphokines which enhance or potentiate the beneficial activities of known lymphokines would be highly advantageous.
- the present invention provides new interleukin compositions and related compounds, and methods for their use.
- the present invention is directed to mammalian, e.g., primate or rodent, interleukin-B60 (IL-B60) and its biological activities. It includes nucleic acids coding for polypeptides themselves and methods for their production and use.
- the nucleic acids of the invention are characterized, in part, by their homology to complementary DNA (cDNA) sequences disclosed herein, and/or by functional assays for growth factor- or cytokine-like activities, e.g., G-CSF (see Nagata (1994) in Thomson The Cytokine Handbook 2d ed.
- polypeptides, antibodies, and methods of using them including using nucleic acid expression methods. Methods for modulating or intervening in the control of a growth factor dependent physiology or an immune response are provided.
- the present invention is based, in part, upon the discovery of a new cytokine sequence exhibiting significant sequence and structural similarity to G-CSF and IL-6.
- a new cytokine sequence exhibiting significant sequence and structural similarity to G-CSF and IL-6.
- primate e.g., human
- rodent e.g., mouse
- Functional equivalents exhibiting significant sequence homology will be available from other mammalian, e.g., cow, horse, and rat species.
- compositions related to the combination of components in the complex are provided, along with methods of use.
- the invention provides a substantially pure or recombinant polypeptide comprising the mature protein portion of SEQ ID NO: 2 or 4.
- the polypeptide is: detectably labeled; unglycosylated; denatured; attached to a solid substrate; conjugated to another chemical moiety; or in a sterile composition.
- Kit forms include those comprising the polypeptide and: a compartment comprising the polypeptide; or with instructions for use or disposal of reagents in the kit.
- Binding compounds include those comprising an antigen binding site from an antibody that specifically binds to the described polypeptide.
- the binding compound can also be in a kit comprising: a compartment comprising the binding compound; or with instructions for use or disposal of reagents in the kit.
- the invention further provides a method of producing an antigen: antibody complex, comprising contacting, under appropriate conditions, a primate IL-B60 polypeptide with an antibody that specifically or selectively binds the polypeptide of the invention, thereby allowing the complex to form.
- Nucleic acid embodiments include an isolated or recombinant polynucleotide encoding the mature protein portion of SEQ ID NO: 2 or 4.
- the invention provides an isolated soluble complex comprising the mature protein portion of SEQ ID NO: 1
- the complex comprises a recombinant polypeptide of SEQ ID NO: 2 , 4, 12, or 13 ; is detectably labeled; is in a buffered solution; is in a sterile solution.
- Kits are provided containing such a complex and: a compartment comprising the complex; or instructions for use or disposal of reagents in the kit.
- Binding compounds comprising an antigen binding site from an antibody that specifically binds to the soluble complex but not to the mature polypeptide of SEQ ID NO: 12 or 13.
- Kits comprising the binding compound and: a compartment comprising the binding compound; or instructions for use or disposal of reagents in the kit.
- Methods are provided, e.g., of producing an antigen: antibody complex, comprising contacting, under appropriate conditions, a primate complex comprising IL-B60 and CLF-1 polypeptides with an antibody that selectively or specifically binds to an isolated soluble complex comprising the mature protein portion of SEQ ID NO: 2 or 4, and the mature protein portion of SEQ ID NO: 12 or 13, thereby allowing the complex to form.
- Nucleic acid embodiments include an isolated or recombinant nucleic acid encoding the mature protein portion of SEQ ID NO: 2 or 4, and the mature protein portion of SEQ ID NO: 12 or 13.
- the invention also provides a composition of matter selected from: an isolated polypeptide comprising at least seven amino acids identical to segments of SEQ ID NO: 2 or 4; a substantially pure or recombinant polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 2 or 4 ; a natural sequence polypeptide comprising mature SEQ ID NO: 2 or 4; or a fusion polypeptide comprising IL-B60 sequence.
- the distinct nonoverlapping segments of identity include: one of at least eight amino acids; one of at least five amino acids and a second of at least six amino acids; at least three segments of at least four, five, and six amino acids, or one of at least twelve amino acids.
- the polypeptide of the composition of matter is the polypeptide which: comprises a mature sequence of Table 1; is an unglycosylated form of IL-B60; is from a primate, such as a human; comprises at least seventeen amino acids of SEQ ID NO: 2 or 4; exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 4; is a natural allelic variant of IL-B60; has a length at least about 30 amino acids; exhibits at least two non-overlapping epitopes which are specific for a primate IL- B60; is glycosylated; has a molecular weight of at least 30 kD with natural glycosylation; is a synthetic polypeptide; is attached to a solid substrate; is conjugated to another chemical moiety; is a 5-fold or less substitution from natural sequence; is a deletion or insertion variant from a natural sequence; or which further comprises: at least seven amino acids identical to segments of SEQ ID NO: 12 or 13; at least two
- the composition comprises: a substantially pure IL-B60 and CLF-1; a sterile IL-B60 polypeptide comprising the mature protein of SEQ ID NO : 2 or 4; or the described polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
- the invention provides fusion polypeptides which comprise: mature protein sequence of Table 1; a detection or purification tag, including a FLAG, His6, or Ig sequence; or sequence of another cytokine receptor family protein, including CLF-1.
- Kit embodiments include those comprising the polypeptide of the composition and: a compartment comprising the protein or polypeptide; or instructions for use or disposal of reagents in the kit.
- the invention further provides methods of using the described polypeptides: to label the polypeptide, comprising labeling the polypeptide with a radioactive label; to separate the polypeptide from another polypeptide in a mixture, comprising running the mixture on a chromatography matrix, thereby separating the polypeptides; to identify a compound that binds selectively to the polypeptide, comprising incubating the compound with the polypeptide under appropriate conditions; thereby causing the component to bind to the polypeptide; or to conjugate the polypeptide to a matrix, comprising derivatizing the polypeptide with a reactive reagent, and conjugating the polypeptide to the matrix.
- binding compounds include those comprising an antigen binding site from an antibody that specifically or selectively binds to a natural polypeptide, as described above, wherein: the binding compound is in a container; the IL-B60 polypeptide is from a human; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a mature polypeptide of Table 1; is raised against a mature IL-B60; is raised to a purified human IL- B60; is immunoselected; is a polyclonal antibody; binds to a denatured IL-B60; exhibits a Kd to antigen of at least 30 ⁇ M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label. Kits are provided comprising such a binding compound and: a compartment comprising the binding compound; or instructions for use or disposal of the binding
- an antigen: antibody complex comprising contacting, under appropriate conditions, a primate IL-B60 polypeptide with a described antibody, thereby allowing the complex to form.
- the complex is purified from other cytokines; the complex is purified from other antibody; the contacting is with a sample comprising a cytokine; the contacting allows quantitative detection of the antigen; the contacting is with a sample comprising the antibody; or the contacting allows quantitative detection of the antibody.
- the invention includes a composition
- a composition comprising: a sterile binding compound, as described, or the binding compound and a carrier, wherein the carrier: wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
- Nucleic acid embodiments include an isolated or recombinant nucleic acid encoding the described polypeptide, wherein: the IL-B60 is from a human; or the nucleic acid: encodes an antigenic peptide sequence of Table 1; encodes a plurality of antigenic peptide sequences of Table 1; encodes a plurality of antigenic peptide sequences of Table 4 ; exhibits identity over at least thirteen nucleotides to a natural cDNA encoding the segment; is an expression vector; further comprises an origin of replication; is from a natural source; comprises a detectable label; comprises synthetic nucleotide sequence; is less than 6 kb, preferably less than 3 kb; is from a primate; comprises a natural full length coding sequence; is a hybridization probe for a gene encoding the IL-B60; or is a PCR primer, PCR product, or mutagenesis primer.
- kits comprising the described nucleic acid and: a compartment comprising the nucleic acid; a compartment further comprising a primate IL-B60 polypeptide; or instructions for use or disposal of reagents in the kit.
- the invention further provides methods for forming a duplex with a polynucleotide described above, comprising contacting the polynucleotide with a probe that hybridizes, under stringent conditions, to at least 25 contiguous nucleotides of the coding portion of SEQ ID NO: 1, 3, or encoding the nature SEQ ID NO: 12 or 13; thereby forming the duplex.
- the invention provides a nucleic acid which: hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of SEQ ID NO: 1; or exhibits identity over a stretch of at least about 30 nucleotides to a primate IL-B60.
- the wash conditions that are at 45° C and/or 500 mM salt; or at 55° C and/or 150 mM salt; or the stretch is at least 55 nucleotides, e.g., at least 75 nucleotides.
- Methods are provided, e.g., of modulating physiology or development of a cell or tissue culture cells comprising contacting the cell with an agonist or antagonist of a mammalian IL-B60; or contacting the cell with an agonist or antagonist of a complex comprising mammalian IL-B60 and CLF- 1.
- the invention provides a method of increasing the secretion of: an IL-B60 sequence, comprising expressing the polypeptide with CLF-1; or a CLF-1, comprising expressing the CLF-1 with an IL-B60 sequence.
- the increasing is at least 3 fold, 5X, IX, 10X, or more; or the expressing is of a recombinant nucleic acid encoding one or both of the polypeptide and CLF- 1.
- the invention further provides a method of screening for a receptor which binds an isolated soluble complex comprising the mature protein portion of SEQ ID NO: 2 or 4 , and the mature protein portion of SEQ ID NO: 12 or 13, comprising contacting the complex to a cell expressing the receptor under conditions allowing the complex to bind to the receptor, thereby forming a detectable interaction.
- the interaction results in a physiological response in the cell.
- inventions include, e.g., an isolated soluble complex comprising at least 6 amino acids of the mature protein portion of SEQ ID NO: 2 or 4 , and: at least 6 amino acids of the mature protein portion of SEQ ID NO: 12 or 13; or at least 6 amino acids of the mature protein portion of the CNTF-R.
- Such complex may, e.g., comprise a recombinant polypeptide of mature SEQ ID NO : 2 or 4; comprise a recombinant polypeptide of mature SEQ ID NO: 12 or 13; comprise a recombinant polypeptide of mature CNTF-R; comprise both a recombinant polypeptide of mature SEQ ID NO: 2 or 4, and a recombinant polypeptide of mature SEQ ID NO: 12 or 13; comprise both a recombinant polypeptide of mature SEQ ID NO: 2 or 4, and a recombinant polypeptide of mature CNTF-R; be detectably labeled; be in a buffered solution; or be in a sterile solution.
- Preferred embodiments include those which: comprise a mature IL-B60 polypeptide; comprise a mature CLF-1 polypeptide; comprises a mature CNTF-R polypeptide; exhibit at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 4; exhibit epitopes from both primate L-B60 and primate CLF-1; exhibit epitopes from both primate L-B60 and primate CNTF-R; not be glycosylated; be attached to a solid substrate; be conjugated to another chemical moiety; or comprise a detection or purification tag, including a FLAG, His6, or Ig sequence.
- Kits are provided, e.g, comprising the complex and: a compartment comprising the complex, and/or instructions for use or disposal of reagents in the kit.
- Fusion polypeptides include, e.g., an isolated or recombinant polypeptide comprising: a first segment comprising at least seven amino acids identical to segments of SEQ ID NO : 2 or 4 , and a second segment comprising at least seven amino acids identical to segments of mature SEQ ID NO: 12 or 13; at least two distinct nonoverlapping segments of at least five amino acids identical to segments of mature SEQ ID NO : 2 or 4 , and a third segment comprising at least seven amino acids identical to segments of mature SEQ ID NO: 12 or 13; at least one segment comprising at least seven amino acids identical to segments of mature SEQ ID NO: 2 or 4, and two distinct nonoverlapping segments of at least five amino acids identical to segments of mature SEQ ID NO: 12 or 13; a first segment comprising at least seven amino acids identical to segments of SEQ ID NO: 2 or 4 , and a second segment comprising at least seven amino acids identical to segments of mature primate CNTF-R; at least two distinct nonoverlapping segments of at least five amino acids identical to segments of
- Certain embodiments include those wherein the distinct nonoverlapping segments of identity: include one of at least eight amino acids; include one of at least five amino acids and a second of at least six amino acids; include at least three segments of at least four, five, and six amino acids, or include one of at least twelve amino acids.
- inventions include those which: comprise a mature IL-B60 sequence; comprise a mature CLF-1 sequence; comprise a mature CNTF-R sequence; exhibit at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 4; have a length at least about 30 amino acids; exhibit epitopes from both primate IL-B60 and primate CLF-1; exhibits epitopes from both primate IL-B60 and primate CNTF- R; are not glycosylated; have a molecular weight of at least 30 kD; be a synthetic polypeptide; be attached to a solid substrate; be conjugated to another chemical moiety; or comprise a detection or purification tag, including a FLAG, His6, or Ig sequence.
- compositions comprising: substantially pure combination of IL-B60 and CLF-1; substantially pure combination of IL-B60 and CNTF-R; a sterile polypeptide described above; or the polypeptide described above and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
- a kit comprising a polypeptide as described, and: a compartment comprising the polypeptide; and/or instructions for use or disposal of reagents in the kit.
- Methods are also provided, e.g, of making an antibody which recognizes a complex as described, comprising inducing an immune response in an animal with the complex; of immunoselecting antibodies, comprising contacting a population of antibodies to a complex as described, and separating antibodies that bind from those which do not bind; or of formulating a composition, comprising admixing a complex as described with a carrier.
- Binding compounds are provided, e.g., comprising an antigen binding site from an antibody, which antibody specifically binds a described complex, but not to any of the mature polypeptides of SEQ ID NO: 2, 4, 12, 13, or CNTF-R.
- the binding compound is: in a container; an Fv, Fab, or Fab2 fragment; or conjugated to another chemical moiety; or the antibody: is raised against a substantially pure complex of IL-B60 with CLF-1; is raised against a substantially pure complex of IL- B60 with CNTF-R; is immunoselected; is a polyclonal antibody; exhibits a Kd to antigen of at least 30 ⁇ M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label.
- Additional embodiments include a composition comprising: a sterile binding compound as described, or the binding compound as described and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
- a kit comprising the binding compound and: a compartment comprising the binding compound; or instructions for use or disposal of reagents in the kit.
