WO2000042855A1 - Biological control of nematodes - Google Patents
Biological control of nematodes Download PDFInfo
- Publication number
- WO2000042855A1 WO2000042855A1 PCT/GB2000/000219 GB0000219W WO0042855A1 WO 2000042855 A1 WO2000042855 A1 WO 2000042855A1 GB 0000219 W GB0000219 W GB 0000219W WO 0042855 A1 WO0042855 A1 WO 0042855A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nucleic acid
- nematode
- nematodes
- plant
- sequence
- Prior art date
Links
- 241000244206 Nematoda Species 0.000 title claims abstract description 136
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 80
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 77
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 77
- 241000894006 Bacteria Species 0.000 claims abstract description 50
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 28
- 230000000967 entomopathogenic effect Effects 0.000 claims abstract description 15
- 241000196324 Embryophyta Species 0.000 claims description 63
- 238000000034 method Methods 0.000 claims description 55
- 108090000623 proteins and genes Proteins 0.000 claims description 54
- 239000003795 chemical substances by application Substances 0.000 claims description 44
- 239000013598 vector Substances 0.000 claims description 34
- 239000000203 mixture Substances 0.000 claims description 30
- 230000001580 bacterial effect Effects 0.000 claims description 25
- 241000607757 Xenorhabdus Species 0.000 claims description 21
- 241001465754 Metazoa Species 0.000 claims description 20
- 239000012634 fragment Substances 0.000 claims description 20
- 241000894007 species Species 0.000 claims description 18
- 239000002773 nucleotide Substances 0.000 claims description 13
- 125000003729 nucleotide group Chemical group 0.000 claims description 13
- 238000002360 preparation method Methods 0.000 claims description 13
- 239000000523 sample Substances 0.000 claims description 13
- 241000123579 Xenorhabdus bovienii Species 0.000 claims description 12
- 238000012217 deletion Methods 0.000 claims description 12
- 230000037430 deletion Effects 0.000 claims description 12
- 230000014509 gene expression Effects 0.000 claims description 12
- 229920001184 polypeptide Polymers 0.000 claims description 10
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 10
- 240000008042 Zea mays Species 0.000 claims description 8
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 8
- 238000010367 cloning Methods 0.000 claims description 8
- 238000009396 hybridization Methods 0.000 claims description 8
- 238000006467 substitution reaction Methods 0.000 claims description 7
- 244000068988 Glycine max Species 0.000 claims description 6
- 235000010469 Glycine max Nutrition 0.000 claims description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 6
- 241001148062 Photorhabdus Species 0.000 claims description 6
- 235000021307 Triticum Nutrition 0.000 claims description 5
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 5
- 230000000295 complement effect Effects 0.000 claims description 5
- 235000005822 corn Nutrition 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 230000003071 parasitic effect Effects 0.000 claims description 5
- 241000244202 Caenorhabditis Species 0.000 claims description 4
- 241001147667 Dictyocaulus Species 0.000 claims description 4
- 208000006968 Helminthiasis Diseases 0.000 claims description 4
- 240000005979 Hordeum vulgare Species 0.000 claims description 4
- 235000007340 Hordeum vulgare Nutrition 0.000 claims description 4
- 241001137882 Nematodirus Species 0.000 claims description 4
- 240000007594 Oryza sativa Species 0.000 claims description 4
- 235000007164 Oryza sativa Nutrition 0.000 claims description 4
- 244000046052 Phaseolus vulgaris Species 0.000 claims description 4
- 235000010627 Phaseolus vulgaris Nutrition 0.000 claims description 4
- 208000014837 parasitic helminthiasis infectious disease Diseases 0.000 claims description 4
- 235000009566 rice Nutrition 0.000 claims description 4
- 230000009261 transgenic effect Effects 0.000 claims description 4
- 244000291564 Allium cepa Species 0.000 claims description 3
- 235000002732 Allium cepa var. cepa Nutrition 0.000 claims description 3
- 241001147657 Ancylostoma Species 0.000 claims description 3
- 241000380490 Anguina Species 0.000 claims description 3
- 235000017060 Arachis glabrata Nutrition 0.000 claims description 3
- 244000105624 Arachis hypogaea Species 0.000 claims description 3
- 235000010777 Arachis hypogaea Nutrition 0.000 claims description 3
- 235000018262 Arachis monticola Nutrition 0.000 claims description 3
- 241000219310 Beta vulgaris subsp. vulgaris Species 0.000 claims description 3
- 241000931178 Bunostomum Species 0.000 claims description 3
- 241000399934 Ditylenchus Species 0.000 claims description 3
- 241001442498 Globodera Species 0.000 claims description 3
- 241000243976 Haemonchus Species 0.000 claims description 3
- 241001480224 Heterodera Species 0.000 claims description 3
- 235000007688 Lycopersicon esculentum Nutrition 0.000 claims description 3
- 240000008790 Musa x paradisiaca Species 0.000 claims description 3
- 235000018290 Musa x paradisiaca Nutrition 0.000 claims description 3
- 241000243795 Ostertagia Species 0.000 claims description 3
- 241000193943 Pratylenchus Species 0.000 claims description 3
- 241000201377 Radopholus Species 0.000 claims description 3
- 235000011034 Rubus glaucus Nutrition 0.000 claims description 3
- 235000009122 Rubus idaeus Nutrition 0.000 claims description 3
- 241000209056 Secale Species 0.000 claims description 3
- 235000007238 Secale cereale Nutrition 0.000 claims description 3
- 240000003768 Solanum lycopersicum Species 0.000 claims description 3
- 244000061456 Solanum tuberosum Species 0.000 claims description 3
- 235000002595 Solanum tuberosum Nutrition 0.000 claims description 3
- 241000122932 Strongylus Species 0.000 claims description 3
- 235000021536 Sugar beet Nutrition 0.000 claims description 3
- 241000244031 Toxocara Species 0.000 claims description 3
- 241001540447 Tylenchus Species 0.000 claims description 3
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 claims description 3
- 238000007792 addition Methods 0.000 claims description 3
- 239000000427 antigen Substances 0.000 claims description 3
- 108091007433 antigens Proteins 0.000 claims description 3
- 102000036639 antigens Human genes 0.000 claims description 3
- 238000003780 insertion Methods 0.000 claims description 3
- 230000037431 insertion Effects 0.000 claims description 3
- 235000009973 maize Nutrition 0.000 claims description 3
- 235000020232 peanut Nutrition 0.000 claims description 3
- 241000219198 Brassica Species 0.000 claims description 2
- 241000253350 Capillaria Species 0.000 claims description 2
- 229920000742 Cotton Polymers 0.000 claims description 2
- 241000219146 Gossypium Species 0.000 claims description 2
- 108020004711 Nucleic Acid Probes Proteins 0.000 claims description 2
- 230000005714 functional activity Effects 0.000 claims description 2
- 108020001507 fusion proteins Proteins 0.000 claims description 2
- 102000037865 fusion proteins Human genes 0.000 claims description 2
- 239000002853 nucleic acid probe Substances 0.000 claims description 2
- 230000001172 regenerating effect Effects 0.000 claims description 2
- 230000010076 replication Effects 0.000 claims description 2
- 244000235659 Rubus idaeus Species 0.000 claims 1
- 244000098338 Triticum aestivum Species 0.000 claims 1
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000003412 degenerative effect Effects 0.000 claims 1
- 244000000003 plant pathogen Species 0.000 claims 1
- 239000000463 material Substances 0.000 abstract description 17
- 241000341511 Nematodes Species 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 69
- 230000001069 nematicidal effect Effects 0.000 description 52
- 108020004414 DNA Proteins 0.000 description 37
- 108700012359 toxins Proteins 0.000 description 27
- 239000003053 toxin Substances 0.000 description 24
- 231100000765 toxin Toxicity 0.000 description 24
- 230000000694 effects Effects 0.000 description 21
- 239000005645 nematicide Substances 0.000 description 16
- 238000009472 formulation Methods 0.000 description 13
- 241000238631 Hexapoda Species 0.000 description 12
- 102000004169 proteins and genes Human genes 0.000 description 12
- 235000018102 proteins Nutrition 0.000 description 11
- 230000029087 digestion Effects 0.000 description 10
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 229960000723 ampicillin Drugs 0.000 description 8
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 239000013612 plasmid Substances 0.000 description 8
- 239000002689 soil Substances 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 7
- 239000006137 Luria-Bertani broth Substances 0.000 description 7
- 230000000813 microbial effect Effects 0.000 description 7
- 229920001817 Agar Polymers 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000008272 agar Substances 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 230000009466 transformation Effects 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 5
- 150000001413 amino acids Chemical group 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000001276 controlling effect Effects 0.000 description 5
- 235000021186 dishes Nutrition 0.000 description 5
- 230000007613 environmental effect Effects 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- 108020004465 16S ribosomal RNA Proteins 0.000 description 4
- 241000193830 Bacillus <bacterium> Species 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 241000209140 Triticum Species 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- IEDVJHCEMCRBQM-UHFFFAOYSA-N trimethoprim Chemical compound COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 IEDVJHCEMCRBQM-UHFFFAOYSA-N 0.000 description 4
- 229960001082 trimethoprim Drugs 0.000 description 4
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- 241000607479 Yersinia pestis Species 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 235000013601 eggs Nutrition 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 244000000013 helminth Species 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 229930027917 kanamycin Natural products 0.000 description 3
- 229960000318 kanamycin Drugs 0.000 description 3
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 3
- 229930182823 kanamycin A Natural products 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 235000012054 meals Nutrition 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 230000000361 pesticidal effect Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 2
- 241000244203 Caenorhabditis elegans Species 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 108020004998 Chloroplast DNA Proteins 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 241000701959 Escherichia virus Lambda Species 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 241001625930 Luria Species 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108020005196 Mitochondrial DNA Proteins 0.000 description 2