- methods of producing an antigen: antibody complex comprising contacting under appropriate conditions a primate complex comprising: IL-B60 and CLF-1 polypeptides; or IL-B60 and CNTF-R polypeptides; with an antibody as described, thereby allowing the complex to form.
- the complex is purified from other cytokines; the complex is purified from other antibody; the contacting is with a sample comprising a cytokine; the contacting allows quantitative detection of the antigen; the contacting is with a sample comprising the antibody; or the contacting allows quantitative detection of the antibody.
- nucleic acids are provided, e.g., an isolated or recombinant nucleic acid: encoding the amino acid portions described above; encoding the amino acid portions as described, and comprise a segment at least 30 contiguous nucleotides from SEQ ID NO: 1 or 3; which will coexpress a segment of at least seven contiguous amino acids from SEQ ID NO: 2 or 4, and a segment of at least seven contiguous amino acids from SEQ ID NO: 12 or 13; or which will coexpress a segment of at least seven contiguous amino acids from SEQ ID NO: 2 or 4, and a segment of at least seven contiguous amino acids from CNTF-R.
- Preferred nucleic acids include those which, e.g.,: encode IL-B60 from a human; encode CLF-1 from a human; encodes CNTF-R from a human; are an expression vector; further comprise an origin of replication; comprise a detectable label; comprise synthetic nucleotide sequence; or are less than 6 kb, preferably less than 3 kb.
- a cell comprising the recombinant nucleic acid is provided, e.g., wherein the cell is: a prokaryotic cell; a eukaryotic cell; a bacterial cell; a yeast cell; an insect cell; a mammalian cell; a mouse cell; a primate cell; or a human cell.
- kits comprising the nucleic acid and: a compartment comprising the nucleic acid; a compartment further comprising a primate IL-B60 polypeptide; a compartment further comprising a primate CLF-1 polypeptide; a compartment further comprising a primate CNTF-R polypeptide; or instructions for use or disposal of reagents in the kit.
- Methods are also provided, e.g., of making a duplex nucleic acid, comprising contacting such a nucleic acid with a complementary nucleic acid under appropriate conditions, thereby forming said duplex; of expressing a polypeptide, comprising expressing the nucleic acid, thereby producing the polypeptide; or of transfecting a cell, comprising contacting said cell under appropriate conditions with the nucleic acid, thereby transfecting the cell.
- the invention provides an isolated or recombinant nucleic acid which encodes at least 5 contiguous amino acids of SEQ ID NO: 12, 13, or primate CNTF- R and: hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of SEQ ID NO: 1; or exhibits identity over a stretch of at least about 30 nucleotides to a primate IL-B60.
- Preferred embodiments include: the isolated nucleic acid, wherein: the contiguous amino acids number at least 8; the wash conditions are at 45° C and/or 500 mM salt; or the stretch is at least 55 nucleotides; or the recombinant nucleic acid, wherein: the contiguous amino acids number at least 12 ; the wash conditions are at 55° C and/or 150 mM salt; or the stretch is at least 75 nucleotides.
- the invention particularly provides methods of modulating physiology or development of a cell or tissue culture cells comprising contacting the cell with an agonist or antagonist of a complex comprising mammalian IL-B60 and: CLF-1; or CNTF-R. It also provides methods of producing the proteins, e.g., producing a complex described, comprising coexpressing a recombinant IL-B60 with a recombinant CLF-1 or CNTF-R; increasing the secretion of an IL-B60 polypeptide comprising expressing the polypeptide with CLF-1 or CNTF-R; or increasing the secretion of a CLF-1 polypeptide, comprising expressing the CLF-1 with an IL-B60.
- the increasing is at least 3 fold; or the expressing is of a recombinant nucleic acid encoding one or both of the polypeptide and CLF-1.
- Also provided are methods of screening for a receptor which binds the described complex comprising contacting the complex to a cell expressing the receptor under conditions allowing the complex to bind to the receptor, thereby forming a detectable interaction.
- the interaction results in a physiological response in the cell.
- the present invention provides amino acid sequences and DNA sequences encoding various mammalian proteins which are cytokines, e.g., which are secreted molecules which can mediate a signal between immune or other cells. See, e.g., Paul (1998) Fundamental Immunology (4th ed. ) Raven Press, N.Y.
- cytokines e.g., which are secreted molecules which can mediate a signal between immune or other cells.
- the full length cytokines, and fragments, or antagonists will be useful, e.g., in physiological modulation of cells expressing a receptor.
- IL-B60 has either stimulatory or inhibitory effects on hematopoietic cells, including, e.g., lymphoid cells, such as T-cells, B- cells, natural killer (NK) cells, macrophages, dendritic cells, hematopoietic progenitors, etc.
- lymphoid cells such as T-cells, B- cells, natural killer (NK) cells, macrophages, dendritic cells, hematopoietic progenitors, etc.
- NK natural killer
- the proteins will also be useful as antigens, e.g., immunogens , for raising antibodies to various epitopes on the protein, both linear and conformational epitopes.
- a sequence encoding IL-B60 was identified from a human genomic sequence. The molecule was designated huIL-B60. A rodent sequence, e.g., from mouse, is also described.
- the human gene encodes a small soluble cytokine-like protein, of about 198 amino acids.
- the psort predicted signal sequence probably is about 17 residues, and would run from the Met to about Ala. See Table 1 and SEQ. ID. NO: 1 and 2.
- IL-B60 exhibits structural motifs characteristic of a member of the long chain cytokines. Compare, e.g., IL-B60, G-CSF, and IL-6, sequences available from GenBank. Closest matching is with CT-1, oncostatin M, and CNTF . See also Table 2.
- Nucleic acid (SEQ ID NO: 1) encoding IL-B60 from a primate, e.g., human. Predicted signal cleavage site is indicated. Nucleotide 375 may be A. Translated amino acid sequence is SEQ ID NO: 2.
- Leu Gly Ser lie Ala Gly Val Met Ala Ala Leu Gly Tyr Pro Leu Pro
- Rodent, e.g., mouse, IL-B60 (SEQ ID NO: 3 and 4): atg tta get tgc eta tgc acg gtg ctg tgg cac etc cct gca gtg cca 48
- Table 1 (continued) : MLACLCTVL HLPAVPA/LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAE TLPRATVNLEVWRSLNDRLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMATLG YPLPQPLPGTEPA APGPAHSDFLQKMDDFWLLKELQT L RSAKDFNRLKKKMQPPAASVTLHLEAHGF
- IL-B60 ATGTTAGCGTGCCTGTGCACGGTGCTCTGGCACCTCCCTGCAGTGCCAGCTCTCAATCGC
- mIL-B60 ATGTTAGCTTGCCTATGCACGGTGCTGTGGCACCTCCCTGCAGTGCCAGCTCTTAATCGC
- Human IL- B60 is SEQ ID NO: 2; mouse IL-B60 is SEQ ID NO: 4; mouse LIF (mLIF) is SEQ ID NO: 5 and Accession number X06381; human LIF (hLIF) is SEQ ID NO: 6 and Accession numbers M63420 J05436; human CT-1 (hCT-1) is SEQ ID NO: 7 and Accession number U43030; mouse CT-1 (mCT-1) is SEQ ID NO: 8 and Accession number U18366; human CNTF (hCNTF) is SEQ ID NO: 9 and Accession number X60542; mouse CNTF (mCNTF) is SEQ ID NO: 10 and Accession number U05342; human DNAX IL-40 (hDIL-40) is SEQ ID NO: 11.
- IL-B60 is a long chain cytokine exhibiting sequence similarity to IL-6 and G-CSF.
- IL-B60 agonists, or antagonists may also act as functional or receptor antagonists, e.g., which block IL-6 or G-CSF binding to their respective receptors, or mediating the opposite actions.
- IL-B60, or its antagonists may be useful in the treatment of abnormal medical conditions, including immune disorders, e.g., T cell immune deficiencies, chronic inflammation, or tissue rejection, or in cardiovascular or neurophysiological conditions.
- the natural antigens are capable of mediating various biochemical responses which lead to biological or physiological responses in target cells.
- the preferred embodiment characterized herein is from human, but other primate, or other species counterparts exist in nature.
- the association of the IL-B60 with a partner has been confirmed.
- the IL-B60 and CLF-1 molecules have likely evolved together, reflected in their homology between species.
- the coevolution of their function is suggested by the observation that the human/mouse relationship of the IL-B60 is very close, as is the human/mouse CLF-1. If the two functionally associate, they might act together in the fashion of IL-12. See, e.g., Trinchieri (1998) Adv. Immunol. 70:83-243; Gately, et al. (1998) Ann. Rev. Immunol. 16:495-521; and Trinchieri (1998) Int. Rev. Immunol. 16:365-396.
- cytokine receptor family e.g., gpl30, LIF- R, OSM-R, IL-12Rbl, IL-12Rb2, and NR30. These receptors will be tested for binding to the soluble complex.
- a series of BAF/3 cells that stably express various of these tall receptors have been constructed.
- the supernatants of transfectants of both IL-B60 and CLF-1 (or a single combination construct) in the same cell will be used to test these various BAF/3 cells to see if there is a proliferative or other signaling response.
- most of the physiological effects of the cytokine may be due to the complex of the proteins.
- many of the descriptions below of biology resulting from the cytokine may actually be physiologically effected by the complex comprising the combination of the subunits.
- Table 4 provides the sequences of the IL-B60 partner, known as CLF-1.
- the CNTF receptor (CNTF-R) subunit alpha was described, e.g., by Davis, et al . (1991) Science 253:59-63. See also GenBank accession numbers NM1001842 and M73238 (human) ; AF068615 (mouse) ; and S54212 (rat) ; each of which is incorporated herein by reference.
- Standard domains of the human CLF-1 receptor sequence correspond approximately to: signal from 1 to about 38; first IG-like domain from about residue 39 to 130; a second domain from about 131 to about 237; and the last from about 238 to the end.
- the descriptions below may also be applied to the CLF-1, or to the IL-B60/CLF-1 complex.
- a fusion of the IL-B60 with CLF-1 may be constructed, as, e.g., the hyper IL-6. See, e.g., Fischer, et al . (1997) Nature Biotechnol. 15:142-145; Rakemann, et al . (1999) J. Biol. Chem. 274:1257-1266; and Peters, et al.(1998) J. Immunol. 161:3575-3581; which are incorporated herein by reference.
- CNTF is oddly a protein without a secretory signal peptide, and does not appear to escape the cell (Stockli, et al . , ibid); furthermore, engineered (Masu, et al . (1993) Nature 365:27-32) or naturally occurring (Takahashi, et al . (1994) Nature Genet. 7:79-84) disruptions of the CNTF gene are not deleterious. By contrast, gene disruptions of the primary receptor for CNTF (CNTF-R ⁇ ) prove lethal shortly after birth. DeChiara, et al . (1995) Cell 83:313-322). Together, these observations point to the existence of a second ligand for CNTF-R ⁇ that is physiologically responsible for the in vitro observed, or in vivo desired, actions of
- IL-B60 has a signal peptide
- its secretion remains critically dependent on complexing with CLF-1, as described.
- IL-B60 signals via a tripartite receptor system that is otherwise identical to that of CNTF, consisting of the two ubiquitously expressed signal-transducing components gpl30 and LIF-R, and the specificity-determining receptor, CNTF-R ⁇ .
- IL-B60 or complex Human IL-B60 amino acid sequence is shown, in one embodiment within SEQ ID NO: 2.
- Other naturally occurring nucleic acids which encode the protein can be isolated by standard procedures using the provided sequence, e.g., PCR techniques, or by hybridization. These amino acid sequences, provided amino to carboxy, are important in providing sequence information for the cytokine allowing for distinguishing the protein antigen from other proteins and exemplifying numerous variants.
- peptide sequences allow preparation of peptides to generate antibodies to recognize such segments
- nucleotide sequences allow preparation of oligonucleotide probes, both of which are strategies for detection or isolation, e.g., cloning, of genes encoding such sequences.
- human soluble IL-B60 shall encompass, when used in a protein context, a protein having amino acid sequence corresponding to a soluble polypeptide from SEQ ID NO: 2. Significant fragments thereof will often retain similar functions, e.g., antigenicity .
- Preferred embodiments comprise a plurality of distinct, e.g., nonoverlapping, segments of the specified length. Typically, the plurality will be at least two, more usually at least three, and preferably 5, 7, or even more. While the length minima may be recited, longer lengths, of various sizes, may be appropriate, e.g., one of length 7, and two of length 12. Similar features apply to polynucleotides .
- Binding components typically bind to an IL-B60 with high affinity, e.g., at least about 100 nM, usually better than about 30 nM, preferably better than about 10 nM, and more preferably at better than about 3 nM.
- Counterpart proteins will be found in mammalian species other than human, e.g., other primates, ungulates, or rodents. Non-mammalian species should also possess structurally or functionally related genes and proteins, e.g., birds or amphibians .
- polypeptide as used herein includes a significant fragment or segment, and encompasses a stretch of amino acid residues of at least about 8 amino acids, generally at least about 12 amino acids, typically at least about 16 amino acids, preferably at least about 20 amino acids, and, in particularly preferred embodiments, at least about 30 or more amino acids, e.g., 35, 40, 45, 50, etc.
- Such fragments may have ends which begin and/or end at virtually all positions, e.g., beginning at residues 1, 2, 3, etc., and ending at, e.g., 150, 149, 148, etc., in all practical combinations.
- binding composition refers to molecules that bind with specificity to IL-B60, e.g., in an antibody-antigen interaction.
- the specificity may be more or less inclusive, e.g., specific to a particular embodiment, or to groups of related embodiments, e.g., primate, rodent, etc. Depletion or absorptions can provide desired selectivities .
- the molecule may be a polymer, or chemical reagent.
- a functional analog may be a protein with structural modifications, or it may be a molecule which has a molecular shape which interacts with the appropriate binding determinants.
- the compounds may serve as agonists or antagonists of a receptor binding interaction, see, e.g., Goodman, et al . (eds.) Goodman & Gilman's: The Pharmacological Bases of Therapeutics (current ed. ) Pergamon Press .
- Substantially pure e.g., in a protein context, typically means that the protein is free from other contaminating proteins, nucleic acids, or other biologicals derived from the original source organism.