- 241000904715 Oxyuris Species 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 244000181025 Rosa gallica Species 0.000 description 2
- 240000007651 Rubus glaucus Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 241000282898 Sus scrofa Species 0.000 description 2
- 241001185310 Symbiotes <prokaryote> Species 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000003096 antiparasitic agent Substances 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000012876 carrier material Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 235000013339 cereals Nutrition 0.000 description 2
- 239000013043 chemical agent Substances 0.000 description 2
- 239000013601 cosmid vector Substances 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000000834 fixative Substances 0.000 description 2
- 230000037406 food intake Effects 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 230000007653 larval development Effects 0.000 description 2
- 230000001418 larval effect Effects 0.000 description 2
- 230000009571 larval growth Effects 0.000 description 2
- 239000012669 liquid formulation Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 238000000053 physical method Methods 0.000 description 2
- 239000000467 phytic acid Substances 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 244000144977 poultry Species 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000002708 random mutagenesis Methods 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 244000000000 soil microbiome Species 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 239000012137 tryptone Substances 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- 241000589220 Acetobacter Species 0.000 description 1
- 241000588986 Alcaligenes Species 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000186063 Arthrobacter Species 0.000 description 1
- 241000204727 Ascaridia Species 0.000 description 1
- 241000244186 Ascaris Species 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000223651 Aureobasidium Species 0.000 description 1
- 235000007319 Avena orientalis Nutrition 0.000 description 1
- 241000209763 Avena sativa Species 0.000 description 1
- 235000007558 Avena sp Nutrition 0.000 description 1
- 241000589151 Azotobacter Species 0.000 description 1
- 108700003918 Bacillus Thuringiensis insecticidal crystal Proteins 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 239000011547 Bouin solution Substances 0.000 description 1
- 241000701489 Cauliflower mosaic virus Species 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241001126268 Cooperia Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 206010011732 Cyst Diseases 0.000 description 1
- 241000238557 Decapoda Species 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 208000035126 Facies Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 241001148481 Helicotylenchus Species 0.000 description 1
- 241000920462 Heterakis Species 0.000 description 1
- 101000962469 Homo sapiens Transcription factor MafF Proteins 0.000 description 1
- 206010020649 Hyperkeratosis Diseases 0.000 description 1
- 240000007049 Juglans regia Species 0.000 description 1
- 235000009496 Juglans regia Nutrition 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 235000019738 Limestone Nutrition 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000510960 Oesophagostomum Species 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241000237502 Ostreidae Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000244187 Parascaris Species 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000589180 Rhizobium Species 0.000 description 1
- 241000190932 Rhodopseudomonas Species 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000222068 Sporobolomyces <Sporidiobolaceae> Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 101000805609 Tityus fasciolatus Venom metalloproteinase antarease-like TfasMP_A Proteins 0.000 description 1
- 101000805582 Tityus pachyurus Venom metalloproteinase antarease-like TpachMP_A Proteins 0.000 description 1
- 101000805584 Tityus pachyurus Venom metalloproteinase antarease-like TpachMP_B Proteins 0.000 description 1
- 101000805583 Tityus serrulatus Venom metalloproteinase antarease TserMP_A Proteins 0.000 description 1
- 101000805574 Tityus serrulatus Venom metalloproteinase antarease-like TserMP_B Proteins 0.000 description 1
- 101000805580 Tityus trivittatus Venom metalloproteinase antarease-like TtrivMP_A Proteins 0.000 description 1
- 102100039187 Transcription factor MafF Human genes 0.000 description 1
- 241001220308 Trichodorus Species 0.000 description 1
- 239000007984 Tris EDTA buffer Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000571986 Uncinaria Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 229920001938 Vegetable gum Polymers 0.000 description 1
- 241000589634 Xanthomonas Species 0.000 description 1
- JUGOREOARAHOCO-UHFFFAOYSA-M acetylcholine chloride Chemical compound [Cl-].CC(=O)OCC[N+](C)(C)C JUGOREOARAHOCO-UHFFFAOYSA-M 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 229940024606 amino acid Drugs 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 230000000507 anthelmentic effect Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 239000002518 antifoaming agent Substances 0.000 description 1
- 229940125687 antiparasitic agent Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- OCBHHZMJRVXXQK-UHFFFAOYSA-M benzyl-dimethyl-tetradecylazanium;chloride Chemical compound [Cl-].CCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 OCBHHZMJRVXXQK-UHFFFAOYSA-M 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000000853 biopesticidal effect Effects 0.000 description 1
- 235000012745 brilliant blue FCF Nutrition 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 208000031513 cyst Diseases 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000030609 dephosphorylation Effects 0.000 description 1
- 238000006209 dephosphorylation reaction Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000010410 dusting Methods 0.000 description 1
- 239000004495 emulsifiable concentrate Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000035611 feeding Effects 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 208000035474 group of disease Diseases 0.000 description 1
- 230000002140 halogenating effect Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000000749 insecticidal effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000012500 ion exchange media Substances 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 239000006028 limestone Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 231100001225 mammalian toxicity Toxicity 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 235000013379 molasses Nutrition 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- CLVOYFRAZKMSPF-UHFFFAOYSA-N n,n-dibutyl-4-chlorobenzenesulfonamide Chemical compound CCCCN(CCCC)S(=O)(=O)C1=CC=C(Cl)C=C1 CLVOYFRAZKMSPF-UHFFFAOYSA-N 0.000 description 1
- 230000005257 nucleotidylation Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 235000020636 oyster Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000003415 peat Substances 0.000 description 1
- 239000000575 pesticide Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 229910052615 phyllosilicate Inorganic materials 0.000 description 1
- 230000019612 pigmentation Effects 0.000 description 1
- 238000004161 plant tissue culture Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 235000012015 potatoes Nutrition 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007892 solid unit dosage form Substances 0.000 description 1
- RNVYQYLELCKWAN-UHFFFAOYSA-N solketal Chemical compound CC1(C)OCC(CO)O1 RNVYQYLELCKWAN-UHFFFAOYSA-N 0.000 description 1
- 239000002195 soluble material Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000017105 transposition Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- -1 variants of C42 Chemical class 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000010455 vermiculite Substances 0.000 description 1
- 229910052902 vermiculite Inorganic materials 0.000 description 1
- 235000019354 vermiculite Nutrition 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 235000020234 walnut Nutrition 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/20—Bacteria; Substances produced thereby or obtained therefrom
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/50—Isolated enzymes; Isolated proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8285—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for nematode resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Definitions
- the present invention relates to methods and materials for controlling nematodes.
- Methods of controlling nematodes and their associated diseases include cultural practices; biological methods, e.g. use of resistant varieties; physical methods, e.g. heat; and use of chemical agents.
- Patent application WO 92/ 19739 (Mycogen) relates to genes and gene fragments from Bacillus thunngiensis which have nematocidal activity. These generally encode crystal toxins from particular strains.
- Patent application EP 0 303 426 also relates to strains of B. thunngiensis which have nematocidal activity.
- Patent application EP 0 171 381 (Monsanto) relates to particular soil bacteria which are capable of proliferating in an environment which is infested with nematodes such as pseudomonads which colonise the surface of plant roots.
- glycosidase enzymes which are hypothesised to directly inhibit the nematodes.
- Patent application PCT/WO 99/22598 (University of Reading) published 14 May 1999 claims a biopesticide for the control of insect pests or plant parasitic nematodes or both, which comprises as an effective agent a species of bacteria which is a symbiont of an entomopathogenic nematode.
- the present inventors have established that species of bacteria which in nature are associated symbiotically with entomopathogenic nematodes, can in fact be utilised to control nematodes, and in preferred forms of the invention, to kill them.
- the bacteria themselves can be employed, or nematode control agents can be used which are derived from such bacteria.
- the present invention employs bacteria which are engineered and thus not naturally occurring, or nematode control agents which are derived from natural or non-natural bacteria.
- nematode symbiotes might possess nematocidal activity.
- the bacteria in order to protect a nutrient supply from a dead insect, the bacteria might produce anti-nematocides to prevent saprophytic nematodes gaining access.
- the bacterial strains may have once been pathogens of these nematodes and evolved towards a less hostile symbiotic relationship.