- Purity may be assayed by standard methods, typically by weight, and will ordinarily be at least about 40% pure, generally at least about 50% pure, often at least about 60% pure, typically at least about 80% pure, preferably at least about 90% pure, and in most preferred embodiments, at least about 95% pure. Carriers or excipients will often be added. Solubility of a polypeptide or fragment depends upon the environment and the polypeptide. Many parameters affect polypeptide solubility, including temperature, electrolyte environment, size and molecular characteristics of the polypeptide, and nature of the solvent. Typically, the temperature at which the polypeptide is used ranges from about 4° C to about 65° C. Usually the temperature at use is greater than about 18° C.
- the temperature will usually be about room temperature or warmer, but less than the denaturation temperature of components in the assay.
- the temperature will usually be body temperature, typically about 37° C for humans and mice, though under certain situations the temperature may be raised or lowered in situ or in vitro.
- the size and structure of the polypeptide should generally be in a substantially stable state, and usually not in a denatured state.
- the polypeptide may be associated with other polypeptides in a quaternary structure, e.g., to confer solubility, or associated with lipids or detergents.
- the solvent and electrolytes will usually be a biologically compatible buffer, of a type used for preservation of biological activities, and will usually approximate a physiological aqueous solvent. Usually the solvent will have a neutral pH, typically between about 5 and 10, and preferably about 7.5.
- one or more detergents will be added, typically a mild non-denaturing one, e.g., CHS (cholesteryl hemisuccinate) or CHAPS (3- [3- cholamidopropyl ) dimethylam onio] -1-propane sulfonate) , or a low enough concentration as to avoid significant disruption of structural or physiological properties of the protein.
- CHS cholesteryl hemisuccinate
- CHAPS 3- [3- cholamidopropyl ) dimethylam onio] -1-propane sulfonate
- a harsh detergent may be used to effect significant denaturation.
- An IL-B60 polypeptide that specifically binds to or that is specifically immunoreactive with an antibody, e.g., such as a polyclonal antibody, generated against a defined immunogen, e.g., such as an immunogen consisting of an amino acid sequence of SEQ ID NO: 2 or fragments thereof or a polypeptide generated from the nucleic acid of SEQ ID NO: 1 is typically determined in an immunoassay. Included within the metes and bounds of the present invention are those nucleic acid sequences described herein, including functional variants, that encode polypeptides that selectively bind to polyclonal antibodies generated against the prototypical IL-B60 polypeptide as structurally and functionally defined herein.
- the immunoassay typically uses a polyclonal antiserum which was raised, e.g., to a protein of SEQ ID NO: 2.
- This antiserum is selected, or depleted, to have low crossreactivity against appropriate other closely related family members, preferably from the same species, and any such crossreactivity is removed by immunoabsorption or depletion prior to use in the immunoassay.
- Appropriate selective serum preparations can be isolated, and characterized.
- the protein e.g., of SEQ ID NO: 2
- recombinant protein may be produced in a mammalian cell line.
- An appropriate host e.g., an inbred strain of mice such as Balb/c
- a standard adjuvant such as Freund's adjuvant
- a standard mouse immunization protocol see Harlow and Lane
- a substantially full length synthetic peptide derived from the sequences disclosed herein can be used as an immunogen.
- Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, e.g., a solid phase immunoassay with the immunogen immobilized on a solid support.
- Polyclonal antisera with a titer of 10 ⁇ or greater are selected and tested for their cross reactivity against other closely related family members, e.g., LIF, CT-1, CNTF, DIL-40, or other members of the IL-6 family, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570- 573.
- a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570- 573.
- Preferably at least two IL-6/IL-12 family members are used in this determination in conjunction with the target.
- These long chain cytokine family members can be produced as recombinant proteins and isolated using standard molecular biology and protein chemistry techniques as described herein.
- antibody preparations can be identified or produced having desired selectivity or specificity for subsets of IL-B60 family members.
- antibodies may be prepared which bind to the complex comprising the IL-B60 with the CLF-1.
- Immunoassays in the competitive binding format can be used for the crossreactivity determinations.
- the protein of SEQ ID NO : 2 can be immobilized to a solid support. Proteins added to the assay compete with the binding of the antisera to the immobilized antigen. The ability of the above proteins to compete with the binding of the antisera to the immobilized protein is compared to the protein of SEQ ID NO: 2. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the proteins listed above are selected and pooled.
- the cross-reacting antibodies are then removed from the pooled antisera by immunoabsorption with the above-listed proteins.
- the immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein to the immunogen protein.
- the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required is less than twice the amount of the protein of, e.g., SEQ ID NO: 2 that is required, then the second protein is said to specifically bind to an antibody generated to the immunogen.
- This invention also encompasses proteins or peptides having substantial amino acid sequence identity with the amino acid sequence of the IL-B60 antigen.
- the variants include species, polymorphic, or allelic variants.
- Amino acid sequence homology, or sequence identity is determined by optimizing residue matches, if necessary, by introducing gaps as required. See also Needleham, et al . (1970) J. Mol. Biol. 48:443-453; Sankoff, et al . (1983)
- Sequence identity changes when considering conservative substitutions as matches.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- the conservation may apply to biological features, functional features, or structural features .
- Homologous amino acid sequences are typically intended to include natural polymorphic or allelic and interspecies variations of a protein sequence. Typical homologous proteins or peptides will have from 25-100% identity (if gaps can be introduced), to 50-100% identity (if conservative substitutions are included) with the amino acid sequence of the IL-B60. Identity measures will be at least about 35%, generally at least about 40%, often at least about 50%, typically at least about 60%, usually at least about 70%, preferably at least about 80%, and more preferably at least about 90%.
- the isolated IL-B60 DNA can be readily modified by nucleotide substitutions, nucleotide deletions, nucleotide insertions, and inversions of short nucleotide stretches.
- Modifications result in novel DNA sequences which encode these antigens, their derivatives, or proteins having similar physiological, immunogenic, antigenic, or other functional activity. These modified sequences can be used to produce mutant antigens or to enhance expression. Enhanced expression may involve gene amplification, increased transcription, increased translation, and other mechanisms.
- “Mutant IL-B60” encompasses a polypeptide otherwise falling within the sequence identity definition of the IL-B60 as set forth above, but having an amino acid sequence which differs from that of IL-B60 as normally found in nature, whether by way of deletion, substitution, or insertion.
- IL-B60 mutagenesis can also be conducted by making amino acid insertions or deletions. Substitutions, deletions, insertions, or any combinations may be generated to arrive at a final construct. Insertions include amino- or carboxy- terminal fusions. Random mutagenesis can be conducted at a target codon and the expressed mutants can then be screened for the desired activity. Methods for making substitution mutations at predetermined sites in DNA having a known sequence are well known in the art, e.g., by M13 primer mutagenesis or polymerase chain reaction (PCR) techniques. See, e.g., Sambrook, et al . (1989); Ausubel, et al . (1987 and Supplements); and Kunkel, et al .
- PCR polymerase chain reaction
- Preferred embodiments include, e.g., 1-fold, 2- fold, 3-fold, 5-fold, 7-fold, etc., preferably conservative substitutions at the nucleotide or amino acid levels.
- substitutions will be away from the conserved cysteines, and often will be in the regions away from the helical structural domains. Such variants may be useful to produce specific antibodies, and often will share many or all biological properties. See Table 2. Recognition of the cytokine structure provides important insight into the structure and positions of residues which may be modified to effect desired changes in receptor interaction. Also, the interaction of the IL-B60 with the CLF-1 protein requires complementary structural features in the interacting surface.
- the present invention also provides recombinant proteins, e.g., heterologous fusion proteins using segments from these proteins.
- a heterologous fusion protein is a fusion of proteins or segments which are naturally not normally fused in the same manner. A similar concept applies to heterologous nucleic acid sequences.
- new constructs may be made from combining similar functional domains from other proteins.
- target-binding or other segments may be "swapped" between different new fusion polypeptides or fragments. See, e.g., Cunningham, et al . (1989) Science 243:1330-1336; and O'Dowd, et al. (1988) J. Biol. Chem. 263:15985-15992.
- Structural analysis can be applied to this gene, in comparison to the IL-6 family of cytokines.
- the family includes, e.g., IL-6, IL-11, IL-12, G-CSF, LIF, OSM, CNTF, and Ob.
- Alignment of the human and mouse IL-B60 sequences with other members of the IL-6 family should allow definition of structural features.
- ⁇ -sheet and ⁇ -helix residues can be determined using, e.g., RASMOL program, see Bazan, et al . (1996) Nature 379:591; Lodi , et al .
- residues for substitutions include the surface exposed residues which would be predicted to interact with receptor. Other residues which should conserve function will be conservative substitutions, particularly at position far from the surface exposed residues.
- the blocking of physiological response to IL-B60s may result from the competitive inhibition of binding of the ligand to its receptor.
- In vitro assays of the present invention will often use isolated protein, soluble fragments comprising receptor binding segments of these proteins, or fragments attached to solid phase substrates. These assays will also allow for the diagnostic determination of the effects of either binding segment mutations and modifications, or cytokine mutations and modifications, e.g., IL-B60 analogs.
- This invention also contemplates the use of competitive drug screening assays, e.g., where neutralizing antibodies to the cytokine, or receptor binding fragments compete with a test compound.
- “Derivatives" of IL-B60 antigens include amino acid sequence mutants from naturally occurring forms, glycosylation variants, and covalent or aggregate conjugates with other chemical moieties. Covalent derivatives can be prepared by linkage of functionalities to groups which are found in IL-B60 amino acid side chains or at the N- or C- termini, e.g., by standard means. See, e.g., Lundblad and Noyes (1988) Chemical Reagents for Protein Modification, vols. 1-2, CRC Press, Inc., Boca Raton, FL; Hugli (ed.
- glycosylation alterations are included, e.g., made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing, or in further processing steps. See, e.g., Elbein (1987) Ann . Rev . Biochem. 56:497-534. Also embraced are versions of the peptides with the same primary amino acid sequence which have other minor modifications, including phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine .
- Fusion polypeptides between IL-B60s and other homologous or heterologous proteins are also provided.
- Many cytokine receptors or other surface proteins are multimeric, e.g., homodimeric entities, and a repeat construct may have various advantages, including lessened susceptibility to proteolytic cleavage.
- Typical examples are fusions of a reporter polypeptide, e.g., luciferase, with a segment or domain of a protein, e.g., a receptor-binding segment, so that the presence or location of the fused ligand may be easily determined. See, e.g., Dull, et al . , U.S. Patent No. 4,859,609.
- gene fusion partners include bacterial ⁇ - galactosidase, trpE, Protein A, ⁇ -lactamase, alpha amylase, alcohol dehydrogenase, yeast alpha mating factor, and detection or purification tags such as a FLAG sequence of His6 sequence. See, e.g., Godowski, et al . (1988) Science 241:812-816. Fusion peptides will typically be made by either recombinant nucleic acid methods or by synthetic polypeptide methods. Techniques for nucleic acid manipulation and expression are described generally, e.g., in Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual (2d ed. ) , vols.
- This invention also contemplates the use of derivatives of IL-B60 proteins other than variations in amino acid sequence or glycosylation.
- Such derivatives may involve covalent or aggregative association with chemical moieties or protein carriers.
- Covalent or aggregative derivatives will be useful as immunogens, as reagents in immunoassays, or in purification methods such as for affinity purification of binding partners, e.g., other antigens.
- An IL-B60 can be immobilized by covalent bonding to a solid support such as cyanogen bromide-activated SEPHAROSE, by methods which are well known in the art, or adsorbed onto polyolefin surfaces, with or without glutaraldehyde cross-linking, for use in the assay or purification of anti-IL-B60 antibodies or an alternative binding composition.
- the IL-B60 proteins can also be labeled with a detectable group, e.g., for use in diagnostic assays.
- Purification of IL-B60 may be effected by an immobilized antibody or complementary binding partner, e.g., binding portion of a receptor.
- a solubilized IL-B60 or fragment of this invention can be used as an immunogen for the production of antisera or antibodies specific for binding.
- Purified antigen can be used to screen monoclonal antibodies or antigen-binding fragments, encompassing antigen binding fragments of natural antibodies, e.g., Fab, Fab', F(ab)2, etc.
- Purified IL-B60 antigens can also be used as a reagent to detect antibodies generated in response to the presence of elevated levels of the cytokine, which may be diagnostic of an abnormal or specific physiological or disease condition.
- This invention contemplates antibodies raised against amino acid sequences encoded by nucleotide sequence shown in SEQ ID NO: 1, or fragments of proteins containing it.
- this invention contemplates antibodies having binding affinity to or being raised against specific domains, e.g., helices A, B, C, or D of the IL-B60, or the Ig domains of the CLF-1.
- the present invention contemplates the isolation of additional closely related species variants. Southern and Northern blot analysis will establish that similar genetic entities exist in other mammals. It is likely that IL-B60s are widespread in species variants, e.g., rodents, lagomorphs, carnivores, artiodactyla, perissodactyla, and primates .
- the invention also provides means to isolate a group of related antigens displaying both distinctness and similarities in structure, expression, and function. Elucidation of many of the physiological effects of the molecules will be greatly accelerated by the isolation and characterization of additional distinct species or polymorphic variants of them. In particular, the present invention provides useful probes for identifying additional homologous genetic entities in different species.
- the isolated genes will allow transformation of cells lacking expression of an IL-B60, e.g., either species types or cells which lack corresponding proteins and exhibit negative background activity. This should allow analysis of the function of IL-B60 in comparison to untransformed control cells . Dissection of critical structural elements which effect the various physiological functions mediated through these antigens is possible using standard techniques of modern molecular biology, particularly in comparing members of the related class. See, e.g., the homolog-scanning mutagenesis technique described in Cunningham, et al . (1989) Science
- Intracellular functions would probably involve receptor signaling. However, protein internalization may occur under certain circumstances, and interaction between intracellular components and cytokine may occur. Specific segments of interaction of IL-B60 with interacting components may be identified by mutagenesis or direct biochemical means, e.g., cross-linking or affinity methods. Structural analysis by crystallographic or other physical methods will also be applicable. Further investigation of the mechanism of signal transduction will include study of associated components which may be isolatable by affinity methods or by genetic means, e.g., complementation analysis of mutants.
- controlling elements associated with the antigens should exhibit differential physiological, developmental, tissue specific, or other expression patterns. Upstream or downstream genetic regions, e.g., control elements, are of interest.
- Antibodies can be raised to various epitopes of the IL-B60 proteins, including species, polymorphic, or allelic variants, and fragments thereof, both in their naturally occurring forms and in their recombinant forms . Additionally, antibodies can be raised to IL-B60s in either their active forms or in their inactive forms, including native or denatured versions. Anti-idiotypic antibodies are also contemplated.
- Antibodies including binding fragments and single chain versions, against predetermined fragments of the antigens can be raised by immunization of animals with conjugates of the fragments with immunogenic proteins. Monoclonal antibodies are prepared from cells secreting the desired antibody. These antibodies can be screened for binding to normal or defective IL-B60s, or screened for agonistic or antagonistic activity, e.g., mediated through a receptor. Antibodies may be agonistic or antagonistic, e.g., by sterically blocking binding to a receptor.
- These monoclonal antibodies will usually bind with at least a K D of about 1 mM, more usually at least about 300 ⁇ M, typically at least about 100 ⁇ M, more typically at least about 30 ⁇ M, preferably at least about 10 ⁇ M, and more preferably at least about 3 ⁇ M or better.
- the antibodies of this invention can also be useful in diagnostic applications. As capture or non-neutralizing antibodies, they can be screened for ability to bind to the antigens without inhibiting binding to a receptor. As neutralizing antibodies, they can be useful in competitive binding assays. They will also be useful in detecting or quantifying IL-B60 protein or its receptors. See, e.g., Chan (ed.
- the antibodies, including antigen binding fragments, of this invention can be potent antagonists that bind to the antigen and inhibit functional binding, e.g., to a receptor which may elicit a biological response. They also can be useful as non-neutralizing antibodies and can be coupled to toxins or radionuclides so that when the antibody binds to antigen, a cell expressing it, e.g., on its surface, is killed. Further, these antibodies can be conjugated to drugs or other therapeutic agents, either directly or indirectly by means of a linker, and may effect drug targeting. Antigen fragments may be joined to other materials, particularly polypeptides, as fused or covalently joined polypeptides to be used as immunogens .
- An antigen and its fragments may be fused or covalently linked to a variety of immunogens, such as keyhole limpet hemocyanin, bovine serum albumin, tetanus toxoid, etc. See Microbiology, Hoeber
- Suitable labels include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like. Patents, teaching the use of such labels include U.S. Patent Nos . 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437;
- the antibodies of this invention can also be used for affinity chromatography in isolating the protein.
- Columns can be prepared where the antibodies are linked to a solid support. See, e.g., Wilchek et al . (1984) Meth. Enzymol . 104:3-55.
- protein can be used for depletion or cross absorptions to prepare selectively specific binding compositions .
- Antibodies raised against each IL-B60 will also be useful to raise anti-idiotypic antibodies. These will be useful in detecting or diagnosing various immunological conditions related to expression of the respective antigens.
- the described peptide sequences and the related reagents are useful in detecting, isolating, or identifying a DNA clone encoding IL-B60, e.g., from a natural source.
- it will be useful in isolating a gene from a mammal, and similar procedures will be applied to isolate genes from other species, e.g., warm blooded animals, such as birds and mammals.
- Cross hybridization will allow isolation of IL-B60 from the same, e.g., polymorphic variants, or other species.
- a number of different approaches will be available to successfully isolate a suitable nucleic acid clone.
- the purified protein or polypeptides are useful for generating antibodies by standard methods, as described above. Synthetic peptides or purified protein can be presented to an immune system to generate monoclonal or polyclonal antibodies. See, e.g., Coligan (1991) Current Protocols in Immunology Wiley/Greene; and Harlow and Lane (1989) Antibodies: A Laboratory Manual, Cold Spring Harbor Press .
- a specific binding composition could be used for screening of an expression library made from a cell line which expresses an IL-B60. Screening of intracellular expression can be performed by various staining or immunofluorescence procedures. Binding compositions could be used to affinity purify or sort out cells expressing a surface fusion protein.
- the peptide segments can also be used to predict appropriate oligonucleotides to screen a library.
- the genetic code can be used to select appropriate oligonucleotides useful as probes for screening. See, e.g., SEQ ID NO: 1.
- synthetic oligonucleotides will be useful in selecting correct clones from a library.
- Complementary sequences will also be used as probes, primers, or antisense strands.
- Various fragments should be particularly useful, e.g., coupled with anchored vector or poly-A complementary PCR techniques or with complementary DNA of other peptides. This invention contemplates use of isolated DNA or fragments to encode a biologically active corresponding
- IL-B60 polypeptide particularly lacking the portion coding the untranslated portions of the described sequence.
- this invention covers isolated or recombinant DNA which encodes a biologically active protein or polypeptide and which is capable of hybridizing under appropriate conditions with the DNA sequences described herein.
- Said biologically active protein or polypeptide can be an intact antigen, or fragment, and have an amino acid sequence disclosed in, e.g., SEQ ID NO: 2, particularly a mature, secreted polypeptide.
- this invention covers the use of isolated or recombinant DNA, or fragments thereof, which encode proteins which exhibit high identity to a secreted IL- B60.
- the isolated DNA can have the respective regulatory sequences in the 5' and 3' flanks, e.g., promoters, enhancers, poly-A addition signals, and others.
- expression may be effected by operably linking a coding segment to a heterologous promoter, e.g., by inserting a promoter upstream from an endogenous gene.
- nucleic acid is a nucleic acid, e.g., an RNA, DNA, or a mixed polymer, which is substantially separated from other components which naturally accompany a native sequence, e.g., ribosomes, polymerases, and/or flanking genomic sequences from the originating species.
- the term embraces a nucleic acid sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogs or analogs biologically synthesized by heterologous systems.
- a substantially pure molecule includes isolated forms of the molecule.
- the nucleic acid will be in a vector or fragment less than about 50 kb, usually less than about 30 kb, typically less than about 10 kb, and preferably less than about 6 kb.
- An isolated nucleic acid will generally be a homogeneous composition of molecules, but will, in some embodiments, contain minor heterogeneity. This heterogeneity is typically found at the polymer ends or portions not critical to a desired biological function or activity.
- a "recombinant" nucleic acid is defined either by its method of production or its structure.
- the process is use of recombinant nucleic acid techniques, e.g., involving human intervention in the nucleotide sequence, typically selection or production.
- it can be a nucleic acid made by generating a sequence comprising fusion of two fragments which are not naturally contiguous to each other, but is meant to exclude products of nature, e.g., naturally occurring mutants.
- products made by transforming cells with any unnaturally occurring vector is encompassed, as are nucleic acids comprising sequence derived using any synthetic oligonucleotide process. Such is often done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site.
- nucleic acid segments of desired functions are joined together to generate a single genetic entity comprising a desired combination of functions not found in the commonly available natural forms.
- Restriction enzyme recognition sites are often the target of such artificial manipulations, but other site specific targets, e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design.
- site specific targets e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design.
- a similar concept is intended for a recombinant, e.g., fusion, polypeptide.
- synthetic nucleic acids which, by genetic code redundancy, encode polypeptides similar to fragments of these antigens, and fusions of sequences from various different species or polymorphic variants.
- a significant "fragment" in a nucleic acid context is a contiguous segment of at least about 17 nucleotides, generally at least about 22 nucleotides, ordinarily at least about 29 nucleotides, more often at least about 35 nucleotides, typically at least about 41 nucleotides, usually at least about 47 nucleotides, preferably at least about 55 nucleotides, and in particularly preferred embodiments will be at least about 60 or more nucleotides, e.g., 67, 73, 81, 89, 95, etc.
- a DNA which codes for an IL-B60 protein will be particularly useful to identify genes, mRNA, and cDNA species which code for related or similar proteins, as well as DNAs which code for homologous proteins from different species. There will be homologs in other species, including primates, rodents, canines, felines, and birds. Various IL-B60 proteins should be homologous and are encompassed herein. However, even proteins that have a more distant evolutionary relationship to the antigen can readily be isolated under appropriate conditions using these sequences if they are sufficiently homologous. Primate IL-B60 proteins are of particular interest.
- Recombinant clones derived from the genomic sequences, e.g., containing introns, will be useful for transgenic studies, including, e.g., transgenic cells and organisms, and for gene therapy. See, e.g., Goodnow (1992) "Transgenic Animals” in Roitt (ed. ) Encyclopedia of Immunology, Academic Press, San Diego, pp. 1502-1504; Travis (1992) Science 256:1392-1394; Kuhn, et al . (1991) Science 254:707-710; Capecchi (1989) Science 244:1288; Robertson (ed.
- nucleic acid sequence comparison context means either that the segments, or their complementary strands, when compared, are identical when optimally aligned, with appropriate nucleotide insertions or deletions, in at least about 50% of the nucleotides, generally at least about 58%, ordinarily at least about 65%, often at least about 71%, typically at least about 77%, usually at least about 85%, preferably at least about 95 to 98% or more, and in particular embodiments, as high as about 99% or more of the nucleotides.
- telomere sequence e.g., in SEQ ID NO: 1.
- selective hybridization will occur when there is at least about 55% identity over a stretch of at least about 30 nucleotides, preferably at least about 75% over a stretch of about 25 nucleotides, and most preferably at least about 90% over about 20 nucleotides. See, Kanehisa (1984) Nuc. Acids Res. 12:203-213.
- the length of identity comparison, as described, may be over longer stretches, and in certain embodiments will be over a stretch of at least about 17 nucleotides, usually at least about 28 nucleotides, typically at least about 40 nucleotides, and preferably at least about 75 to 100 or more nucleotides.
- Stringent conditions in referring to homology in the hybridization context, will be stringent combined conditions of salt, temperature, organic solvents, and other parameters, typically those controlled in hybridization reactions.
- Stringent temperature conditions will usually include temperatures in excess of about 30° C, usually in excess of about 37° C, typically in excess of about 55° C, preferably in excess of about 70° C.
- Stringent salt conditions will ordinarily be less than about 1000 mM, usually less than about 400 mM, typically less than about 250 mM, preferably less than about 150 mM, including about 100, 50, or even 20 mM. However, the combination of parameters is much more important than the measure of any single parameter. See, e.g., Wetmur and Davidson (1968) J. Mol . Biol. 31:349-370. Hybridization under stringent conditions should give a background of at least 2-fold over background, preferably at least 3-5 or more.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence (s) relative to the reference sequence, based on the designated program parameters.
- Optical alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1981) Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol . 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc . Nat ' 1 Acad. Sci . USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI) , or by visual inspection (see generally Ausubel et al . , supra) .
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendrogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (1987) J. Mol . Evol . 35:351-360. The method used is similar to the method described by Higgins and Sharp (1989) CABIOS 5:151- 153. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences.
- This cluster is then aligned to the next most related sequence or cluster of aligned sequences.
- Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences.
- the final alignment is achieved by a series of progressive, pairwise alignments.
- the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. For example, a reference sequence can be compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
- BLAST algorithm Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described Altschul, et al . (1990) J. Mol. Biol. 215:403-410. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information
- HSPs high scoring sequence pairs
- Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Nat'l Acad. Sci. USA 90:5873-5787).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- a further indication that two nucleic acid sequences of polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described below.
- IL-B60 from other mammalian species can be cloned and isolated by cross-species hybridization of closely related species. Homology may be relatively low between distantly related species, and thus hybridization of relatively closely related species is advisable. Alternatively, preparation of an antibody preparation which exhibits less species specificity may be useful in expression cloning approaches.
- DNA which encodes the IL-B60 or fragments thereof can be obtained by chemical synthesis, screening cDNA libraries, or screening genomic libraries prepared from a wide variety of cell lines or tissue samples. See, e.g., Okayama and Berg (1982) Mol. Cell. Biol. 2:161-170; Gubler and Hoffman (1983) Gene 25:263-269; and Glover (ed. 1984) DNA Cloning: A Practical Approach, IRL Press, Oxford.
- the sequences provided herein provide useful PCR primers or allow synthetic or other preparation of suitable genes encoding an IL-B60; including naturally occurring embodiments.
- This DNA can be expressed in a wide variety of host cells for the synthesis of a full-length IL-B60 or fragments which can in turn, e.g., be used to generate polyclonal or monoclonal antibodies; for binding studies; for construction and expression of modified molecules; and for structure/function studies.
- Vectors as used herein, comprise plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles which enable the integration of DNA fragments into the genome of the host. See, e.g., Pouwels, et al . (1985 and Supplements) Cloning Vectors: A Laboratory Manual, Elsevier, N.Y.; and Rodriguez, et al . (eds. 1988) Vectors : A Survey of Molecular Cloning Vectors and Their Uses, Buttersworth, Boston, MA.
- DNA sequences are operably linked when they are functionally related to each other.
- DNA for a presequence or secretory leader is operably linked to a polypeptide if it is expressed- as a preprotein or participates in directing the polypeptide to the cell membrane or in secretion of the polypeptide.
- a promoter is operably linked to a coding sequence if it controls the transcription of the polypeptide;
- a ribosome binding site is operably linked to a coding sequence if it is positioned to permit translation.
- operably linked means contiguous and in reading frame, however, certain genetic elements such as repressor genes are not contiguously linked but still bind to operator sequences that in turn control expression.
- Suitable expression vectors include pCDNAl ; pCD, see Okayama, et al . (1985) Mol. Cell Biol. 5:1136-1142; pMClneo Poly-A, see Thomas, et al . (1987) Cell 51:503-512; and a baculovirus vector such as pAC 373 or pAC 610. See, e.g., Miller (1988) Ann. Rev. Microbiol. 42:177-199.
- IL-B60 polypeptide it will often be desired to express an IL-B60 polypeptide in a system which provides a specific or defined glycosylation pattern. See, e.g., Luckow and Summers (1988) Bio/Technology 6:47-55; and Kaufman (1990) Meth. Enzymol . 185:487-511.
- the IL-B60 may be engineered to be phosphatidyl inositol (PI) linked to a cell membrane, but can be removed from membranes by treatment with a phosphatidyl inositol cleaving enzyme, e.g., phosphatidyl inositol phospholipase-C .