- the nematocidal activity may be an evolutionary throwback from the original pathogenic relationship, in which case it may be expected to be widely present amongst bacteria which have evolved in this way.
- a first aspect of the present invention is the use of bacterial strains to control a target nematode, characterised in that in nature the bacterial strain is associated symbiotically with an entomopathogenic nematode.
- the bacterial strains may be used in the methods of the present invention per se, or they may be used as a source of nematode control agent.
- the nematode control agent can be derived directly, or be prepared and utilised through recombinant DNA techniques, optionally via a host cell.
- the target nematode will generally be different to the nematode with which the bacterial strain is found symbiotically in nature.
- bacteria or a nematode control agent it becomes possible to control nematodes, in the sense of, to prevent or retard the effect that the nematode has on other organisms such as animals or more preferably plants, or to reduce the number of nematodes or nematode eggs in an area of interest, or to alleviate or cure a disease caused by nematodes.
- Control may be at the level of larval nematodes or nematode eggs, or may inhibit the motion, feeding or infectivity of adult nematodes.
- Nematocidal control may be employed to kill the nematode target. Such controlling activity can be assessed as shown in the Examples below.
- the present invention provides a composition for the control of parasitic nematodes which comprises as an effective agent a species of bacteria which is a symbiont of an entomopathogenic nematode, or engineered bacteria having such activity, or a nematode control agent derived from natural or engineered bacteria.
- the present invention also provides a method of nematode control employing such a composition.
- the bacterial species is typically of the genera Xenorhabdus or Photorhabdus, preferably the genus Xenorhabdus, for instance the species Xenorhabdus bovienii.
- particularly preferred bacteria include:
- the nematode control agent can be a peptide derived from a symbiont of an entomopathogenic nematode or an engineered bacterium has functional activity against a nematode.
- the peptide nematode control agent can be produced from a nucleic acid derived from a symbiont of an entomopath nematode or an engineered bacterium and which encodes such a peptide.
- the peptide can be an oligopeptide or a polypeptide, notably a protein.
- the nematode control agent is a toxin with toxic activity against nematodes, but the nematode control agent can have other activity.
- nucleic acids of this invention can be employed in a method of producing a peptide comprising the step of causing or allowing the expression from a nucleic acid of this invention in a suitable host cell.
- the nucleic acid can comprise a natural nucleotide sequence or a degeneratively equivalent sequence, and functional variants thereof.
- Variants include homologous variants encoding a peptide which is a nematode control agent, the nucleic acid having 70% or more DNA sequence identity and/ or the peptide having 70% or more amino acid sequence identity.
- the present invention extends to nucleic acids having a sequence which is a derivative by way of addition, insertion, deletion or substitution of one or more nucleotides.
- the nucleic acid can contain longer expressed sequences such that the nematode control agent is expressed as a fusion protein.
- Nucleic acids complementary to the nucleic acid encoding a nematode control agent are also part of this invention.
- Nucleic acids for use as a probe or primer having a nucleotide sequence of at least 15, 18, 21 , 24 or 30 nucleotides, which sequence is present in, or complementary to, the nucleic acid encoding nematode control agent are further provided by this invention.
- the invention extends to a method for identifying or cloning a nucleic acid for nematode control agent which method employs such a nucleic acid probe.
- a method provided by this invention comprises the steps of:
- the hybridisation conditions can be selected to allow the identification of sequences having 70% or more sequence identity with the probe.
- the method comprises use of two primers to amplify a nucleic acid encoding a nematode control agent, at least one of the primers having a conserved nucleotide sequence of at least 15 nucleotides.
- a method is further made possible by this invention comprising the steps of:
- the invention provides a recombinant vector comprising a nucleic acid of this invention.
- the vector is preferably capable of replicating in a suitable host such as E. coli or in Xenorhabdus.
- the vector can be a baculovirus.
- the nucleic acid is operably linked to a promoter or other regulatory element for transcription in a host cell.
- Vectors can further comprise any one or more of the following: a terminator sequence; a polyadenylation sequence; an enhancer sequence; a marker gene; a sequence encoding pesticidal material derived from Bacillus thunngiensis.
- the vector can be a plant vector.
- the vector of this invention can be introduced into a cell.
- a method for transforming a plant cell comprises the step of causing or allowing recombination between the vector and the plant cell genome to introduce the nucleic acid into the genome.
- the nucleic acid can be incorporated into chloroplast DNA, or into mitochondrial DNA.
- Host cells comprising a vector are also part of this invention.
- the host cell can be a plant cell, which may be in a plant.
- a method for producing a transgenic plant comprises the step of regenerating a plant from the transformed cell.
- plants of this invention extend to the progeny of such plants.
- plants of this invention include crop species which can be protected, notably maize, cotton, soya, rice, Brassica species, tomato, potato, sugar beet, barley, soybean, peanut, onion, rye, wheat, corn, banana, raspberry, bean.
- Decorative and other plants are also possible, e.g. rose.
- a part of the propagule of the plants is also envisaged by this invention.
- a method of influencing or affecting the toxicity of a cell such as a plant cell includes causing or allowing expression of a heterologous nucleic acid of this invention within the cells.
- the invention involves the use of a material selected from: an X. bovienii strain, a nematode control agent; a nucleic acid; a host cell; a plant; a peptide; or a composition of the invention, for the control of a pest, especially where the pest is a nematode and the material is used to control the nematode.
- the present invention extends to control of helminthiasis in humans and other animals including domesticated animals such as swine, sheep, horses, cattle, goats, dogs, cats and poultry.
- the nematodes to be controlled include Haemonchus, T ⁇ chostrongylus, Ostertagia, Nematodirus, Cooperia, Asca ⁇ s, Bunostomum, Oesophagosromuni, Chaber ⁇ a, Trichu ⁇ s, Strongylus, T ⁇ chonema, Dictyocaulus, Capillaria, Heterkis, Toxocara, Asca ⁇ dia, Oxyuris, Ancylostoma, Uncina ⁇ a, Toxasca ⁇ s, Caenorhabditis and Parascaris.
- Target nematodes may be selected from the genera Aphelenochoides, Anguina, Bursaphalenchus, C ⁇ conemella, Melodigyne, Ditylenchus, Globodera, Heliocotylenchus, Heterodera, Pratylenchus, Radopholus, Rotelynchus, Tylenchus, Trichodorus, Xiphenema, and Caenorhabditis.
- compositions of this invention can be used in conjunction with Bacillus thunngiensis or pesticidal materials derived therefrom.
- an antibody or fragment thereof, or a polypeptide comprising the antigen-binding domain of the antibody, capable of specifically binding a peptide of this invention in a further aspect, there is provided an antibody or fragment thereof, or a polypeptide comprising the antigen-binding domain of the antibody, capable of specifically binding a peptide of this invention.
- Such an antibody or fragment can be obtained by immunising a mammal with the peptide, and is useful in a method of identifying and/ or isolating a nematode control agent comprising the step of screening candidate polypeptide s with a polypeptide comprising the antigen-binding domain of the antibody of claim.
- entomopathogenic nematodes can be isolated using an insect baiting technique such as that described by Bedding & Akhurst (1975) Nematologia 21 : 215-227.
- Bacteria from nematodes identified as being pathogenic to the insect are isolated, cultured, and used as a source of nematocidal agent, e.g. by analogy with the methods used in the Examples below.
- Xenorhabdus or Photorhabdus species are used.
- the preferred bacterial strains include ones which have the characteristics of strain C42, 173 or H31 isolated by the present inventors.
- This Xenorhabdus strain has the following characteristics: rod shaped; motile; non-bio luminescent; blue on NBTA; produces antibiotics; resistant to ampicillin; forms circular colonies; has convex morphology; white colour.
- This strain was presumptively identified as belonging to the genera Xenorhabdus since it was isolated from an insect killed by an entomopathogenic nematode and had the above characteristics.
- the strain has been deposited at the NCIMB (23 St Machar Drive, Aberdeen, AB24 3RY, Scotland) by the applicants under accession number NCIMB 41004 on 20 January 1999.
- strains of the present invention are two strains of X. bovienii designated H31 and 173 which have also been deposited under the terms of the Budapest Treaty at the NCIMB under the accession numbers NCIMB 40985 and 40986 respectively. These share characteristics of C42 in that they are rod- shaped; motile; non-bioluminescent; blue on NBTA; produce antibiotics; resistant to ampicillin; form circular colonies; and have convex morphology.
- the strains were identified as belonging to the species X. bovienii when compared to the X. bovienii type strain T228 using Restriction Analysis of the complete 16S rRNA gene and partial sequence analysis.
- helminthiasis The group of diseases described generally as helminthiasis is due to infection of an human or other animal host with parasitic worms known as helminths. Helminthiasis is a prevalent and serious economic problem in domesticated animals such as swine, sheep, horses, cattle, goats, dogs, cats and poultry. Among the helminths, the group of worms described as nematodes causes widespread and often at times serious infection in various species of animals. The most common genera of nematodes infecting the animals referred to above are Haemonchus, Tnchostrongylus, Ostertagia, Nematodirus,
- Parasca ⁇ s Certain of these, such as Nematodirus, Coope ⁇ a, and
- Oesophagostomum attack primarily the intestinal tract, while others, such as Dictyocaulus are found in the lungs. Still other parasites may be located in other tissues and organs of the body.