- PI phosphatidyl inositol
- a phosphatidyl inositol cleaving enzyme e.g., phosphatidyl inositol phospholipase-C .
- IL-B60 fragments or derivatives thereof can be prepared by conventional processes for synthesizing peptides. These include processes such as are described in Stewart and Young (1984) Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL; Bodanszky and Bodanszky (1984) The Practice of Peptide Synthesis, Springer- Verlag, New York; Bodanszky (1984) The Principles of Peptide Synthesis, Springer-Verlag, New York; and Villafranca (ed. 1991) Techniques in Protein Chemistry II, Academic Press, San Diego, Ca.
- the present invention provides reagents which will find use in diagnostic applications as described elsewhere herein, e.g., in IL-B60 mediated conditions, or below in the description of kits for diagnosis.
- the gene may be useful in forensic sciences, e.g., to distinguish rodent from human, or as a marker to distinguish between different cells exhibiting differential expression or modification patterns.
- the provided compositions are useful reagents for, e.g., in vitro assays, scientific research, and the synthesis or manufacture of nucleic acids, polypeptides, or antibodies.
- This invention also provides reagents with significant commercial and/or therapeutic potential.
- the IL-B60 naturally occurring or recombinant
- fragments thereof, and antibodies thereto, along with compounds identified as having binding affinity to IL-B60, should be useful as reagents for teaching techniques of molecular biology, immunology, or physiology.
- Appropriate kits may be prepared with the reagents, e.g., in practical laboratory exercises in production or use of proteins, antibodies, cloning methods, histology, etc.
- the reagents will also be useful in the treatment of conditions associated with abnormal physiology or development, including inflammatory conditions. They may be useful in vitro tests for presence or absence of interacting components, which may correlate with success of particular treatment strategies. In particular, modulation of physiology of various, e.g., hematopoietic or lymphoid, cells will be achieved by appropriate methods for treatment using the compositions provided herein. See, e.g., Thomson (1994; ed.) The Cytokine Handbook (2d ed.) Academic Press, San
- a disease or disorder associated with abnormal expression or abnormal signaling by an IL-B60 should be a likely target for an agonist or antagonist.
- the new cytokine should play a role in regulation or development of hematopoietic cells, e.g., lymphoid cells, which affect immunological responses, e.g., inflammation and/or autoimmune disorders. Alternatively, it may affect vascular physiology or development, or neuronal effects.
- the cytokine should mediate, in various contexts, cytokine synthesis by the cells, proliferation, etc.
- Antagonists of IL-B60 such as mutein variants of a naturally occurring form of IL-B60 or blocking antibodies, may provide a selective and powerful way to block immune responses, e.g., in situations as inflammatory or autoimmune responses. See also Samter, et al . (eds.) Immunological Diseases vols. 1 and 2, Little, Brown and Co.
- compositions would be useful, e.g., with other modulators of inflammation.
- Such other molecules may include steroids, other versions of IL-6 and/or G-CSF, including species variants, or viral homologs, and their respective antagonists.
- pancreatic islet localization suggests a possible relevance to diabetes.
- IL-B60, antagonists, antibodies, etc. can be purified and then administered to a patient, veterinary or human.
- reagents can be combined for therapeutic use with additional active or inert ingredients, e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, along with physiologically innocuous stabilizers, excipients, or preservatives.
- additional active or inert ingredients e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, along with physiologically innocuous stabilizers, excipients, or preservatives.
- These combinations can be sterile filtered and placed into dosage forms as by lyophilization in dosage vials or storage in stabilized aqueous preparations.
- This invention also contemplates use of antibodies or binding fragments thereof, including forms which are not complement binding.
- Drug screening using IL-B60 or fragments thereof can be performed to identify compounds having binding affinity to or other relevant biological effects on IL-B60 functions, including isolation of associated components. Subsequent biological assays can then be utilized to determine if the compound has intrinsic stimulating activity and is therefore a blocker or antagonist in that it blocks the activity of the cytokine. Likewise, a compound having intrinsic stimulating activity can activate the signal pathway and is thus an agonist in that it simulates the activity of IL-B60. This invention further contemplates the therapeutic use of blocking antibodies to IL-B60 as antagonists and of stimulatory antibodies as agonists. This approach should be particularly useful with other IL-B60 species variants.
- reagents necessary for effective therapy will depend upon many different factors, including means of administration, target site, physiological state of the patient, and other medicants administered. Thus, treatment dosages should be titrated to optimize safety and efficacy. Typically, dosages used in vitro may provide useful guidance in the amounts useful for in situ administration of these reagents. Animal testing of effective doses for treatment of particular disorders will provide further predictive indication of human dosage. Various considerations are described, e.g., in Gilman, et al . (eds. 1990) Goodman and Gilman' s: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington ' s Pharmaceutical Sciences, 17th ed. (1990) , Mack Publishing
- Pharmaceutically acceptable carriers will include water, saline, buffers, and other compounds described, e.g., in the Merck Index, Merck & Co., Rahway, New Jersey. Dosage ranges would ordinarily be expected to be in amounts lower than 1 mM concentrations, typically less than about 10 ⁇ M concentrations, usually less than about 100 nM, preferably less than about 10 pM (picomolar) , and most preferably less than about 1 fM ( femtomolar) , with an appropriate carrier. Slow release formulations, or a slow release apparatus will often be utilized for continuous or long term administration. See, e.g., Langer (1990) Science 249:1527-1533.
- IL-B60 may be administered directly to the host to be treated or, depending on the size of the compounds, it may be desirable to conjugate them to carrier proteins such as ovalbumin or serum albumin prior to their administration.
- Therapeutic formulations may be administered in many conventional dosage formulations. While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical formulation.
- Formulations typically comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof .
- Each carrier should be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the patient.
- Formulations include those suitable for oral, rectal, nasal, topical, or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. See, e.g., Gilman, et al . (eds. 1990) Goodman and Gilman' s: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington's Pharmaceutical Sciences, 17th ed. (1990), Mack Publishing Co., Easton, Penn. ; Avis, et al . (eds.
- compositions Parenteral Medications, Dekker, New York; Lieberman, et al . (eds. 1990) Pharmaceutical Dosage Forms: Tablets, Dekker, New York; and Lieberman, et al . (eds. 1990) Pharmaceutical Dosage Forms: Disperse Systems, Dekker, New York.
- the therapy of this invention may be combined with or used in association with other agents, e.g., other cytokines, including IL-6 or G-CSF, or their respective antagonists.
- IL-B60s of this invention are particularly useful in kits and assay methods which are capable of screening compounds for binding activity to the proteins.
- Several methods of automating assays have been developed in recent years so as to permit screening of tens of thousands of compounds in a short period. See, e.g., Fodor, et al . (1991) Science 251:767-773, which describes means for testing of binding affinity by a plurality of defined polymers synthesized on a solid substrate.
- suitable assays can be greatly facilitated by the availability of large amounts of purified, soluble IL-B60 as provided by this invention.
- Other methods can be used to determine the critical residues in IL-B60-IL-B60 receptor interactions.
- antagonists can normally be found once the antigen has been structurally defined, e.g., by tertiary structure data. Testing of potential interacting analogs is now possible upon the development of highly automated assay methods using a purified IL-B60. In particular, new agonists and antagonists will be discovered by using screening techniques described herein. Of particular importance are compounds found to have a combined binding affinity for a spectrum of IL-B60 molecules, e.g., compounds which can serve as antagonists for species variants of IL-B60.
- One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant DNA molecules expressing an IL-B60.
- Cells may be isolated which express an IL-B60 in isolation from other molecules.
- Such cells either in viable or fixed form, can be used for standard binding partner binding assays. See also, Parce, et al . (1989) Science 246:243-247; and Owicki, et al. (1990) Proc. Nat'l Acad. Sci. USA 87:4007-4011, which describe sensitive methods to detect cellular responses.
- Another technique for drug screening involves an approach which provides high throughput screening for compounds having suitable binding affinity to an IL-B60 and is described in detail in Geysen, European Patent Application 84/03564, published on September 13, 1984.
- a solid substrate e.g., plastic pins or some other appropriate surface, see Fodor, et al . (1991).
- all the pins are reacted with solubilized, unpurified or solubilized, purified IL-B60, and washed.
- the next step involves detecting bound IL-B60.
- Rational drug design may also be based upon structural studies of the molecular shapes of the IL-B60 and other effectors or analogs. Effectors may be other proteins which mediate other functions in response to binding, or other proteins which normally interact with IL-B60, e.g., a receptor.
- One means for determining which sites interact with specific other proteins is a physical structure determination, e.g., x-ray crystallography or 2 dimensional NMR techniques. These will provide guidance as to which amino acid residues form molecular contact regions, as modeled, e.g., against other cytokine-receptor models.
- protein structural determination see, e.g., Blundell and Johnson (1976) Protein Crystallography, Academic Press, New York.
- kits and methods for detecting the presence of another IL-B60 or binding partner will have a compartment containing either a defined IL- B60 peptide or gene segment or a reagent which recognizes one or the other, e.g., IL-B60 fragments or antibodies.
- a kit for ' determining the binding affinity of a test compound to an IL-B60 would typically comprise a test compound; a labeled compound, for example a binding partner or antibody having known binding affinity for IL-B60; a source of IL-B60 (naturally occurring or recombinant) ; and a means for separating bound from free labeled compound, such as a solid phase for immobilizing the molecule.
- a test compound for example a binding partner or antibody having known binding affinity for IL-B60
- a source of IL-B60 naturally occurring or recombinant
- a means for separating bound from free labeled compound such as a solid phase for immobilizing the molecule.
- a preferred kit for determining the concentration of, e.g., an IL-B60 in a sample would typically comprise a labeled compound, e.g., binding partner or antibody, having known binding affinity for the antigen, a source of cytokine (naturally occurring or recombinant) and a means for separating the bound from free labeled compound, e.g., a solid phase for immobilizing the IL-B60. Compartments containing reagents, and instructions, will normally be provided.
- Antibodies including antigen binding fragments, specific for the IL-B60 or fragments are useful in diagnostic applications to detect the presence of elevated levels of IL- B60 and/or its fragments.
- diagnostic assays can employ lysates, live cells, fixed cells, immunofluorescence, cell cultures, body fluids, and further can involve the detection of antigens related to the antigen in serum, or the like. Diagnostic assays may be homogeneous (without a separation step between free reagent and antigen-binding partner complex) or heterogeneous (with a separation step) .
- RIA radioimmunoassay
- ELISA enzyme-linked immunosorbent assay
- EIA enzyme immunoassay
- EMIT enzyme-multiplied immunoassay technique
- SFIA substrate-labeled fluorescent immunoassay
- Anti-idiotypic antibodies may have similar use to diagnose presence of antibodies against an IL-B60, as such may be diagnostic of various abnormal states. For example, overproduction of IL-B60 may result in production of various immunological reactions which may be diagnostic of abnormal physiological states, particularly in proliferative cell conditions such as cancer or abnormal activation or differentiation. Moreover, the distribution pattern available provides information that the cytokine is expressed in pancreatic islets, suggesting the possibility that the cytokine may be involved in function of that organ, e.g., in a diabetes relevant medical condition.
- the reagents for diagnostic assays are supplied in kits, so as to optimize the sensitivity of the assay.
- the protocol, and the label either labeled or unlabeled antibody or binding partner, or labeled IL-B60 is provided. This is usually in conjunction with other additives, such as buffers, stabilizers, materials necessary for signal production such as substrates for enzymes, and the like.
- the kit will also contain instructions for proper use and disposal of the contents after use.
- the kit has compartments for each useful reagent.
- the reagents are provided as a dry lyophilized powder, where the reagents may be reconstituted in an aqueous medium providing appropriate concentrations of reagents for performing the assay.
- labeling may be achieved by covalently or non- covalently joining a moiety which directly or indirectly provides a detectable signal.
- the binding partner, test compound, IL-B60, or antibodies thereto can be labeled either directly or indirectly.
- Possibilities for direct labeling include label groups: radiolabels such as 1 25 ⁇ / enzymes such as peroxidase and alkaline phosphatase, and fluorescent labels (U.S. Pat. No. 3,940,475) capable of monitoring the change in fluorescence intensity, wavelength shift, or fluorescence polarization.
- Possibilities for indirect labeling include biotinylation of one constituent followed by binding to avidin coupled to one of the above label groups.
- the IL-B60 can be immobilized on various matrixes followed by washing. Suitable matrixes include plastic such as an ELISA plate, filters, and beads. See, e.g., Coligan, et al . (eds. 1993) Current Protocols in Immunology, Vol. 1, Chapter 2, Greene and Wiley, NY.
- suitable separation techniques include, without limitation, the fluorescein antibody magnetizable particle method described in Rattle, et al . (1984) Clin. Chem. 30:1457-1461, and the double antibody magnetic particle separation as described in U.S. Pat. No. 4,659,678.
- Another diagnostic aspect of this invention involves use of oligonucleotide or polynucleotide sequences taken from the sequence of an IL-B60. These sequences can be used as probes for detecting levels of the IL-B60 message in samples from patients suspected of having an abnormal condition, e.g., inflammatory or autoimmune. Since the cytokine may be a marker or mediator for activation, it may be useful to determine the numbers of activated cells to determine, e.g., when additional therapy may be called for, e.g., in a preventative fashion before the effects become and progress to significance.
- the preparation of both RNA and DNA nucleotide sequences, the labeling of the sequences, and the preferred size of the sequences has received ample description and discussion in the literature.
- kits which also test for the qualitative or quantitative expression of other molecules are also contemplated. Diagnosis or prognosis may depend on the combination of multiple indications used as markers. Thus, kits may test for combinations of markers. See, e.g., Viallet, et al . (1989) Progress in Growth Factor Res. 1:89- 97. Other kits may be used to evaluate other cell subsets.
- IL-B60 cytokine without interfering with the binding to its receptor can be determined.
- an affinity label can be fused to either the amino- or carboxyl-terminus of the ligand.
- Such label may be a FLAG epitope tag, or, e.g., an Ig or Fc domain.
- An expression library can be screened for specific binding of the cytokine, e.g., by cell sorting, or other screening to detect subpopulations which express such a binding component.
- IL-6 or G-CSF receptor components are involved in response (s) to IL-B60. It is also quite possible that these functional receptor complexes may share many or all components with an IL-B60 receptor complex, either a specific receptor subunit or an accessory receptor subunit.
- Methods for protein purification include such methods as ammonium sulfate precipitation, column chromatography, electrophoresis, centrifugation, crystallization, and others. See, e.g., Ausubel, et al . (1987 and periodic supplements) ; Deutscher (1990) "Guide to Protein Purification,” Methods in Enzymology vol. 182, and other volumes in this series; Coligan, et al . (1995 and supplements) Current Protocols in Protein Science John Wiley and Sons, New York, NY; Matsudaira (ed.
- Assays for vascular biological activities are well known in the art. They will cover angiogenic and angiostatic activities in tumor, or other tissues, e.g., arterial smooth muscle proliferation (see, e.g., Koyoma, et al . (1996) Cell 87:1069-1078), monocyte adhesion to vascular epithelium (see McEvoy, et al . (1997) J. Exp. Med. 185:2069-2077), etc. See also Ross (1993) Nature 362:801-809; Rekhter and Gordon
- the sequence of the gene is provided in Table 1.
- the sequence is derived from a genomic human sequence. These sequences allow preparation of PCR primers, or probes, to determine cellular distribution of the gene. The sequences allow isolation of genomic DNA which encode the message.
- PCR products are cloned using, e.g., a TA cloning kit (Invitrogen) .
- the resulting cDNA plasmids are sequenced from both termini on an automated sequencer (Applied Biosystems) .
- probes specific for cDNA encoding primate IL-B60 are prepared.
- the probe is labeled, e.g., by random priming.
- the expression is probably in the cell types described, and perhaps also in pancreatic islets.
- IL-B60 could only be immunoprecipitated from the lysate of the transfected cells.
- IL-12 p35/p40
- receptor CLF-1 NR6
- DNA (5 ⁇ g) from a primary amplified cDNA library is digested with appropriate restriction enzymes to release the inserts, run on a 1% agarose gel and transferred to a nylon membrane (Schleicher and Schuell, Keene, NH) .
- Samples for human mRNA isolation can include, e.g., peripheral blood mononuclear cells (monocytes, T cells, NK cells, granulocytes, B cells) , resting (T100) ; peripheral blood mononuclear cells, activated with anti-CD3 for 2, 6, 12 h pooled (T101) ; T cell, THO clone Mot 72, resting (T102); T cell, THO clone Mot 72, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T103); T cell, THO clone Mot 72, anergic treated with specific peptide for 2, 7, 12 h pooled (T104); T cell, THl clone HY06, resting (T107); T cell, THl clone HY06, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T108); T cell, THl clone HY06, ane
- IL-B60 transcript was very high in elutriated monocytes, activated with LPS, IFN ⁇ , anti-IL-10 for 4, 16 h pooled (M106); elutriated monocytes, activated with LPS, IFN ⁇ , anti-IL-10 for 1, 2, 6, 12, 24 h pooled (M102); elutriated monocytes, activated LPS for 6 h (M109); and elutriated monocytes, activated LPS for 1 h (M108) .
- Samples for mouse mRNA expression can include, e.g., resting mouse fibroblastic L cell line (C200); Braf:ER (Braf fusion to estrogen receptor) transfected cells, control (C201); Mell4+ naive T cells from spleen, resting (T209); Mell4+ naive T cells from spleen, stimulated with IFN ⁇ , IL-12, and anti IL-4 to polarize to THl cells, exposed to IFN ⁇ and IL-4 for 6, 12, 24 h, pooled (T210); Mell4+ naive T cells from spleen, stimulated with IL-4 and anti IFN ⁇ to polarize to Th2 cells, exposed to IL-4 and anti IFN ⁇ for 6, 13, 24 h, pooled (T211) ; T cells, THl polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IFN- ⁇ and anti
- T cells TH2 polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IL-4 and anti-IFN- ⁇ ; T201) ; T cells, highly THl polarized 3x from transgenic Balb/C (see Openshaw, et al . (1995) J. Exp . Med.
- T cells highly TH2 polarized 3x from transgenic Balb/C (activated with anti-CD3 for 2, 6, 24 h pooled (T203); T cells, highly THl polarized 3x from transgenic C57 bl/6 (activated with anti-CD3 for 2, 6, 24 h pooled; T212); T cells, highly TH2 polarized 3x from transgenic C57 bl/6 (activated with anti-CD3 for 2, 6, 24 h pooled; T213); T cells, highly THl polarized (naive CD4+ T cells from transgenic Balb/C, polarized 3x with IFN ⁇ , IL-12, and anti-IL- 4; stimulated with IGIF, IL-12, and anti IL-4 for 6, 12, 24 h, pooled) ; CD44- CD25+ pre T cells, sorted from thymus
- T204 THl T cell clone Dl.l, resting for 3 weeks after last stimulation with antigen
- T205 THl T cell clone Dl.l, 10 ⁇ g/ml ConA stimulated 15 h
- T206 TH2 T cell clone CDC35, resting for 3 weeks after last stimulation with antigen
- T207 TH2 T cell clone CDC35, 10 ⁇ g/ml ConA stimulated 15 h (T208); unstimulated B cell line CH12 (B201) ; unstimulated mature B cell leukemia cell line A20 (B200) ; unstimulated large B cells from spleen (B202); B cells from total spleen, LPS activated (B203); metrizamide enriched dendritic cells from spleen, resting (D200) ; dendritic cells from bone marrow, resting (D201); unstimulated bone marrow derived dendritic cells deplete
- the human IL-B60 was found expressed in T cells; the ThO clone Mot72 (activated); activated PBL; monocytes; dendritic cells; fetal lung, and heavy smoker lung samples.
- the CLF-1 was found expressed in dendritic cells; splenocytes; Thl cells; fetal lung; and lung samples. This distribution is consistent with the complex being important in immune function, e.g., dendritic and immune cells, and in lung physiology.
- Chromosome mapping is a standard technique. See, e.g., BIOS Laboratories (New Haven, CT) and methods for using a mouse somatic cell hybrid panel with PCR.
- the human IL-B60 gene has been localized to human chromosome 11.
- transfected cell lines are screened for one which expresses the cytokine at a high level compared with other cells.
- a recombinant construct with both subunits can be made.
- Various cell lines are screened and selected for their favorable properties in handling.
- Natural IL-B60 can be isolated from natural sources, or by expression from a transformed cell using an appropriate expression vector. Purification of the expressed protein or complex is achieved by standard procedures, or may be combined with engineered means for effective purification at high efficiency from cell lysates or supernatants . FLAG or His ⁇ segments can be used for such purification features. Alternatively, affinity chromatography may be used with specific antibodies, see below.
- Protein is produced in coli, insect cell, or mammalian expression systems, as desired.
- the IL-B60 cDNA, or other species counterpart sequence can be used as a hybridization probe to screen a library from a desired source, e.g., a primate cell cDNA library. Many different species can be screened both for stringency necessary for easy hybridization, and for presence using a probe. Appropriate hybridization conditions will be used to select for clones exhibiting specificity of cross hybridization. Screening by hybridization using degenerate probes based upon the peptide sequences will also allow isolation of appropriate clones. Alternatively, use of appropriate primers for PCR screening will yield enrichment of appropriate nucleic acid clones. Similar methods are applicable to isolate either species, polymorphic, or allelic variants.
- Species variants are isolated using cross-species hybridization techniques based upon isolation of a full length isolate or fragment from one species as a probe.
- antibodies raised against human IL-B60 will be used to screen for cells which express cross-reactive proteins from an appropriate, e.g., cDNA library.
- the purified protein or defined peptides are useful for generating antibodies by standard methods, as described above. Synthetic peptides or purified protein are presented to an immune system to generate monoclonal or polyclonal antibodies. See, e.g., Coligan (1991) Current Protocols in Immunology Wiley/Greene; and Harlow and Lane (1989) Antibodies: A Laboratory Manual Cold Spring Harbor Press .
- binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods.
- Immunoselection, immunodepletion, and related techniques are available to prepare selective reagents, as desired, e.g., for the IL-B60 alone, or the complex between the two subunits .
- a CLF-1-FLAG construct was prepared in an expression vector.
- An IL-B60Etag (epitope tagged) construct was also prepared.
- the Etag antibody immunoprecipitates both proteins, e.g., they form a complex.
- CLF- 1FLAG a little bit of CLF-1FLAG protein is immunoprecipitated with the anti-FLAG M2 Ab. This result is consistent with the other soluble receptors, e.g., for p40 component of IL-12.
- the double transfectants not only is more CLF-1 seen, but now also IL-B60. The immunoprecipitation works in both directions.
- IL-B60 binds to the CNTFR
- Hyper-CNTFR-IL-B60 was able to induce proliferation of BAF3/gpl30/LIFR cells but not of BAF3/gpl30 cells, showing that the LIFR is a component of the signaling complex. Stimulation of cells with hyper-CLF-1-IL- B60 did not result in proliferation of any cell line. This indicated that although necessary for IL-B60 secretion, CLF-1 is not a subunit of the active signaling receptor complex. Involvement of gpl30 in the active receptor complex was shown with a neutralizing antibody against gpl30 which completely blocked this response.
- Biological activities of IL-B60 or complex are tested based, e.g., on the sequence and structural homology between IL-B60 and IL-6 and G-CSF. Initially, assays that had shown biological activities of IL-6 or G-CSF are examined.
- IL-B60 and CLF-1 expression in the mouse spinal cord was analyzed in unilateral transection of the sciatic nerve followed by separation of proximal and distal nerve stumps, thus preventing regeneration. At various timepoints, tissue from the transection area was collected and analyzed by quantitative PCR for expression of IL-B60 and CLF-1. Transection of the sciatic nerve resulted in fast and long lasting upregulation of ligand and receptor. After 6 hrs IL- B60 and CLF-1 were upregulated. Expression was still elevated 20 days after transsection when compared to non- lesioned or sham-lesioned nerves.
- both IL-B60 and CLF-1 are downregulated after 12 h, but whereas IL-B60 expression almost reaches levels of non-lesioned nerves after 20 days, CLF-1 levels peak after 20 days. This might point to an additional function of CLF-1, possibly in remyelination, which starts after two weeks.
- Transection of the sciatic nerve in mice lacking GM-CSF and a macrophage response in nerve shows that IL-B60 expression after 4 days is not altered compared to normal mice.
- CLF-1 levels in those mice are heterogenous, with a range from no alteration to an almost 4 fold increase of expression compared to normal littermates.
- a dose response analysis is performed, in combinations with the related cytokines IL-6, G-CSF, etc.
- a cytosensor machine may be used, which detects cell metabolism and growth (Molecular Devices, Sunnyvale, CA) .
- Monocytes are purified by negative selection from peripheral blood mononuclear cells of normal healthy donors. Briefly, 3 x 10 ⁇ ficoll banded mononuclear cells are incubated on ice with a cocktail of monoclonal antibodies (Becton-Dickinson; Mountain View, CA) consisting, e.g., of 200 ⁇ l of ⁇ CD2 (Leu-5A) , 200 ⁇ l of ⁇ CD3 (Leu-4), 100 ⁇ l of ⁇ CD8 (Leu 2a) , 100 ⁇ l of ⁇ CD19 (Leu-12 ) , 100 ⁇ l of ⁇ CD20
- a cocktail of monoclonal antibodies consisting, e.g., of 200 ⁇ l of ⁇ CD2 (Leu-5A) , 200 ⁇ l of ⁇ CD3 (Leu-4), 100 ⁇ l of ⁇ CD8 (Leu 2a) , 100 ⁇ l of ⁇ CD19 (Leu-12 ) , 100 ⁇ l of ⁇ CD
- Antibody bound cells are washed and then incubated with sheep anti-mouse IgG coupled magnetic beads (Dynal, Oslo, Norway) at a bead to cell ratio of 20:1. Antibody bound cells are separated from monocytes by application of a magnetic field.
- human monocytes are cultured in Yssel ' s medium (Gemini Bioproducts, Calabasas, CA) containing 1% human AB serum in the absence or presence of IL-B60, IL-6, G-CSF or combinations.
- Yssel ' s medium Gibco Bioproducts, Calabasas, CA
- Analyses of the expression of cell surface molecules can be performed by direct immunofluorescence. For example, 2 x 10 ⁇ purified human monocytes are incubated in phosphate buffered saline (PBS) containing 1% human serum on ice for 20 minutes. Cells are pelleted at 200 x g. Cells are resuspended in 20 ml PE or FITC labeled mAb. Following an additional 20 minute incubation on ice, cells are washed in PBS containing 1% human serum followed by two washes in PBS alone. Cells are fixed in PBS containing 1% paraformaldehyde and analyzed on FACScan flow cytometer (Becton Dickinson; Mountain View, CA) .
- PBS phosphate buffered saline
- Exemplary mAbs are used, e.g.: CDllb (anti-macl), CDllc (a gpl50/95), CD14 (Leu-M3), CD54 (Leu 54), CD80 (anti-BBl/B7) , HLA-DR (L243) from Becton-Dickinson and CD86 (FUN 1; Pharmingen) , CD64 (32.2; Medarex) , CD40 (mAb89; Schering-Plough France).
- CDllb anti-macl
- CDllc a gpl50/95
- CD14 Leu-M3
- CD54 Leu 54
- CD80 anti-BBl/B7
- HLA-DR L243
- CD64 32.2; Medarex
- CD40 mAb89; Schering-Plough France
- IL-B60 Effects of IL-B60 or complex on cytokine production by human monocytes
- Human monocytes are isolated as described and cultured in Yssel ' s medium (Gemini Bioproducts, Calabasas, CA) containing 1% human AB serum in the absence or presence of IL-B60 (1/100 dilution baculovirus expressed material) .
- monocytes are stimulated with LPS (E. coli 0127 :B8 Difco) in the absence or presence of IL-B60 and the concentration of cytokines (IL-l ⁇ , IL-6, TNF ⁇ , GM-CSF, and IL-10) in the cell culture supernatant determined by ELISA.