- the bacteria and encoded toxins of the invention may be used as nematocides for the control of the nematodes and diseases discussed above. More preferably, however, they are used to control soil and plant parasitic nematodes.
- Particular crop species which can be protected include tomatoes, potatoes, sugar beet, barley, soybean, peanut, onion, rye, wheat, corn, banana, raspberry, beans.
- Decorative and other plants may also be treated e.g. rose.
- Target nematodes may be selected from the genera Aphelenochoides, Anguina, Bursaphalenchus, C ⁇ conemella, Melodoigyne, Ditylenchus, Globodera, Helicotylenchus, Heterodera, Pratylenchus, Radopholus, Rotelynchus, Tylenchus, T ⁇ chodorus, Xiphenema.
- a further organism used in certain of the Examples below is Caenorhabditis elegans. Other target organisms and plants are discussed by Agrios in "Plant Pathology - 3rd Ed” Pub Academic Press Inc, see Chapter 15 therein.
- the target nematode will generally be different to that with which the bacterial strain is found in nature.
- the bacteria may be used in any appropriate method which brings them into contact with the target nematode, preferably such that they, or their products, are ingested or absorbed by the target nematode.
- the bacteria may be formulated in a variety of ways so as to enhance stability. For instance they may be employed in admixture with substrates to protect the cells.
- the mixture can be spread over, ploughed into or otherwise mixed with nematode infected or potentially infected soil.
- bacteria intended for enteric inoculation can be mixed with carrier material that is suitable for ingestion by the intended animals.
- Nematode control agents of the present invention which may be proteinaceous, or nucleic acids encoding them, may be isolated and/ or purified from the C42, 173 or H31 bacteria described above, in substantially pure or homogeneous form, or free or substantially free of other materials from the bacterial strain of origin. Where used herein, the term “isolated” encompasses all of these possibilities.
- Nematocidal activity may be assessed using a spread assay as discussed below.
- the C42, 173 or H31 agent may be wholly or partially synthetic. In particular they may be recombinantly produced from nucleic acid sequences which are not found together in nature (do not run contiguously) but which have been ligated or otherwise combined artificially.
- nucleic acid encoding toxin(s) from 173 has been expressed in hosts cells using a vector system.
- Amino acid sequences of 38 different putative 173 toxin(s) are set out in sequence Annex I. These sequences are based on the nucleic acid sequence set out in Fig 2 ('chrim5'), a cosmid clone derived from 173 genomic DNA which conferred nematocidal activity upon E. coli cells into which it was introduced (i.e. significantly reduced nematode larval growth and development, and feeding) . As detailed below, the entire amino acid sequence as set out in each case may not be required for nematocidal activity.
- nematocidal agents comprising a polypeptide containing all, or a nematocidal fragment, of any of the depicted 173 sequences, form one aspect of the present invention.
- Preferred agents include those encoded by pl4-2f and pi 3- If. Other active variants of these sequences are also encompassed as described below.
- Candidate agents for use in this invention to control nematodes extend to those from the bacteria described in PCT/WO 99/22598, as well as the insecticidal toxins and bacteria of PCT/WO 99/42589, PCT/WO 98/08388 and PCT/WO 97/ 17432, the disclosures of which are incorporated by reference.
- nucleic acid molecule encoding a nematode control agent of the present invention, for example a toxin, as described above.
- the nucleic acid may be derived from the sequence shown in Fig 2 or the complement (or degenerate equivalent) thereof.
- This sequence (cHRIM5) was itself derived from 173 and identified by its unexpected nematocidal activity. Regions of this sequence believed to correspond to genes of the present invention are described in Fig 3. Isolated nucleic acids comprising one or more of these regions which encode a nematocidal activity are particularly preferred.
- nucleic acids of the present invention may be isolated using PCR or southern blotting or other techniques well known to those skilled in the art. This requires the use of two primers to specifically amplify target nucleic acid, so preferably two nucleic acid molecules with sequences characteristic of the C42, H31 or most preferably an 173 toxin isolated as above are employed. Using RACE
- a method involving use of PCR in obtaining nucleic acid according to the present invention may include:
- nucleic acids which are variants of the C42, 173 or H31 toxin.
- a variant nucleic acid molecule shares homology (or identity) with all or part of the C42, H31 , or most preferably 173 sequence discussed above.
- sequence comparisons are made using FASTA and FASTP (see
- Gapopen (penalty for the first residue in a gap): - 12 for proteins / - 16 for
- Gapext (penalty for additional residues in a gap): -2 for proteins / -4 for DNA
- KTUP word length 2 for proteins / 6 for DNA.
- Homology may be at the nucleotide sequence and/ or encoded amino acid sequence level.
- the nucleic acid and/ or amino acid sequence shares at least about 70%, 75%, 80%, or 85% homology, most preferably at least about 90%, 95%, 96%, 97%, 98% or 99% homology.
- Another method for assessing homology at the nucleic acid level is by hybridization screening.
- One common formula for calculating the stringency conditions required to achieve hybridisation between nucleic acid molecules of a specified sequence homology is shown in Molecular Cloning: a Laboratory Manual: 2nd edition, Sambrook et al, 1989, Cold Spring Harbor Laboratory Press:
- Tm 81.5°C + 16.6Log [Na+] + 0.41 (% G+C) - 0.63 (% formamide) - 600/ #bp in duplex
- Variants of the present invention can be artificial nucleic acids. Alternatively they may be novel, naturally occurring, nucleic acids, isolatable using the information disclosed herein. Thus a variant may be a distinctive part or fragment (however produced) corresponding to a portion of the C42, 173 or H31 toxin. The fragments may encode particular functional parts of the agent or they may be used for probing for, or amplifying, sequences corresponding to C42, 173 or H31 toxin. Sequence variants which occur naturally may include homologs of the C42, 173 or H31 toxin from other bacteria, including nematode- symbionts.
- Artificial variants may be prepared by those skilled in the art, for instance by site directed or random mutagenesis (i.e. nucleotide addition, deletion or substitution, optionally to lead to amino acid addition, deletion or substitution) or by direct synthesis.
- the variant nucleic acid is generated either directly or indirectly from an original nucleic acid encoding the C42, 173 or
- Changes may be desirable for a number of reasons, including introducing or removing the following features. Sites which are required for pre- or post- translation modification. Changes for codon usage preferences to enhance gene expression in different organisms. Leader or other targeting sequences (e.g. membrane or golgi locating sequences) may be added to the expressed protein to determine its location following expression. All of these may assist in efficiently cloning and expressing an active polypeptide in recombinant form. Other desirable mutation may be random or site directed mutagenesis in order to alter the activity (e.g. host specificity) or stability of the encoded polypeptide. Changes may be by way of conservative variation, i.e.
- substitution of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine.
- substitution of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine.
- active (nematocidal) variants having non-conservative substitutions.
- variant nucleic acids encompass all of these possibilities.
- variant nucleic acid i.e. variants of C42, 173 or H31 toxin e.g. variants of the 173 toxin sequences disclosed hereinafter.
- the nucleic acid encoding the nematode control agent is provided in the form of a recombinant and preferably replicable vector.
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- appropriate regulatory sequences including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- the permitted vectors include, inter alia, any plasmid, cosmid, phage or Agrobacte ⁇ um binary vector in double or single stranded linear or circular form which may or may not be self transmissible or mobilizable, and which can transform a prokaryotic or eukaryotic host either by integration into the cellular genome or exist extrachromosomally, e.g. an autonomous replicating plasmid with an origin of replication.
- Illustratively integration can occur into chloroplast DNA or into mitochondrial DNA.
- the nucleic acid in the vector is under the control of, and operably linked to, an appropriate optionally inducible promoter or other regulatory elements for transcription in a host cell such as a microbial, e.g. bacterial, yeast, filamentous fungal or plant cell.
- a host cell such as a microbial, e.g. bacterial, yeast, filamentous fungal or plant cell.
- the vector may be a bi-functional expression vector which functions in multiple hosts. In the case of genomic DNA, this may contain its own promoter or other regulatory elements and in the case of cDNA this may be under the control of an appropriate promoter or other regulatory elements for expression in the host cell.
- the vectors and host cells into which they are introduced may be used to clone or otherwise identify nucleic acids according to the invention.
- the agent may be used as part of a viral vector which is itself pathogenic to nematodes.
- nucleic acid constructs which operate as plant vectors. Specific procedures and vectors previously used with wide success upon plants are described by Guerineau and Mullineaux (1993) (Plant transformation and expression vectors. In: Plant Molecular Biology Labfax (Croy RRD ed) Oxford, BIOS Scientific Publishers, pp 121- 148). Suitable vectors may include plant viral-derived vectors (see e.g. EP- A- 194809). Suitable promoters which operate in plants include the Cauliflower Mosaic Virus 35S (CaMV 35S). Other examples are disclosed at page 120 of Lindsey & Jones (1989) "Plant Biotechnology in Agriculture” Pub. OU Press, Milton Keynes, UK.
- the toxin genes or gene fragments encoding the nematocidal agents of the subject invention may be introduced into a host cell, microbial, animal or plant. Expression of the toxin gene in the host cell results, directly or indirectly, in the intracellular production and maintenance of the nematocide.
- the present invention also provides methods comprising introduction of such a construct into a plant cell or a microbial cell and /or induction of expression of a construct within a cell, by application of a suitable stimulus e.g. an effective exogenous inducer.
- a suitable stimulus e.g. an effective exogenous inducer.
- Hosts may be used to assay the activity of particular sequences or fragments. Hosts can also be used to generate quantities of toxin which can be employed in situ in suitable treated cells, or alternatively with suitable hosts, e.g., Pseudomonas viable microbes can be applied to the sites of nematodes where they will proliferate and where they or their products can be ingested by the nematodes. Higher organisms, preferably plants, can also be engineered with the toxin. The result in each case is a control of the nematodes. A host may be selected that can tolerate harsh environmental conditions and then grow when they improve, as illustrated by Bacillus species where the spores can exist under environmental extremes.
- Characteristics of interest for use as a nematocide microcapsule i.e. a vehicle for the active agent include protective qualities for the nematocide, such as thick cell walls, pigmentation, and intracellular packaging or formation of inclusion bodies; leaf affinity; lack of mammalian toxicity; attractiveness to nematodes for ingestion; ease of killing and fixing without damage to the toxin; and the like.
- the cell will usually be intact and be substantially proliferative form when treated, rather than in a spore form, although in some instances spores may be employed.
- Treatment of the microbial cell e.g. a microbe containing the bacterial toxin gene or gene fragment, can be by chemical or physical means, or by a combination of chemical and /or physical means, so long as the technique does not deleteriously affect the properties of the toxin, nor diminish the cellular capability in protecting the toxin.
- microorganism hosts are selected which are known to occupy the phytosphere (phylloplane, phyllosphere, rhizosphere, and/ or rhizoplane) of one or more crops of interest. These microorganisms are selected so as to be capable of successfully competing in the particular environment (crop and other insect habitats) with the wild-type microorganisms, provide for stable maintenance and expression of the gene expressing the polypeptide pesticide, and, desirably, provide for improved protection of the nematocide from environmental degradation and inactivation.
- microorganisms are known to inhabit the phylloplane (the surface of the plant leaves) and/ or the rhizosphere (the soil surrounding plant roots) of a wide variety of important crops. These microorganisms include bacteria, algae, and fungi.
- microorganisms such as bacteria, e.g., genera Pseudomonas, Erwinia, Serratia, Klebsiella, Xanthomonas, Streptomyces, Rhizobium, Rhodopseudomonas, Methylophilius, Agrobacte ⁇ um , Acetobacter, Lactobacillus, Arthrobacter, Azotobacter, Leuconosroc, and Alcaligenes; fungi, particularly yeast, e.g., genera Saccharomyces, Cryprococcus, Kluyveromyces, Sporobolomyces, Rhodororula, and Aureobasidium.
- bacteria e.g., genera Pseudomonas, Erwinia, Serratia, Klebsiella, Xanthomonas, Streptomyces, Rhizobium, Rhodopseudomonas, Methylophilius, Agrobacte ⁇ um , Ace
- Nucleic acid encoding the nematocides of the present invention can be introduced into plant cells using any suitable technology, such as a disarmed Ti-plasmid vector carried by Agrobacte ⁇ um exploiting its natural gene transfer ability (EP-A-270355, EP-A-0116718, NAR 12(22) 8711 - 87215 1984), particle or microprojectile bombardment (US 5100792, EP-A-444882, EP-A-434616) microinjection (WO 92/09696, WO 94/00583, EP 331083, EP
- Agrobacte ⁇ um transformation is widely used by those skilled in the art to transform dicotyledonous species. It has also been used with filamentous fungi (see de Groot et al, 1998, Nature Biotechnology 16: 839-842).
- a plant may be regenerated, e.g. from single cells, callus tissue or leaf discs, as is standard in the art. Almost any plant can be entirely regenerated from cells, tissues and organs of the plant. Available techniques are reviewed in Vasil et al., Cell Culture and Somatic Cell Genetics of Plants, Vol I, II and III, Laboratory Procedures and Their Applications, Academic Press, 1984, and Weissbach and Weissbach, Methods for Plant Molecular Biology, Academic Press, 1989.
- bacteria associated with entomopathogenic nematodes or the toxins or products discussed above are used in conjunction with other nematocidal bacteria such as B. thunngiensis strains (e.g. from WO 92/ 19739) or pesticidal materials derived therefrom.
- the present invention also embraces materials for use in the methods above. These materials include the novel bacterial strains which are associated symbiotically with an entomopathogenic nematode and which are capable of controlling a target nematode.
- the invention encompasses strain C42, 173 or H31 in isolated or substantially isolated form, or strains having the characteristics of C42, 173 or H31 (including nematocidal activity assessed as below) .
- compositions and formulations of these bacteria may comprise or consist of wettable powders, granules or dusts, mixed with various inert materials, such as inorganic minerals (phyllosilicates, carbonates, sulfates, phosphates, methylcellulose, xanthan gum and the like) or botanical materials (powdered corncobs, rice hulls, walnut shells, peat moss, vermiculite, soil, seeds, other plant tissue and the like).
- the formulations may include spreader- sticker adjutants, stabilizing agents or surfactants.
- Liquid formulations may be aqueous-based or non-aqueous and employed as foams, gels, suspensions, emulsifiable concentrates, or the like.
- the ingredients may include rheological agents, surfactants, emulsifiers, dispersants, or polymers.
- Bacteria may be mixed with other material while in freeze-dried form, encapsulated in biodegradable or water-soluble material, or otherwise treated to prolong their viability or decrease their levels of metabolic activity during handling.
- the carrier material may contain assimilatable nutrient sources to support proliferation of the bacteria.
- nematocidal agents isolated or isolatable from the strains or host cells discussed above.
- compositions comprising one or more agents as described above.
- Such compositions preferably further comprise other nematocidal materials from other Xenorhabdus species or non- Xenorhabdus species. These other materials may be chosen such as to have complementary properties to the agents described above, or act synergistically with it.
- Toxins of the invention for use with animals can be adapted to be administered orally in a unit dosage form such as a capsule, bolus or tablet, or as a liquid drench when used as an anthelmintic in mammals, and in the soil to control plant nematodes.
- the drench is normally a solution, suspension or dispersion of the active ingredient, usually in water, together with a suspending agent such as bentonite and a wetting agent or like excipient.
- the drenches also contain an antifoaming agent.
- Drench formulations generally contain from about 0.001 to 0.5% by weight of the active compound. Preferred drench formulations may contain from
- the capsules and boluses comprise the active ingredient admixed with a carrier vehicle such as starch, talc, magnesium stearate, or dicalcium phosphate.
- a carrier vehicle such as starch, talc, magnesium stearate, or dicalcium phosphate.
- capsules, boluses or tablets containing the desired amount of active compound usually are employed.
- These dosage forms are prepared by intimately and uniformly mixing the active ingredient with suitable finely divided diluents, fillers, disintegrating agents and/ or binders such as starch, lactose, talc, magnesium stearate, vegetable gums and the like.
- Such unit dosage formulations may be varied widely with respect to their total weight and content of the antiparasitic agent, depending upon the factors such as the type of host animal to be treated, the severity and type of infection and the weight of the host.
- the active compound When the active compound is to be administered via an animal feedstuff, it is intimately dispersed in the feed or used as a top dressing or in the form of pellets which may then be added to the finished feed or, optionally, fed separately.
- a carrier for feed administration is one that is, or may be, an ingredient of the animal ration.
- Suitable compositions include feed premixes or supplements in which the active ingredient is present in relatively large amounts and which are suitable for direct feeding to the animal or for addition to the feed either directly or after an intermediate dilution or blending step.
- Typical carriers or diluents suitable for such compositions include, for example, distillers' dried grains, corn meal, citrus meal, fermentation residues, ground oyster shells, wheat shorts, molasses solubles, corn cob meal, edible bean mill feed, soya grits, crushed limestone and the like.
- the antiparasitic compounds may be administered to animals parenterally, for example, by intraluminal, intramuscular, intratracheal, or subcutaneous injection, in which event the active ingredient is dissolved or dispersed in a liquid carrier vehicle.
- the active material is suitably admixed with an acceptable vehicle, preferably of the vegetable oil variety, such as peanut oil, cotton seed oil and the like.
- parenteral vehicles such as organic preparations using solketal, glycerol, formal and aqueous parenteral formulations, are also used.
- the active compound or compounds are dissolved or suspended in the parenteral formulation for administration; such formulations generally contain from 0.005 to 5% by weight of the active compound.