- LPS E. coli 0127 :B8 Difco
- monocytes are cultured (1 million/ml) in Yssel ' s medium in the absence or presence of IL-B60 and LPS (E. coli 0127 :B8 Difco) and 10 mg/ml Brefeldin A (Epicentre technologies Madison WI) for 12 hrs.
- Cells are washed in PBS and incubated in 2% formaldehyde/PBS solution for 20 minutes at RT .
- Subsequently cells are washed, resuspended in permeabilization buffer (0.5% saponin (Sigma) in PBS/BSA (0.5%) /Azide (1 mM) ) and incubated for 20 minutes at RT.
- Cells (2 x 10 5 ) are centrifuged and resuspended in 20 ml directly conjugated anti-cytokine mAbs diluted 1:10 in permeabilization buffer for 20 minutes at RT.
- the following antibodies can be used: IL-l ⁇ -PE (364-3B3-14) ; IL-6-PE (MQ2-13A5); TNF ⁇ -PE (MAbll); GM-CSF-PE (BVD2-21C11) ; and IL-12-PE (Cll.5.14; Pharmingen San Diego, CA) .
- IL-l ⁇ -PE 364-3B3-14
- IL-6-PE MQ2-13A5
- TNF ⁇ -PE MAbll
- GM-CSF-PE GM-CSF-PE
- IL-12-PE Cll.5.14; Pharmingen San Diego, CA
- PBMC peripheral blood mononuclear cells
- IL-B60 Cells are cultured in medium alone or in combination with 100 U/ml IL-2 (R&D Systems) for 120 hours. 3H-Thymidine (0.1 mCi) is added during the last six hours of culture and 3H-Thymidine incorporation determined by liquid scintillation counting.
- the native, recombinant, and fusion proteins would be tested for agonist and antagonist activity in many other biological assay systems, e.g., on T-cells, B-cells, NK, macrophages, dendritic cells, hematopoietic progenitors, etc. Because of the IL-6 and G-CSF structural relationship, assays related to those activities should be analyzed
- IL-B60 is evaluated for agonist or antagonist activity on transfected cells expressing IL-6 or G-CSF receptor and controls. See, e.g., Ho, et al . (1993) Proc. Nat ' 1 Acad. Sci. USA 90, 11267-11271; Ho, et al . (1995) Mol. Cell. Biol. 15:5043-5053; and Liu, et al . (1994). J. Immunol. 152:1821- 1829.
- IL-B60 is evaluated for effect in macrophage/dendritic cell activation and antigen presentation assays, T cell cytokine production and proliferation in response to antigen or allogeneic stimulus. See, e.g., de Waal Malefyt et al . (1991) J. EXP. Med. 174:1209-1220; de Waal Malefyt et al .
- IL-B60 will also be evaluated for effects on NK cell stimulation. Assays may be based, e.g., on Hsu, et al .
- B cell growth and differentiation effects will be analyzed, e.g., by the methodology described, e.g., in Defrance, et al . (1992). J. EXP. Med. 175:671-682; Rousset, et al. (1992) Proc. Nat'l Acad. Sci. USA 89:1890-1893; including IgG2 and IgA2 switch factor assays. Note that, unlike COS7 supernatants, NIH3T3 and COP supernatants apparently do not interfere with human B cell assays.
- IL-B60 and CLF-1 induce a switch in neurotransmitter properties
- Cholineric sympathetic neurons innervate at least three different targets: sweat glands, vasculature in skeletal muscle, and periosteum. Mature innervation of sympathetic neurons begins at the end of the first postnatal week and is characterized by the appearance of cholineric properties. Cultures of sympathetic neurons were analyzed for the induction of different neuromodulators , which specify the cholinergic phenotype. Cholecystokinin (CCK) , vasoactive intestinal polypeptide (VIP) , substance P (SP) and somatostatin (SOM) are upregulated after stimulation of neurons v ⁇ th conditioned medium from IL-B60 /CLF-1 cotransfected cells or the CNTFR-IL-B60 fusion protein. Thus, the complex exhibits significant developmental biology function, and may be effective in inducing certain aspects of neural development.
- CCK Cholecystokinin
- VIP vasoactive intestinal polypeptide
- SP substance P
- SOM somatostatin
- Transgenic mice can be generated by standard methods. Such animals are useful to determine the effects of overexpression of the gene, in specific tissues, or completely throughout the organism. Such may provide interesting insight into development of the animal or particular tissues in various stages. Moreover, the effect on various responses to biological stress can be evaluated. See, e.g., Hogan, et al . (1995) Manipulating the Mouse Embryo: A Laboratory Manual (2d ed.) Cold Spring Harbor Laboratory Press . Adenovirus techniques are available for expression of the gene in various cells and organs. See, e.g., Hitt, et al. (1997) Adv. Pharmacol. 40:137-195; and literature from Quantum Biotechnologies, Montreal, Canada. Animals may be useful to determine the effects of the gene on various developmental or physiologically functional animal systems.
- the genomic structure for the mouse IL-B60 has been determined.
- a strategy for the production of IL-B60 knock- out mice can be developed, and appropriate constructs made.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE60041393T DE60041393D1 (de) | 1999-03-11 | 2000-03-09 | Cytokine aus säugetieren, verwandte reagenzien und verfahren |
| CA002366706A CA2366706A1 (en) | 1999-03-11 | 2000-03-09 | Mammalian cytokines; related reagents and methods |
| JP2000604066A JP2003500010A (ja) | 1999-03-11 | 2000-03-09 | 哺乳動物サイトカイン;関連試薬および方法 |
| AU38732/00A AU3873200A (en) | 1999-03-11 | 2000-03-09 | Mammalian cytokines; related reagents and methods |
| EP00917821A EP1159299B1 (en) | 1999-03-11 | 2000-03-09 | Mammalian cytokines; related reagents and methods |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US26790199A | 1999-03-11 | 1999-03-11 | |
| US09/267,901 | 1999-03-11 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2000053631A1 true WO2000053631A1 (en) | 2000-09-14 |
Family
ID=23020618
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2000/006182 Ceased WO2000053631A1 (en) | 1999-03-11 | 2000-03-09 | Mammalian cytokines; related reagents and methods |
Country Status (9)
| Country | Link |
|---|---|
| EP (2) | EP1159299B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2003500010A (cg-RX-API-DMAC7.html) |
| AR (1) | AR022890A1 (cg-RX-API-DMAC7.html) |
| AT (1) | ATE420894T1 (cg-RX-API-DMAC7.html) |
| AU (1) | AU3873200A (cg-RX-API-DMAC7.html) |
| CA (1) | CA2366706A1 (cg-RX-API-DMAC7.html) |
| DE (1) | DE60041393D1 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2319958T3 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2000053631A1 (cg-RX-API-DMAC7.html) |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2804435A1 (fr) * | 2000-01-27 | 2001-08-03 | Pf Medicament | COMPLEXE ISOLE COMPRENANT UNE PROTEINE NNT-1 ET EN OUTRE AU MOINS UNE PROTEINE CLF-1 ET/OU UNE PROTEINE sCNTFRalpha |
| WO2007027714A2 (en) | 2005-08-31 | 2007-03-08 | Schering Corporation | Engineered anti-il-23 antibodies |
| US7247711B2 (en) | 2003-05-09 | 2007-07-24 | Centocor, Inc. | IL-23p40 specific antibody |
| US7252971B2 (en) | 2004-09-24 | 2007-08-07 | Centocor, Inc. | IL-23p40 specific immunoglobulin derived proteins |
| JP2007270148A (ja) * | 2000-10-18 | 2007-10-18 | Univ California | 内在化機能を有する抗体の高処理スクリーニングの方法 |
| WO2008106134A2 (en) | 2007-02-28 | 2008-09-04 | Schering Corporation | Engineered anti-il-23r antibodies |
| WO2008106131A2 (en) | 2007-02-28 | 2008-09-04 | Schering Corporation | Combination therapy for treatment of immune disorders |
| US7491391B2 (en) | 2005-06-30 | 2009-02-17 | Centocor, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US7935344B2 (en) | 2005-12-29 | 2011-05-03 | Centocor Ortho Biotech Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| EP2426145A1 (en) | 2007-02-23 | 2012-03-07 | Schering Corporation | Engineered anti-IL-23p19 antibodies |
| EP2426144A1 (en) | 2007-02-23 | 2012-03-07 | Schering Corporation | Engineered anti-IL-23p19 antibodies |
| WO2014004436A2 (en) | 2012-06-27 | 2014-01-03 | Merck Sharp & Dohme Corp. | Crystalline anti-human il-23 antibodies |
| WO2014093203A1 (en) | 2012-12-13 | 2014-06-19 | Merck Sharp & Dohme Corp. | SOLUTION FORMULATIONS OF ENGINEERED ANTI-IL-23p19 ANTIBODIES |
| US11548941B2 (en) | 2018-11-20 | 2023-01-10 | Janssen Biotech, Inc. | Safe and effective method of treating psoriasis with anti-IL-23 specific antibody |
| US11633476B2 (en) | 2017-05-02 | 2023-04-25 | Merck Sharp & Dohme Llc | Stable formulations of programmed death receptor 1 (PD-1) antibodies and methods of use thereof |
| US11780911B2 (en) | 2019-05-23 | 2023-10-10 | Janssen Biotech, Inc. | Method of treating inflammatory bowel disease with a combination therapy of antibodies to IL-23 and TNF alpha |
| US11845798B2 (en) | 2017-05-02 | 2023-12-19 | Merck Sharp & Dohme Llc | Formulations of anti-LAG3 antibodies and co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US12258393B2 (en) | 2020-05-21 | 2025-03-25 | Janssen Biotech, Inc. | Method of treating inflammatory bowel disease with a combination therapy of antibodies to IL-23 and TNF alpha |
| US12319735B2 (en) | 2018-11-07 | 2025-06-03 | Merck Sharp & Dohme Llc | Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US12565526B2 (en) | 2018-10-18 | 2026-03-03 | Merck Sharpe & Dohme LLC | Formulations of anti-RSV antibodies and methods of use thereof |
| US12576159B2 (en) | 2018-10-31 | 2026-03-17 | Merck Sharp & Dohme Llc | Anti-human PD-1 antibody crystals and methods of use thereof |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1995011303A1 (en) * | 1993-10-20 | 1995-04-27 | Regeneron Pharmaceuticals, Inc. | Cntf family antagonists |
| EP0759466A2 (en) * | 1995-08-01 | 1997-02-26 | F. Hoffmann-La Roche Ag | Low binding affinity interleukin-12 beta receptors |
| WO1998011225A2 (en) * | 1996-09-11 | 1998-03-19 | Amrad Operations Pty. Ltd. | A novel haemopoietin receptor and genetic sequences encoding same |
| WO1998031811A1 (en) * | 1997-01-16 | 1998-07-23 | Genetics Institute, Inc. | Member of the hematopoietin receptor superfamily |
| WO1998033922A1 (en) * | 1997-02-03 | 1998-08-06 | Amgen Inc. | The neurotrophic factor nnt-1 |
| WO1998049307A1 (en) * | 1997-05-01 | 1998-11-05 | Zymogenetics, Inc. | Mammalian cytokine-like receptor |
| WO1999000415A1 (en) * | 1997-06-30 | 1999-01-07 | Human Genome Sciences, Inc. | Cardiotrophin-like cytokine |
| WO1999020755A2 (en) * | 1997-10-16 | 1999-04-29 | Glaxo Group Limited | Novel cytokine receptors |
| WO1999028462A2 (en) * | 1997-12-03 | 1999-06-10 | Genentech, Inc. | Polypeptides and nucleic acids encoding the same |
| WO1999035264A1 (en) * | 1998-01-09 | 1999-07-15 | Immunex Corporation | H14 dna and polypeptides |
| WO1999040195A1 (en) * | 1998-02-06 | 1999-08-12 | Schering Corporation | Mammalian receptor proteins; related reagents and methods |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3940475A (en) | 1970-06-11 | 1976-02-24 | Biological Developments, Inc. | Radioimmune method of assaying quantitatively for a hapten |
| NL154598B (nl) | 1970-11-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van laagmoleculire verbindingen en van eiwitten die deze verbindingen specifiek kunnen binden, alsmede testverpakking. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| DE3382317D1 (de) | 1982-03-15 | 1991-07-25 | Schering Corp | Hybride dns, damit hergestellte bindungszusammensetzung und verfahren dafuer. |
| US4659678A (en) | 1982-09-29 | 1987-04-21 | Serono Diagnostics Limited | Immunoassay of antigens |
| NZ207394A (en) | 1983-03-08 | 1987-03-06 | Commw Serum Lab Commission | Detecting or determining sequence of amino acids |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4859609A (en) | 1986-04-30 | 1989-08-22 | Genentech, Inc. | Novel receptors for efficient determination of ligands and their antagonists or agonists |
| US5741772A (en) * | 1997-02-03 | 1998-04-21 | Amgen Inc. | Neurotrophic factor NNT-1 |
| PT1181366E (pt) * | 1999-06-01 | 2009-05-25 | Schering Corp | Proteínas receptoras de mamífero; reagentes e métodos relacionados |
| FR2804435A1 (fr) * | 2000-01-27 | 2001-08-03 | Pf Medicament | COMPLEXE ISOLE COMPRENANT UNE PROTEINE NNT-1 ET EN OUTRE AU MOINS UNE PROTEINE CLF-1 ET/OU UNE PROTEINE sCNTFRalpha |
-
2000
- 2000-03-09 DE DE60041393T patent/DE60041393D1/de not_active Expired - Lifetime
- 2000-03-09 JP JP2000604066A patent/JP2003500010A/ja active Pending
- 2000-03-09 AU AU38732/00A patent/AU3873200A/en not_active Abandoned
- 2000-03-09 AR ARP000101059A patent/AR022890A1/es unknown
- 2000-03-09 ES ES00917821T patent/ES2319958T3/es not_active Expired - Lifetime
- 2000-03-09 AT AT00917821T patent/ATE420894T1/de not_active IP Right Cessation