- nucleic acids include nucleic acids, vectors and host cells containing a heterologous construct according to the present invention, especially a plant or a microbial cell.
- Such microbial cells may be treated as described in the methods above.
- chemical reagents are halogenating agents.
- Other suitable techniques include treatment with aldehydes, such as formaldehyde and glutaraldehyde; anti- invectives, such as zephiran chloride and cetylpyridinium chloride; alcohols, such as isopropyl and ethanol; various histologic fixatives, such as Bouin's fixative and Helly's fixative (See: Humason, Gretchen L., Animal Tissue Techniques, W.H. Freeman and Company, 1967); or a combination of physical (heat) and chemical agents that preserve and prolong the activity of the toxin produced in the cell when the cell is administered to the host animal.
- aldehydes such as formaldehyde and glutaraldehyde
- anti- invectives such as zephiran chloride and cetylpyridinium chloride
- alcohols such as isopropyl and ethanol
- the method of inactivation or killing retains at least a substantial portion of the bio-availability or bioactivity of the nematode control agent.
- the nematocide concentration may vary widely depending upon the nature of the particular formulation, particularly whether it is a concentrate or to be used directly.
- the nematocide will be present in at least 1% by weight and may be 100% by weight.
- the dry formulations will have from about 1-95% by weight of the nematocide while the liquid formulations will generally be from about 16% by weight of the solids in the liquid phase.
- the formulations will generally have from about 10 2 to about 10 10 cells /mg, more preferably 10 7 to about 10 9 cells/ mg.
- formulations will be administered at about 50 mg (liquid or dry) to 1 kg or more per hectare.
- the formulations can be applied to the environment of the nematodes, e.g., plants, soil or water, by spraying, dusting, sprinkling, or the like.
- the invention includes plant cells which have been transformed with the genes of the present invention, and plants which include such plant cells.
- Fig 1 shows the cHRIM5 cosmid vector and subclones used for sequencing, as described in Example 6.
- Fig 2 shows the sequence of cHRIM5 (1-37544 bps).
- Fig 3 shows the position and orientation of ORFs in the cHRIM5 sequence.
- Fig 4 shows deletions of cHRIM5 tested for nematocidal activity.
- Fig 5 illustrates cloning of nematocidal activity in PLEX.
- Example 1 Source of strains C42, 173 and H31
- Strain C42 was obtained using an insect entrapment method. Insects which were killed on the surface of a soil sample were observed under a microscope at high magnification. Any that contained high numbers of bacteria and not fungal hyphae were presumed to have been killed by insect parasitic nematodes. The identified presence of nematodes also aids this identification step, but it is not essential. These samples were plated on to NBTA media (see Poinar & Thomas, 1984 Nematodes p238-280 in "Laboratory guide to insect pathogens and parasites" Eds. Poiner & Thomas, Pub. Plenum Press, New York). Any colonies that developed that had characteristic features (e.g.
- Non-luminescent colonies were presumptively identified as Xenorhabdus.
- the identity of those having nematocidal activity as assessed in Example 3, is further confirmed using 16s rRNA sequence data (see Brunei et al 1997, Applied and Environmental Microbiology 63,2: 574-580).
- Subcultures of the Xenorhabdus species C42, 173 and H31 were used to inoculate three 9 cm diameter petri dishes containing L agar (10g tryptone, 5 g Yeast Extract, 5 g NaCl and 15 g agar per It). Plates were incubated for 48 hrs at 26°C and the resulting growth harvested by scraping off bacterial cells and thoroughly resuspending in 40 mis of 5% w/v lactose.
- the cells were washed once by centrifugation (5000 x g for 10 mins), resuspended in 10 mis of 5% w/v lactose, dispensed into 1 ml aliquots and freeze dried (-60°C for 48 hrs ) for medium term storage at 2°C.
- Other stocks were re- suspended in nutrient broth containing 10% w/v glycerol (Protect) and frozen at -70°C.
- the bioassays were performed by allowing C. elegans to feed on live bacterial cell suspensions spread over the surface of Luria broth agar (Luria broth containing 1.2%w/v agar) in segmented square petri dishes (2.0 x 2.0 cm per test well). A minimum of three test wells, each containing 50- 100 nematodes were used for each test. Mortalities were recorded after 3 days at 18°C.
- C. elegans was cultured on Esche ⁇ chia coli at 18°C on 9 cm diameter LB agar plates. Once the nematodes had colonised the complete plate they were re- subbed on a fresh plate to maintain stocks and the remainder re-suspended in 40 ml LB. The tube was allowed to stand for 15 min and the nematodes settled to the bottom. The concentrated nematodes were removed using a sterile pipette and placed in 40 mis of fresh LB. The process was repeated 5 more times to wash the nematodes away from the E. coli cells. The nematodes were then diluted so that approximately 50 nematodes were present in 50 ⁇ l of LB.
- the Xenorhabdus cells used were cultured in LB at 30°C/ 100 rpm for 24 hours and 50 ⁇ l spread on to the surface of each test well.
- the control E. coli cells were treated in a similar way but incubated at 37°C for growth. After application the wells were air dried for 30 min, and 50 ⁇ l of the nematode suspension placed in each well. Again the wells were air dried for 30 min. Plates were incubated at 18°C with 80% relative humidity for 3 days.
- Xenorhabdus spp. C42, H31 and 173 gave 95% mortality, as compared with no significant effect for certain other Xenorhabdus bacterial strains and E. coli. Thus these results clearly show that cells from Xenorhabdus C42, H31 and 173 are an effective nematocide.
- Total DNA was isolated from 173 using a Quiagen genomic DNA purification kit (cat no. 10243). To isolate DNA, cells were grown in Luria broth (lOg tryptone, 5g yeast and 5g NaCl per It) at 26°C with shaking at 200 rpm to an optical density of 1.5 A600. Cells were harvested by centrifugation at 4000 x g and the DNA isolated using Quiagen 100/ G tips, as per manufacturer's instructions. The purified DNA was stored at -20°C in TE buffer (10 mM Tris, 1 mM EDTA, pH 8.0).
- total DNA was partially digested with S ⁇ 3A. Approximately 25 ⁇ g of DNA was incubated at 37°C with 0.25 units of enzyme. At intervals of 5, 15, 30, 45 and 60 minutes, samples were removed and heated at 65°C for 10 minutes. To determine the size of the resulting DNA fragments, the samples were separated on a 0.5% (w/v) agarose gel. The samples containing a dominant DNA fragment size of between 30 and 50 Kb were combined and treated with shrimp alkaline phosphatase (Boehringer) for 20 minutes at 37°C.
- shrimp alkaline phosphatase Boehringer
- the DNA was ligated into the B ⁇ mHI site of the Stratagene cosmid vector Supercosl (scos) and packaged into the Esche ⁇ chia coli strain XL Blue 1 , using a Gigapack II packaging kit (Stratagene) following the manufacturer's instructions.
- Clone cHRIM5 was grown in 50 mis LB containing 50 ⁇ g of ampicillin per ml at 30°C/200 rpm for 40 hours. C42, H31 and 173 were grown in 50 mis LB at 26°C for 48 hours/ 200 rpm. Cultures were centrifuged at 4000 x g for 10 minutes, washed once and resuspended in 5 mis of PBS (0.05 mM phosphate buffer, 0.125M NaCl). To determine activity, 300 ⁇ l of cells were added in triplicate, to 1.2 ml of PBS containing 25, mainly L4 and adult C. elegans larvae in multi well square dishes. As a control, an equivalent amount of XL 1 Blue E. coli cells containing Supercos 1 were used to determine nematode survival. The assays were incubated at 18 °C for 7 days before approximate nematode counts and observations were made.
- Plasmid and cosmid DNA for cloning was prepared using the QIAGEN midi system (tip 100, cat. No 12143). Cells were grown in Luria broth (Merck) at 37°C with shaking at 200 rpm for 18 hours. Cells were harvested by centrifugation at 6,000 x g and the DNA isolated as per manufacturers instructions. Restriction digestion (Roche, Life Technologies), dephosphorylation (Roche) and ligation (Life Technologies) were carried out using manufacturer's recommended conditions and as outlined by Sambrook et al. Transformation was accomplished using electrocompetant cells and a BIO-RAD Gene pulser set at 12.5V cm- 2 . Two ⁇ l of DNA was used to electroporate 80 ⁇ l of early log phase E. coli DH5 alpha cells washed 3 times in sterile water (centrifugation at 6000 x g for 5 mins) and resuspended in
- Sub clone A-380 was constructed by digesting cHRIM5 DNA with the restriction enzyme H ⁇ n lll and re-ligating fragments, this clone contains a deletion of the insert and scos cosmid DNA as the vector.
- Sub clone B-387 is a B ⁇ mHI digestion of cHRIM5 cloned into the plasmid pUC19 also cut with B ⁇ mHI and dephosphorylated.
- Sub clone C-381 was obtained by digesting CHRIM5 DNA with B ⁇ mHI and re-ligating the fragments, this clone contains the scos cosmid as the vector.
- Clones E-391 and F-392 were obtained by cutting cHRIM5 DNA with Sa . and B ⁇ mHI and ligating these fragments into the vector pUC19 also cut with these enzymes.
- Sequencing was conducted using the artificial transposon AT2 (supplied by Perkin-Elmer-Applied Biosystems, Primer Island Transposition kit, cat No. 403015) using the cosmid cHRIM5 and all sub-clones as target DNA.
- One ⁇ g of cHRIM5 DNA was incubated with the transposon AT2 for 1 hour at
- DNA for sequencing was prepared using the QIAGEN ion exchange media (qiawell ⁇ , cat. No. 17122). Clones were grown in 1 ml of
- Example 7 Fragments that encode nematocidal activity
- the cosmid cHRIM5 (figure 4A) was digested with the enzyme S ⁇ /I and religated.
- the resulting sub clone cHRIM ⁇ illustrated in Figure 4B showed nematicidal activity.
- cHRIM6 was digested with the enzyme Sm ⁇ l and religated, producing sub-clone cHRIM7 ( Figure 4C).
- CHRIM7 was digested with Bg ⁇ II and the kanamycin resistance gene block (nptll, Pharmacia) cut with B ⁇ mHI was ligated into it.
- Clone cHRIM6-tn43 was digested with BgRl and Noil and cloned into the vector PLEX (Invitrogen cat. No. K450-01) cut with B ⁇ mHI and Notl.
- the E. coli strain used was GI742 supplied by Invitrogen.
- the resulting plasmid insert (PLEX-BgftJ/tn43, Figure 5) places the pl4-2f and pl3- lf genes under the control of the bacteriophage Lambda PL promoter.
- Figure 5 illustrates the cloning of DNA encoding nematocidal activity in the expression vector PLEX, where: A, plasmid clone; B, insert and gene locations; Tpr, trimethoprim resistance; Apr, ampicillin resistance; P , bacteriophage lambda PL promoter; *, plasmid joins to form a circular molecule; **, incomplete genes. Selection of colonies on RMG media (described in the Invitrogen manual) containing ampicillin (50 ⁇ g mL 1 ) and trimethoprim (50 ⁇ g ml" 1 ) prevents expression from the PL promoter.
- Colonies were then cultured on LB containing Trimethoprim (50 ⁇ g mH) in 2.0 cm 2 wells for nematocidal tests.
- the clone was active. This indicates that genes within this fragment have nematocidal activity.
- the clone PLEX-BgZII/tn43 was digested with CZ ⁇ l and religated, this resulted in a deletion of part of the pl3- lf gene, this clone had reduced nematocidal activity indicating the importance of this gene.
- genes and gene products of pl3- lf and pl4-2f are important for nematocidal activity.
- Other smaller genes within the BgRl to Nrul sites of cHRIM lO and PLEX-BgZII/tn43 may also be essential.
- genes outside this region within the remaining cosmid clone (cHRIM5) may also encode products with nematocidal activity, or may enhance the nematocidal activity of genes in the smaller region (BgRl-Nn ⁇ of cHRIM lO and PLEX-BgZII/tn43).
- Symbiotic bacteria in the absence of their nematode host can be inoculated into one or more portions of a field which is infested with nematodes, or into containers containing unsterilised soil from such a field.
- the bacteria can be inoculated onto the roots of plants, or into seeds.
- Periodically treated and untreated areas or containers can be assayed for nematode larva, egg, or cyst counts and for the presence of the inoculated bacteria by methods well known to those skilled in the art.
- a reduction in the number of nematode counts in areas in which the symbiote bacteria are present indicates control of the nematodes otherwise found in the untreated areas or samples.
- NAHFLIVSKTNVVMSNQDPHNKRDSLFSAPIANLGDWSFDERVAEVFPDMVKRSIPGYSN IISMIGMLASRFVTPGSQIYDLGCSLGAATLSIRRSINADNCRIIAIDNSPAMIERCRRH IDSFKASTPVEVIEQNILDTDIQNASMVVLNFTLQFLHPDDRQKILKKIYAGLKPGGVLV LSEKFNFEDQKIGELLFNMHHDFKRANGYSELEVSQKRSMLENVMRTDSVDTHKSRLKEV GFQHVEVWFQCFNFGSLLAIKGTEQ
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Plant Pathology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Environmental Sciences (AREA)
- Dentistry (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Pest Control & Pesticides (AREA)
- Agronomy & Crop Science (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Measuring Pulse, Heart Rate, Blood Pressure Or Blood Flow (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE60029748T DE60029748D1 (en) | 1999-01-22 | 2000-01-24 | BIOLOGICAL CONTROL OF NEMATODES |
BR0008187-6A BR0008187A (en) | 1999-01-22 | 2000-01-24 | Biological control of nematodes |
AU21178/00A AU778146B2 (en) | 1999-01-22 | 2000-01-24 | Biological control of nematodes |
EP00901218A EP1143800B1 (en) | 1999-01-22 | 2000-01-24 | Biological control of nematodes |
CA002359490A CA2359490A1 (en) | 1999-01-22 | 2000-01-24 | Biological control of nematodes |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB9901499.5 | 1999-01-22 | ||
GBGB9901499.5A GB9901499D0 (en) | 1999-01-22 | 1999-01-22 | Biological control |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2000042855A1 true WO2000042855A1 (en) | 2000-07-27 |
Family
ID=10846394
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/GB2000/000219 WO2000042855A1 (en) | 1999-01-22 | 2000-01-24 | Biological control of nematodes |
Country Status (8)
Country | Link |
---|---|
EP (1) | EP1143800B1 (en) |
AT (1) | ATE334592T1 (en) |
AU (1) | AU778146B2 (en) |
BR (1) | BR0008187A (en) |
CA (1) | CA2359490A1 (en) |
DE (1) | DE60029748D1 (en) |
GB (1) | GB9901499D0 (en) |
WO (1) | WO2000042855A1 (en) |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7071386B2 (en) | 2003-01-21 | 2006-07-04 | Dow Agrosciences Llc | Xenorhabdus TC gene for pest control |
WO2006123157A2 (en) * | 2005-05-18 | 2006-11-23 | University Of Bath | Nematistatic protein |
EP1841783A2 (en) * | 2004-12-22 | 2007-10-10 | Dow Agrosciences LLC | Second tc complex from xenorhabdus |
EP2019115A2 (en) | 2002-06-28 | 2009-01-28 | Dow AgroSciences LLC | Pesticidally active proteins and polynucleotides obtainable from paenibacillus species |
US7491698B2 (en) | 2003-01-21 | 2009-02-17 | Dow Agrosciences Llc | Mixing and matching TC proteins for pest control |
WO2012104837A1 (en) * | 2011-02-01 | 2012-08-09 | Technion Research And Development Foundation Ltd. | Antinematodal methods and compositions |
US9185915B2 (en) | 2010-12-21 | 2015-11-17 | Bayer Cropscience Lp | Sandpaper mutants of bacillus and methods of their use to enhance plant growth, promote plant health and control diseases and pests |
US9554578B2 (en) | 2011-07-25 | 2017-01-31 | Bayer Cropscience Lp | Biocontrol of nematodes |
CN116875499A (en) * | 2023-07-06 | 2023-10-13 | 吉林省农业科学院 | Entomopathogenic nematode symbiotic bacteria and application of metabolite thereof |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102009025119B4 (en) | 2009-06-11 | 2011-07-21 | Leibnitz-Institut für Meereswissenschaften, 24148 | Antitumoral, antibiotic and insecticidal cyclodepsipeptides, their preparation and uses |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS6480294A (en) * | 1987-09-21 | 1989-03-27 | Sumitomo Chemical Co | Bt insecticidal protein gene |
WO1992019739A1 (en) * | 1991-05-03 | 1992-11-12 | Mycogen Corporation | Novel nematode-active toxins and genes which code therefor |
WO1998008388A1 (en) * | 1996-08-29 | 1998-03-05 | The Minister Of Agriculture Fisheries & Food In Her Britannic Majesty's Government Of The United Kingdom Of Great Britain & Northern Ireland | Pesticidal agents |
WO1999022598A1 (en) * | 1997-10-30 | 1999-05-14 | The University Of Reading | Biopesticide: materials and methods |
WO1999042589A2 (en) * | 1998-02-20 | 1999-08-26 | Novartis Pharma Ag. | Insecticidal toxins from photorhabdus |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5972687A (en) * | 1993-06-25 | 1999-10-26 | Commonwealth Scientific And Industrial Research Organisation | Toxin gene from Xenorhabdus nematophilus |
BR9606889A (en) * | 1995-11-06 | 1997-10-28 | Wisconsin Alumni Res Found | Photorhabdus insecticidal protein toxins |
-
1999
- 1999-01-22 GB GBGB9901499.5A patent/GB9901499D0/en not_active Ceased
-
2000
- 2000-01-24 WO PCT/GB2000/000219 patent/WO2000042855A1/en active IP Right Grant
- 2000-01-24 BR BR0008187-6A patent/BR0008187A/en not_active Application Discontinuation
- 2000-01-24 EP EP00901218A patent/EP1143800B1/en not_active Expired - Lifetime
- 2000-01-24 AT AT00901218T patent/ATE334592T1/en not_active IP Right Cessation
- 2000-01-24 CA CA002359490A patent/CA2359490A1/en not_active Abandoned
- 2000-01-24 DE DE60029748T patent/DE60029748D1/en not_active Expired - Lifetime
- 2000-01-24 AU AU21178/00A patent/AU778146B2/en not_active Ceased
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS6480294A (en) * | 1987-09-21 | 1989-03-27 | Sumitomo Chemical Co | Bt insecticidal protein gene |
WO1992019739A1 (en) * | 1991-05-03 | 1992-11-12 | Mycogen Corporation | Novel nematode-active toxins and genes which code therefor |
WO1998008388A1 (en) * | 1996-08-29 | 1998-03-05 | The Minister Of Agriculture Fisheries & Food In Her Britannic Majesty's Government Of The United Kingdom Of Great Britain & Northern Ireland | Pesticidal agents |
WO1999022598A1 (en) * | 1997-10-30 | 1999-05-14 | The University Of Reading | Biopesticide: materials and methods |
WO1999042589A2 (en) * | 1998-02-20 | 1999-08-26 | Novartis Pharma Ag. | Insecticidal toxins from photorhabdus |
Non-Patent Citations (10)
Title |
---|
ACS SYMP. SER. (1997), 658(PHYTOCHEMICALS FOR PEST CONTROL), 134-143 * |
CHEMICAL ABSTRACTS, vol. 126, Columbus, Ohio, US; abstract no. 234686, GEORGIS, R. ET AL: "Novel pesticidal substances from the entomopathogenic nematode-bacterium complex" XP002136523 * |
CHEMICAL ABSTRACTS, vol. 132, Columbus, Ohio, US; abstract no. 163304, HU, KAIJI ET AL: "Nematicidal metabolites produced by Photorhabdus luminescens (Enterobacteriaceae), bacterial symbiont of entomopathogenic nematodes" XP002136522 * |
DATABASE BIOSIS [online] BIOSCIENCES INFORMATION SERVICE, PHILADELPHIA, PA, US; GREWAL, PARWINDER S. (1) ET AL: "Allelopathy: A possible mechanism of suppression of plant-parasitic nematodes by entomopathogenic nematodes.", XP002136524, retrieved from STN * |
DATABASE BIOSIS [online] BIOSCIENCES INFORMATION SERVICE, PHILADELPHIA, PA, US; HAN, RICHOU ET AL: "Trans - specific nematicidal activity of Photorhabdus luminescens.", XP002136525, retrieved from STN * |
K. HU ET AL.: "Mortality of Plant-Parastic Nematodes Caused by Bacterial (Xenorhabdus spp. and Photorhabdus Luminescens) Culture Media", JOURNAL OF NEMATOLOGY, vol. 27, no. 4, December 1995 (1995-12-01), XP000905673 * |
NEMATOLOGY (1999), 1(5), 457-469 * |
NEMATOLOGY, (NOV., 1999) VOL. 1, NO. 7-8, PP. 687-693. * |
NEMATOLOGY, (NOV., 1999) VOL. 1, NO. 7-8, PP. 735-743. * |
PATENT ABSTRACTS OF JAPAN vol. 013, no. 286 (C - 613) 29 June 1989 (1989-06-29) * |
Cited By (17)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7902334B2 (en) | 2002-06-28 | 2011-03-08 | Dow Agrosciences Llc | Pesticidally active proteins and polynucleotides obtainable from Paenibacillus species |
EP2019115A2 (en) | 2002-06-28 | 2009-01-28 | Dow AgroSciences LLC | Pesticidally active proteins and polynucleotides obtainable from paenibacillus species |
US7517956B2 (en) | 2003-01-21 | 2009-04-14 | Dow Agrosciences Llc | Xenorhabdus TC proteins and genes for pest control |
US8084418B2 (en) | 2003-01-21 | 2011-12-27 | Dow Agrosciences Llc | Methods of inhibiting insects by treatment with a complex comprising a Photorhabdus insecticidal protein and one or two Xenorhabdus enhancer proteins |
US7709623B2 (en) | 2003-01-21 | 2010-05-04 | Dow Agrosciences Llc | Xenorhabdus TC proteins and genes for pest control |
US7071386B2 (en) | 2003-01-21 | 2006-07-04 | Dow Agrosciences Llc | Xenorhabdus TC gene for pest control |
US7491698B2 (en) | 2003-01-21 | 2009-02-17 | Dow Agrosciences Llc | Mixing and matching TC proteins for pest control |
EP1841783A4 (en) * | 2004-12-22 | 2008-11-26 | Dow Agrosciences Llc | Second tc complex from xenorhabdus |
EP1841783A2 (en) * | 2004-12-22 | 2007-10-10 | Dow Agrosciences LLC | Second tc complex from xenorhabdus |
WO2006123157A3 (en) * | 2005-05-18 | 2007-03-15 | Univ Bath | Nematistatic protein |
WO2006123157A2 (en) * | 2005-05-18 | 2006-11-23 | University Of Bath | Nematistatic protein |
US9185915B2 (en) | 2010-12-21 | 2015-11-17 | Bayer Cropscience Lp | Sandpaper mutants of bacillus and methods of their use to enhance plant growth, promote plant health and control diseases and pests |
WO2012104837A1 (en) * | 2011-02-01 | 2012-08-09 | Technion Research And Development Foundation Ltd. | Antinematodal methods and compositions |
US9468660B2 (en) | 2011-02-01 | 2016-10-18 | Technion Research And Development Foundation Ltd. | Antinematodal methods and compositions |
US9554578B2 (en) | 2011-07-25 | 2017-01-31 | Bayer Cropscience Lp | Biocontrol of nematodes |
CN116875499A (en) * | 2023-07-06 | 2023-10-13 | 吉林省农业科学院 | Entomopathogenic nematode symbiotic bacteria and application of metabolite thereof |
CN116875499B (en) * | 2023-07-06 | 2024-04-09 | 吉林省农业科学院 | Entomopathogenic nematode symbiotic bacteria and application of metabolite thereof |
Also Published As
Publication number | Publication date |
---|---|
BR0008187A (en) | 2002-04-16 |
GB9901499D0 (en) | 1999-03-17 |
AU778146B2 (en) | 2004-11-18 |
CA2359490A1 (en) | 2000-07-27 |
EP1143800B1 (en) | 2006-08-02 |
AU2117800A (en) | 2000-08-07 |
ATE334592T1 (en) | 2006-08-15 |
EP1143800A1 (en) | 2001-10-17 |
DE60029748D1 (en) | 2006-09-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
RU2382822C2 (en) | INSECTICIDAL PROTEINS EXTRACTED FROM Bacillus BACTERIA AND USE THEREOF | |
CA2112676C (en) | Novel microorganism and insecticide | |
JP4338057B2 (en) | Insecticide | |
JP3794548B2 (en) | Bacillus thuringiensis Cry6 toxin with improved activity | |
EP1143800B1 (en) | Biological control of nematodes | |
JP2002500166A (en) | Toxin Active Against Ostrinianubilis | |
JP4018749B2 (en) | Bacillus thuringiensis gene encoding a toxin effective against nematodes | |
WO1997026339A1 (en) | Method of protecting crop plants against insect pests | |
EP1130970B1 (en) | Insecticidal agents | |
JP3987912B2 (en) | Bacillus thuringiensis strain effective against weevil | |
KR100280380B1 (en) | Endotoxin Protein of Bacillus thuringiensis ENT0423 Strain and Microbial Insecticide Using the Same | |
US20050246789A1 (en) | Polypeptide having larvae growth inhibiting or insecticidal effect on scarabaeidae insects | |
KR100599414B1 (en) | Bacillus thuringiensis k-3 strain having novel genes showing insecticidal activity for lepidopteran larvae and microbiological formulation using the same | |
WO1992020802A2 (en) | Novel bacillus thuringiensis isolates active against hymenopteran pests and genes encoding hymenopteran-active toxins | |
MX2011004154A (en) | Derived proteins from cry genes of bacillus thuringiensis. | |
AU668687C (en) | Novel (bacillus thuringiensis) isolates active against hymenopteran pests and genes encoding hymenopteran-active toxins | |
KR20010022626A (en) | Materials and method for controlling homopteran pests | |
ZA200005662B (en) | Novel insecticidal toxins from xenorhabdus nematophilus and nucleic acid sequences coding therefor. |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
ENP | Entry into the national phase |
Ref document number: 2359490 Country of ref document: CA Ref country code: CA Ref document number: 2359490 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000901218 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 21178/00 Country of ref document: AU |
|
WWP | Wipo information: published in national office |
Ref document number: 2000901218 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 09889874 Country of ref document: US |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWG | Wipo information: grant in national office |
Ref document number: 21178/00 Country of ref document: AU |
|
WWG | Wipo information: grant in national office |
Ref document number: 2000901218 Country of ref document: EP |