- 2000-03-09 CA CA002366706A patent/CA2366706A1/en not_active Abandoned
- 2000-03-09 EP EP00917821A patent/EP1159299B1/en not_active Expired - Lifetime
- 2000-03-09 EP EP08103087A patent/EP1942114A3/en not_active Withdrawn
- 2000-03-09 WO PCT/US2000/006182 patent/WO2000053631A1/en not_active Ceased
Patent Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1995011303A1 (en) * | 1993-10-20 | 1995-04-27 | Regeneron Pharmaceuticals, Inc. | Cntf family antagonists |
| EP0759466A2 (en) * | 1995-08-01 | 1997-02-26 | F. Hoffmann-La Roche Ag | Low binding affinity interleukin-12 beta receptors |
| WO1998011225A2 (en) * | 1996-09-11 | 1998-03-19 | Amrad Operations Pty. Ltd. | A novel haemopoietin receptor and genetic sequences encoding same |
| WO1998031811A1 (en) * | 1997-01-16 | 1998-07-23 | Genetics Institute, Inc. | Member of the hematopoietin receptor superfamily |
| WO1998033922A1 (en) * | 1997-02-03 | 1998-08-06 | Amgen Inc. | The neurotrophic factor nnt-1 |
| WO1998049307A1 (en) * | 1997-05-01 | 1998-11-05 | Zymogenetics, Inc. | Mammalian cytokine-like receptor |
| WO1999000415A1 (en) * | 1997-06-30 | 1999-01-07 | Human Genome Sciences, Inc. | Cardiotrophin-like cytokine |
| WO1999020755A2 (en) * | 1997-10-16 | 1999-04-29 | Glaxo Group Limited | Novel cytokine receptors |
| WO1999028462A2 (en) * | 1997-12-03 | 1999-06-10 | Genentech, Inc. | Polypeptides and nucleic acids encoding the same |
| WO1999035264A1 (en) * | 1998-01-09 | 1999-07-15 | Immunex Corporation | H14 dna and polypeptides |
| WO1999040195A1 (en) * | 1998-02-06 | 1999-08-12 | Schering Corporation | Mammalian receptor proteins; related reagents and methods |
Non-Patent Citations (6)
| Title |
|---|
| FISCHER M ET AL: "A BIOACTIVE DESIGNER CYTOKINE FOR HUMAN HEMATOPOIETIC PROGENITOR CELL EXPANSION", NATURE BIOTECHNOLOGY,US,NATURE PUBLISHING, vol. 15, no. 2, 1 February 1997 (1997-02-01), pages 142 - 145, XP002047603, ISSN: 1087-0156 * |
| GREG C A ELSON ET AL: "Cytokine-like factor-1, a novel soluble protein, shares homology with members of the cytokine type I receptor family", JOURNAL OF IMMUNOLOGY,US,THE WILLIAMS AND WILKINS CO. BALTIMORE, vol. 161, no. 3, 1 August 1998 (1998-08-01), pages 1371 - 1379, XP002111421, ISSN: 0022-1767 * |
| PETERS M ET AL.,: "In vivo and in vitro activities of the gp130-stimulating designer cytokine hyper-IL6", THE JOURNAL OF IMMUNOLOGY, vol. 161, 1998, pages 3575 - 3581, XP002144212 * |
| RAKEMANN TIM ET AL: "The designer cytokine hyper-interleukin-6 is a potent activator of STAT3-dependent gene transcription in vivo and in vitro.", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 274, no. 3, 15 January 1999 (1999-01-15), pages 1257 - 1266, XP002144213, ISSN: 0021-9258 * |
| SENALDI GIORGIO ET AL: "Novel neurotrophin-1/B cell-stimulating factor-3: A cytokine of the IL-6 family.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES, vol. 96, no. 20, September 1999 (1999-09-01), pages 11458 - 11463, XP002144214, ISSN: 0027-8424 * |
| SHI Y ET AL: "Computational EST database analysis identifies a novel member of the neuropoietic cytokine family.", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 262, no. 1, 19 August 1999 (1999-08-19), pages 132 - 138, XP000929732, ISSN: 0006-291X * |
Cited By (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001055172A3 (fr) * | 2000-01-27 | 2001-11-15 | Pf Medicament | COMPLEXE ISOLE COMPRENANT UNE PROTEINE NNT-1 ET EN OUTRE AU MOINS UNE PROTEINE CLF-1 ET/OU UNE PROTEINE sCNTFR$g(a) |
| FR2804435A1 (fr) * | 2000-01-27 | 2001-08-03 | Pf Medicament | COMPLEXE ISOLE COMPRENANT UNE PROTEINE NNT-1 ET EN OUTRE AU MOINS UNE PROTEINE CLF-1 ET/OU UNE PROTEINE sCNTFRalpha |
| JP2007270148A (ja) * | 2000-10-18 | 2007-10-18 | Univ California | 内在化機能を有する抗体の高処理スクリーニングの方法 |
| US7247711B2 (en) | 2003-05-09 | 2007-07-24 | Centocor, Inc. | IL-23p40 specific antibody |
| US7807471B2 (en) | 2004-09-24 | 2010-10-05 | Centocor Ortho Biotech, Inc. | IL-23p40 specific immunoglobulin derived proteins, compositions, epitopes, methods and uses |
| US7252971B2 (en) | 2004-09-24 | 2007-08-07 | Centocor, Inc. | IL-23p40 specific immunoglobulin derived proteins |
| US9505837B2 (en) | 2005-06-30 | 2016-11-29 | Janssen Biotech, Inc. | Anti-IL-23 antibodies |
| US12161716B2 (en) | 2005-06-30 | 2024-12-10 | Janssen Biotech, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US11185584B2 (en) | 2005-06-30 | 2021-11-30 | Janssen Biotech, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US7491391B2 (en) | 2005-06-30 | 2009-02-17 | Centocor, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US8574579B2 (en) | 2005-06-30 | 2013-11-05 | Janssen Biotech, Inc. | Anti-IL-23 antibodies |
| US9096667B2 (en) | 2005-06-30 | 2015-08-04 | Janssen Biotech, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US7807414B2 (en) | 2005-06-30 | 2010-10-05 | Centocor Ortho Biotech Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US10576150B2 (en) | 2005-06-30 | 2020-03-03 | Janssen Biotech, Inc. | Anti-IL-23 antibodies |
| US9127058B2 (en) | 2005-06-30 | 2015-09-08 | Janssen Biotech, Inc. | Anti-IL-23 Antibodies |
| US10272152B2 (en) | 2005-06-30 | 2019-04-30 | Janssen Biotech, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US9714287B2 (en) | 2005-06-30 | 2017-07-25 | Janssen Biotech, Inc. | Anti-IL-23 antibody compositions |
| WO2007027714A2 (en) | 2005-08-31 | 2007-03-08 | Schering Corporation | Engineered anti-il-23 antibodies |
| EP3190125A1 (en) | 2005-08-31 | 2017-07-12 | Merck Sharp & Dohme Corp. | Engineered anti-il-23 antibodies |
| EP2354160A1 (en) | 2005-08-31 | 2011-08-10 | Schering Corporation | Engineered anti-IL-23-antibodies |
| US8362212B2 (en) | 2005-08-31 | 2013-01-29 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23 antibodies |
| US7807160B2 (en) | 2005-08-31 | 2010-10-05 | Schering Corporation | Engineered anti-IL-23 antibodies |
| US7993645B2 (en) | 2005-12-29 | 2011-08-09 | Janssen Biotech, Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| US9353181B2 (en) | 2005-12-29 | 2016-05-31 | Janssen Biotech, Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| US12129293B2 (en) | 2005-12-29 | 2024-10-29 | Janssen Biotech, Inc. | Medical device for administering anti-IL-23 antibodies |
| US10954297B2 (en) | 2005-12-29 | 2021-03-23 | Janssen Biotech, Inc. | Methods of treatment using human anti-IL-23 antibodies |
| US7935344B2 (en) | 2005-12-29 | 2011-05-03 | Centocor Ortho Biotech Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| US8221760B2 (en) | 2005-12-29 | 2012-07-17 | Janssen Biotech, Inc. | Methods of treatment using human anti-IL-23 antibodies |
| US10030070B2 (en) | 2005-12-29 | 2018-07-24 | Janssen Biotech, Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| US9783607B2 (en) | 2005-12-29 | 2017-10-10 | Janssen Biotech, Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| US8106177B2 (en) | 2005-12-29 | 2012-01-31 | Janssen Biotech, Inc. | Nucleic acids encoding human anti-IL-23 antibodies |
| US9809648B2 (en) | 2007-02-23 | 2017-11-07 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23p19 antibodies |
| US8513389B2 (en) | 2007-02-23 | 2013-08-20 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23p19 antibodies |
| EP2426144A1 (en) | 2007-02-23 | 2012-03-07 | Schering Corporation | Engineered anti-IL-23p19 antibodies |
| EP2426145A1 (en) | 2007-02-23 | 2012-03-07 | Schering Corporation | Engineered anti-IL-23p19 antibodies |
| US8293883B2 (en) | 2007-02-23 | 2012-10-23 | Schering Corporation | Engineered anti-IL-23P19 antibodies |
| US8404813B2 (en) | 2007-02-23 | 2013-03-26 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23P19 antibodies |
| WO2008106134A2 (en) | 2007-02-28 | 2008-09-04 | Schering Corporation | Engineered anti-il-23r antibodies |
| US8119133B2 (en) | 2007-02-28 | 2012-02-21 | Schering Corporation | Engineered anti-IL-23R antibodies |
| US8309085B2 (en) | 2007-02-28 | 2012-11-13 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23R antibodies |
| EP2417974A1 (en) | 2007-02-28 | 2012-02-15 | Schering Corporation | Combination therapy for treatment of immune disorders |
| EP2395025A1 (en) | 2007-02-28 | 2011-12-14 | Schering Corporation | Engineered Anti-IL-23R Antibodies |
| US8691532B2 (en) | 2007-02-28 | 2014-04-08 | Merck Sharp & Dohme Corp. | Nucleic acids encoding engineered anti-IL-23R antibodies |
| WO2008106131A2 (en) | 2007-02-28 | 2008-09-04 | Schering Corporation | Combination therapy for treatment of immune disorders |
| WO2014004436A2 (en) | 2012-06-27 | 2014-01-03 | Merck Sharp & Dohme Corp. | Crystalline anti-human il-23 antibodies |
| US9803010B2 (en) | 2012-06-27 | 2017-10-31 | Merck Sharp & Dohme Corp. | Crystalline anti-human IL-23p19 antibodies |
| WO2014093203A1 (en) | 2012-12-13 | 2014-06-19 | Merck Sharp & Dohme Corp. | SOLUTION FORMULATIONS OF ENGINEERED ANTI-IL-23p19 ANTIBODIES |
| US12509509B2 (en) | 2012-12-13 | 2025-12-30 | Merck Sharp & Dohme Llc | Solution formulations of engineered anti-IL-23p19 antibodies |
| US11633476B2 (en) | 2017-05-02 | 2023-04-25 | Merck Sharp & Dohme Llc | Stable formulations of programmed death receptor 1 (PD-1) antibodies and methods of use thereof |
| US11845798B2 (en) | 2017-05-02 | 2023-12-19 | Merck Sharp & Dohme Llc | Formulations of anti-LAG3 antibodies and co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US12565526B2 (en) | 2018-10-18 | 2026-03-03 | Merck Sharpe & Dohme LLC | Formulations of anti-RSV antibodies and methods of use thereof |
| US12576159B2 (en) | 2018-10-31 | 2026-03-17 | Merck Sharp & Dohme Llc | Anti-human PD-1 antibody crystals and methods of use thereof |
| US12319735B2 (en) | 2018-11-07 | 2025-06-03 | Merck Sharp & Dohme Llc | Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US11548941B2 (en) | 2018-11-20 | 2023-01-10 | Janssen Biotech, Inc. | Safe and effective method of treating psoriasis with anti-IL-23 specific antibody |
| US11780911B2 (en) | 2019-05-23 | 2023-10-10 | Janssen Biotech, Inc. | Method of treating inflammatory bowel disease with a combination therapy of antibodies to IL-23 and TNF alpha |
| US12258393B2 (en) | 2020-05-21 | 2025-03-25 | Janssen Biotech, Inc. | Method of treating inflammatory bowel disease with a combination therapy of antibodies to IL-23 and TNF alpha |
Also Published As
| Publication number | Publication date |
|---|---|
| EP1159299B1 (en) | 2009-01-14 |
| AU3873200A (en) | 2000-09-28 |
| ES2319958T3 (es) | 2009-05-18 |
| JP2003500010A (ja) | 2003-01-07 |
| DE60041393D1 (de) | 2009-03-05 |
| EP1942114A2 (en) | 2008-07-09 |
| EP1159299A1 (en) | 2001-12-05 |
| AR022890A1 (es) | 2002-09-04 |
| CA2366706A1 (en) | 2000-09-14 |
| ATE420894T1 (de) | 2009-01-15 |
| EP1942114A3 (en) | 2008-08-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6479634B1 (en) | IL-B30 proteins | |
| EP2100959B1 (en) | Mammalian cytokine: interleukin-B30 and related reagents | |
| EP1159299B1 (en) | Mammalian cytokines; related reagents and methods | |
| CA2343979C (en) | Human interleukin-b50, therapeutic uses | |
| US7390481B2 (en) | Mammalian cytokine complexes | |
| EP2138510B1 (en) | Methods of generating antibodies against cytokines | |
| MXPA01009178A (en) | Mammalian cytokines;related reagents and methods | |
| HK1131187A (en) | Mammalian cytokine: interleukin-b30 and related reagents | |
| HK1145336A (en) | Mammalian cytokine: interleukin-b30 and related reagents | |
| HK1024932B (en) | Mammalian cytokine: interleukin-b30 and related reagents | |
| HK1113173A (en) | Human interleukin-b50. therapeutic uses | |
| HK1133023A (en) | Methods of generating antibodies against cytokines |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CZ DE DK DM DZ EE ES FI GB GD GE HR HU ID IL IN IS JP KG KR KZ LC LK LR LT LU LV MA MD MG MK MN MX NO NZ PL PT RO RU SE SG SI SK SL TJ TM TR TT TZ UA UZ VN YU ZA |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2366706 Country of ref document: CA Ref country code: JP Ref document number: 2000 604066 Kind code of ref document: A Format of ref document f/p: F Ref country code: CA Ref document number: 2366706 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2001/009178 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2000917821 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2000917821 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |