WO1998009642A9 - Antagonistes de chemokines therapeutiques - Google Patents
Antagonistes de chemokines therapeutiquesInfo
- Publication number
- WO1998009642A9 WO1998009642A9 PCT/US1997/015594 US9715594W WO9809642A9 WO 1998009642 A9 WO1998009642 A9 WO 1998009642A9 US 9715594 W US9715594 W US 9715594W WO 9809642 A9 WO9809642 A9 WO 9809642A9
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gpl20
- cells
- binding
- monocytes
- cell
- Prior art date
Links
- 230000003042 antagnostic Effects 0.000 title description 4
- 230000001225 therapeutic Effects 0.000 title description 4
- 239000005557 antagonist Substances 0.000 title description 3
- 210000004027 cells Anatomy 0.000 claims abstract description 164
- 210000001616 Monocytes Anatomy 0.000 claims abstract description 134
- 101700042113 tap Proteins 0.000 claims abstract description 78
- 230000004044 response Effects 0.000 claims abstract description 49
- 230000001889 chemoattractant Effects 0.000 claims abstract description 29
- 239000002975 chemoattractant Substances 0.000 claims abstract description 29
- 210000001744 T-Lymphocytes Anatomy 0.000 claims abstract description 27
- PRQROPMIIGLWRP-UHFFFAOYSA-N N-formyl-methionyl-leucyl-phenylalanin Chemical compound CSCCC(NC=O)C(=O)NC(CC(C)C)C(=O)NC(C(O)=O)CC1=CC=CC=C1 PRQROPMIIGLWRP-UHFFFAOYSA-N 0.000 claims abstract description 26
- 229920001184 polypeptide Polymers 0.000 claims abstract description 17
- 230000004968 inflammatory condition Effects 0.000 claims abstract description 9
- 230000027455 binding Effects 0.000 claims description 131
- 102100013077 CD4 Human genes 0.000 claims description 105
- 101700022938 CD4 Proteins 0.000 claims description 103
- 101700050775 oct-1 Proteins 0.000 claims description 38
- 239000008194 pharmaceutical composition Substances 0.000 claims description 30
- 230000035605 chemotaxis Effects 0.000 claims description 27
- 102000004965 antibodies Human genes 0.000 claims description 26
- 108090001123 antibodies Proteins 0.000 claims description 26
- 102100016449 CCL5 Human genes 0.000 claims description 24
- 108010055166 Chemokine CCL5 Proteins 0.000 claims description 24
- 101710043203 P23p89 Proteins 0.000 claims description 21
- 230000003399 chemotactic Effects 0.000 claims description 19
- 102100008428 CCL2 Human genes 0.000 claims description 16
- 101700006000 CCL2 Proteins 0.000 claims description 16
- RJSZPKZQGIKVAU-UXBJKDEOSA-N Peptide F Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C(C)C)C(C)C)C1=CC=CC=C1 RJSZPKZQGIKVAU-UXBJKDEOSA-N 0.000 claims description 10
- 239000000203 mixture Substances 0.000 claims description 10
- 108010091742 peptide F Proteins 0.000 claims description 10
- 102100016450 CCL7 Human genes 0.000 claims description 4
- 101700044004 CCL7 Proteins 0.000 claims description 4
- 206010013974 Dyspnoea paroxysmal nocturnal Diseases 0.000 claims description 4
- JMUPMJGUKXYCMF-UHFFFAOYSA-N N-[2-[2-[[6-[5-acetamido-6-(5-acetamido-1,2,4-trihydroxy-6-oxohexan-3-yl)oxy-4-hydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-4-[3-[3-acetamido-4-hydroxy-6-(hydroxymethyl)-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymet Chemical compound OC1C(NC(C)=O)C(OC(C(O)C(C=O)NC(=O)C)C(O)CO)OC(CO)C1OC1C(O)C(OC2C(C(O)C(O)C(CO)O2)OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)NC(C)=O)C(O)C(COC2C(C(O)C(O)C(CO)O2)OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)NC(C)=O)O1 JMUPMJGUKXYCMF-UHFFFAOYSA-N 0.000 claims description 4
- 101700019351 TRYM Proteins 0.000 claims description 4
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 4
- 150000001875 compounds Chemical class 0.000 claims description 4
- 206010020751 Hypersensitivity Diseases 0.000 claims description 3
- 208000006673 Asthma Diseases 0.000 claims description 2
- 206010018364 Glomerulonephritis Diseases 0.000 claims description 2
- 208000009525 Myocarditis Diseases 0.000 claims description 2
- 206010039073 Rheumatoid arthritis Diseases 0.000 claims description 2
- 201000006417 multiple sclerosis Diseases 0.000 claims description 2
- 206010073508 Drug reaction with eosinophilia and systemic symptom Diseases 0.000 claims 1
- 201000009961 allergic asthma Diseases 0.000 claims 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 abstract description 26
- 230000005012 migration Effects 0.000 abstract description 26
- 102000001902 CC Chemokines Human genes 0.000 abstract description 19
- 108010040471 CC Chemokines Proteins 0.000 abstract description 19
- 201000010099 disease Diseases 0.000 abstract description 12
- 101710023234 Segment 5 Proteins 0.000 abstract description 3
- 102000004040 Capsid Proteins Human genes 0.000 abstract 1
- 108090000565 Capsid Proteins Proteins 0.000 abstract 1
- 102000019034 Chemokines Human genes 0.000 description 50
- 108010012236 Chemokines Proteins 0.000 description 50
- 239000002609 media Substances 0.000 description 43
- 230000002401 inhibitory effect Effects 0.000 description 42
- 230000000694 effects Effects 0.000 description 37
- 102100012080 CCR5 Human genes 0.000 description 33
- 101700043583 CCR5 Proteins 0.000 description 33
- 102100002212 CXCR4 Human genes 0.000 description 30
- 102000009410 chemokine receptors Human genes 0.000 description 24
- 108050000299 chemokine receptors Proteins 0.000 description 24
- 108010043277 recombinant soluble CD4 Proteins 0.000 description 23
- 210000000440 Neutrophils Anatomy 0.000 description 21
- 102000005962 receptors Human genes 0.000 description 20
- 108020003175 receptors Proteins 0.000 description 20
- 101710003734 CXCR4 Proteins 0.000 description 17
- 239000003446 ligand Substances 0.000 description 16
- 238000002474 experimental method Methods 0.000 description 15
- 108010061299 CXCR4 Receptors Proteins 0.000 description 13
- 238000002360 preparation method Methods 0.000 description 13
- HJHVQCXHVMGZNC-JCJNLNMISA-M sodium;(2Z)-2-[(3R,4S,5S,8S,9S,10S,11R,13R,14S,16S)-16-acetyloxy-3,11-dihydroxy-4,8,10,14-tetramethyl-2,3,4,5,6,7,9,11,12,13,15,16-dodecahydro-1H-cyclopenta[a]phenanthren-17-ylidene]-6-methylhept-5-enoate Chemical compound [Na+].O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C([O-])=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C HJHVQCXHVMGZNC-JCJNLNMISA-M 0.000 description 13
- 102000004890 Interleukin-8 Human genes 0.000 description 12
- 108090001007 Interleukin-8 Proteins 0.000 description 12
- 230000003828 downregulation Effects 0.000 description 12
- HKSZLNNOFSGOKW-FYTWVXJKSA-N Staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 11
- 241000700605 Viruses Species 0.000 description 11
- -1 MlP-lα Proteins 0.000 description 10
- 108010045030 monoclonal antibodies Proteins 0.000 description 10
- 102000005614 monoclonal antibodies Human genes 0.000 description 10
- 238000000692 Student's t-test Methods 0.000 description 9
- 238000004166 bioassay Methods 0.000 description 9
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 9
- 230000002829 reduced Effects 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- 108010076288 Formyl Peptide Receptors Proteins 0.000 description 8
- 102000011652 Formyl Peptide Receptors Human genes 0.000 description 8
- 150000001413 amino acids Chemical class 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 241000725303 Human immunodeficiency virus Species 0.000 description 7
- 102100002262 NR2E1 Human genes 0.000 description 7
- 101700077161 NR2E1 Proteins 0.000 description 7
- LSUTUUOITDQYNO-UHFFFAOYSA-N calphostin C Chemical compound C=12C3=C4C(CC(C)OC(=O)C=5C=CC=CC=5)=C(OC)C(O)=C(C(C=C5OC)=O)C4=C5C=1C(OC)=CC(=O)C2=C(O)C(OC)=C3CC(C)OC(=O)OC1=CC=C(O)C=C1 LSUTUUOITDQYNO-UHFFFAOYSA-N 0.000 description 7
- 230000012292 cell migration Effects 0.000 description 7
- 101700005465 mip-1 Proteins 0.000 description 7
- 230000003389 potentiating Effects 0.000 description 7
- 238000005406 washing Methods 0.000 description 7
- 206010000565 Acquired immunodeficiency syndrome Diseases 0.000 description 6
- 241000700618 Vaccinia virus Species 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 201000009910 diseases by infectious agent Diseases 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 239000011886 peripheral blood Substances 0.000 description 6
- 101710038852 pkc-3 Proteins 0.000 description 6
- 238000000159 protein binding assay Methods 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 229940064005 Antibiotic throat preparations Drugs 0.000 description 5
- 229940083879 Antibiotics FOR TREATMENT OF HEMORRHOIDS AND ANAL FISSURES FOR TOPICAL USE Drugs 0.000 description 5
- 229940042052 Antibiotics for systemic use Drugs 0.000 description 5
- 229940042786 Antitubercular Antibiotics Drugs 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- 108091006011 G proteins Proteins 0.000 description 5
- 102000030007 GTP-Binding Proteins Human genes 0.000 description 5
- 108091000058 GTP-Binding Proteins Proteins 0.000 description 5
- 229940093922 Gynecological Antibiotics Drugs 0.000 description 5
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 5
- 229940024982 Topical Antifungal Antibiotics Drugs 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 239000003242 anti bacterial agent Substances 0.000 description 5
- 230000003115 biocidal Effects 0.000 description 5
- 238000000586 desensitisation Methods 0.000 description 5
- 231100000673 dose–response relationship Toxicity 0.000 description 5
- 230000002757 inflammatory Effects 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 229940079866 intestinal antibiotics Drugs 0.000 description 5
- 230000001404 mediated Effects 0.000 description 5
- 230000028550 monocyte chemotaxis Effects 0.000 description 5
- 229940005935 ophthalmologic Antibiotics Drugs 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 230000003612 virological Effects 0.000 description 5
- 102100016451 CCL8 Human genes 0.000 description 4
- 101700045693 CCL8 Proteins 0.000 description 4
- 102100005860 CCR1 Human genes 0.000 description 4
- 101700076092 CCR1 Proteins 0.000 description 4
- 101700083927 CCR1 Proteins 0.000 description 4
- 102100014691 CXCL12 Human genes 0.000 description 4
- 101710043128 CXCL12 Proteins 0.000 description 4
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 description 4
- 108060002920 FPR1 Proteins 0.000 description 4
- 102100002030 FPR1 Human genes 0.000 description 4
- MCAHMSDENAOJFZ-BVXDHVRPSA-N Herbimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](OC)[C@@H](OC)C[C@H](C)[C@@H](OC)C2=CC(=O)C=C1C2=O MCAHMSDENAOJFZ-BVXDHVRPSA-N 0.000 description 4
- 229960000310 ISOLEUCINE Drugs 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- 101700071234 RBG8 Proteins 0.000 description 4
- 210000002966 Serum Anatomy 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 230000001154 acute Effects 0.000 description 4
- 230000001684 chronic Effects 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 230000010807 negative regulation of binding Effects 0.000 description 4
- 230000001105 regulatory Effects 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 210000001519 tissues Anatomy 0.000 description 4
- 229960001230 Asparagine Drugs 0.000 description 3
- 206010003816 Autoimmune disease Diseases 0.000 description 3
- 210000000170 Cell Membrane Anatomy 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N D-sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 229960002449 Glycine Drugs 0.000 description 3
- 208000005721 HIV Infections Diseases 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- AEUKDPKXTPNBNY-XEYRWQBLSA-N MCP 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 3
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 239000007759 RPMI Media 1640 Substances 0.000 description 3
- CZMRCDWAGMRECN-GDQSFJPYSA-N Sucrose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1)[C@@]1(CO)[C@H](O)[C@@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-GDQSFJPYSA-N 0.000 description 3
- 102000004142 Trypsin Human genes 0.000 description 3
- 108090000631 Trypsin Proteins 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 230000003110 anti-inflammatory Effects 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 230000001580 bacterial Effects 0.000 description 3
- 230000002860 competitive Effects 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 230000002222 downregulating Effects 0.000 description 3
- 229940079593 drugs Drugs 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 235000019441 ethanol Nutrition 0.000 description 3
- 230000001506 immunosuppresive Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000003834 intracellular Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000006011 modification reaction Methods 0.000 description 3
- 230000003472 neutralizing Effects 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 230000002335 preservative Effects 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 235000010356 sorbitol Nutrition 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000006188 syrup Substances 0.000 description 3
- 235000020357 syrup Nutrition 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 229960001322 trypsin Drugs 0.000 description 3
- 239000012588 trypsin Substances 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- JLPULHDHAOZNQI-ZTIMHPMXSA-N 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC JLPULHDHAOZNQI-ZTIMHPMXSA-N 0.000 description 2
- BVDRUCCQKHGCRX-UHFFFAOYSA-N 2,3-dihydroxypropyl formate Chemical compound OCC(O)COC=O BVDRUCCQKHGCRX-UHFFFAOYSA-N 0.000 description 2
- 229940116904 ANTIINFLAMMATORY THERAPEUTIC RADIOPHARMACEUTICALS Drugs 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 229940009098 Aspartate Drugs 0.000 description 2
- 210000004369 Blood Anatomy 0.000 description 2
- 210000001124 Body Fluids Anatomy 0.000 description 2
- 229940098773 Bovine Serum Albumin Drugs 0.000 description 2
- 108091003117 Bovine Serum Albumin Proteins 0.000 description 2
- 101700070842 CCR3 Proteins 0.000 description 2
- 102100005861 CCR3 Human genes 0.000 description 2
- 108010017088 CCR5 Receptors Proteins 0.000 description 2
- 102000004274 CCR5 Receptors Human genes 0.000 description 2
- 108010041397 CD4 Antigens Proteins 0.000 description 2
- 229920002676 Complementary DNA Polymers 0.000 description 2
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-UHFFFAOYSA-N DL-aspartic acid Chemical compound OC(=O)C(N)CC(O)=O CKLJMWTZIZZHCS-UHFFFAOYSA-N 0.000 description 2
- 102000033180 ERVK-6 Human genes 0.000 description 2
- 101710038044 ERVK-6 Proteins 0.000 description 2
- 101710027967 ERVW-1 Proteins 0.000 description 2
- 108060003133 GDPGP1 Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N HEPES Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 206010062016 Immunosuppression Diseases 0.000 description 2
- 210000004969 Inflammatory Cells Anatomy 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 229940067606 Lecithin Drugs 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 210000000265 Leukocytes Anatomy 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 108010061543 Neutralizing Antibodies Proteins 0.000 description 2
- 229940074726 OPHTHALMOLOGIC ANTIINFLAMMATORY AGENTS Drugs 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N Oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 108010081690 Pertussis Toxin Proteins 0.000 description 2
- 229960005190 Phenylalanine Drugs 0.000 description 2
- 102000001253 Protein Kinases Human genes 0.000 description 2
- 108060006633 Protein Kinases Proteins 0.000 description 2
- 229940075582 Sorbic Acid Drugs 0.000 description 2
- 108060008443 TPPP Proteins 0.000 description 2
- 101710028807 TP_0041 Proteins 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 208000007089 Vaccinia Diseases 0.000 description 2
- 206010046865 Vaccinia virus infection Diseases 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000000240 adjuvant Effects 0.000 description 2
- 230000000172 allergic Effects 0.000 description 2
- 201000008937 atopic dermatitis Diseases 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000010839 body fluid Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M buffer Substances [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 230000001413 cellular Effects 0.000 description 2
- 239000005482 chemotactic factor Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000004624 confocal microscopy Methods 0.000 description 2
- 230000023298 conjugation with cellular fusion Effects 0.000 description 2
- 230000000875 corresponding Effects 0.000 description 2
- 230000001086 cytosolic Effects 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- 239000003925 fat Substances 0.000 description 2
- 235000019197 fats Nutrition 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 230000004907 flux Effects 0.000 description 2
- 238000005755 formation reaction Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 200000000018 inflammatory disease Diseases 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000003278 mimic Effects 0.000 description 2
- 239000002687 nonaqueous vehicle Substances 0.000 description 2
- 230000003000 nontoxic Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 210000000056 organs Anatomy 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000000546 pharmaceutic aid Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 239000011148 porous material Substances 0.000 description 2
- DNIAPMSPPWPWGF-UHFFFAOYSA-N propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 2
- 230000027425 release of sequestered calcium ion into cytosol Effects 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 235000002639 sodium chloride Nutrition 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- WSWCOQWTEOXDQX-UHFFFAOYSA-N sorbic acid Chemical compound CC=CC=CC(O)=O WSWCOQWTEOXDQX-UHFFFAOYSA-N 0.000 description 2
- 235000010199 sorbic acid Nutrition 0.000 description 2
- 239000004334 sorbic acid Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 230000005700 syncytium formation by plasma membrane fusion Effects 0.000 description 2
- 230000000699 topical Effects 0.000 description 2
- 230000010415 tropism Effects 0.000 description 2
- 238000004450 types of analysis Methods 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- OSNSWKAZFASRNG-BMZZJELJSA-N (3R,4S,5S,6R)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol;hydrate Chemical compound O.OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O OSNSWKAZFASRNG-BMZZJELJSA-N 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L 7681-57-4 Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N AI2O3 Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 229940033495 ANTIMALARIALS Drugs 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- 229940063655 Aluminum stearate Drugs 0.000 description 1
- 229940114079 Arachidonic Acid Drugs 0.000 description 1
- YZXBAPSDXZZRGB-DOFZRALJSA-N Arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 210000003567 Ascitic Fluid Anatomy 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 229960002170 Azathioprine Drugs 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 229960000686 Benzalkonium Chloride Drugs 0.000 description 1
- 108010007539 Blocking Antibodies Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 102100003160 CCL3 Human genes 0.000 description 1
- 101700004951 CCL3 Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229960003260 Chlorhexidine Drugs 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000010247 Contact Dermatitis Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- JYGXADMDTFJGBT-VWUMJDOOSA-N Cortisol Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 229960004397 Cyclophosphamide Drugs 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 210000000805 Cytoplasm Anatomy 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N D-Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N DATI Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- 206010012442 Dermatitis contact Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L Dipotassium phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 235000004418 Durio kutejensis Nutrition 0.000 description 1
- 229940047652 Ear Drops Drugs 0.000 description 1
- 208000005679 Eczema Diseases 0.000 description 1
- 210000003979 Eosinophils Anatomy 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Exidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 229940012356 Eye Drops Drugs 0.000 description 1
- 229940065521 Glucocorticoid inhalants for obstructive airway disease Drugs 0.000 description 1
- 210000000224 Granular leucocyte Anatomy 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 108091006822 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 102000005757 Human immunodeficiency virus 1 gp41 protein Human genes 0.000 description 1
- 108010070748 Human immunodeficiency virus 1 gp41 protein Proteins 0.000 description 1
- PNDZEEPOYCVIIY-UHFFFAOYSA-N Indo-1 Chemical compound CC1=CC=C(N(CC(O)=O)CC(O)=O)C(OCCOC=2C(=CC=C(C=2)C=2N=C3[CH]C(=CC=C3C=2)C(O)=O)N(CC(O)=O)CC(O)=O)=C1 PNDZEEPOYCVIIY-UHFFFAOYSA-N 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 229940047124 Interferons Drugs 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-UUNJERMWSA-N Lactose Natural products O([C@@H]1[C@H](O)[C@H](O)[C@H](O)O[C@@H]1CO)[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1 GUBGYTABKSRVRQ-UUNJERMWSA-N 0.000 description 1
- 206010024324 Leukaemias Diseases 0.000 description 1
- 229960005015 Local anesthetics Drugs 0.000 description 1
- 229940083877 Local anesthetics for treatment of hemorrhoids and anal fissures for topical use Drugs 0.000 description 1
- 210000004698 Lymphocytes Anatomy 0.000 description 1
- 210000004759 MCP Anatomy 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- 241000337661 Parada Species 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N Penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 210000003800 Pharynx Anatomy 0.000 description 1
- 229940096826 Phenylmercuric Acetate Drugs 0.000 description 1
- 229960002553 Phenylmercuric nitrate Drugs 0.000 description 1
- XEBWQGVWTUSTLN-UHFFFAOYSA-M Phenylmercury acetate Chemical compound CC(=O)O[Hg]C1=CC=CC=C1 XEBWQGVWTUSTLN-UHFFFAOYSA-M 0.000 description 1
- 229920001451 Polypropylene glycol Polymers 0.000 description 1
- 229940069338 Potassium Sorbate Drugs 0.000 description 1
- CHHHXKFHOYLYRE-STWYSWDKSA-M Potassium sorbate Chemical compound [K+].C\C=C\C=C\C([O-])=O CHHHXKFHOYLYRE-STWYSWDKSA-M 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N Propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229950008679 Protamine sulfate Drugs 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- GKBMIFPNPOSTHB-BJBKLNMKSA-N Recombinant soluble CD4 Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O GKBMIFPNPOSTHB-BJBKLNMKSA-N 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 101710042981 SHMT1 Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N Sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 210000003491 Skin Anatomy 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 229940037128 Systemic Glucocorticoids Drugs 0.000 description 1
- 102100001172 TPPP Human genes 0.000 description 1
- FKHIFSZMMVMEQY-UHFFFAOYSA-N Talc Chemical compound [Mg+2].[O-][Si]([O-])=O FKHIFSZMMVMEQY-UHFFFAOYSA-N 0.000 description 1
- 229940116362 Tragacanth Drugs 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H Tricalcium phosphate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 101700028070 VPX Proteins 0.000 description 1
- 210000002845 Virion Anatomy 0.000 description 1
- 208000001756 Virus Disease Diseases 0.000 description 1
- 210000002268 Wool Anatomy 0.000 description 1
- NWGKJDSIEKMTRX-HSACVWGTSA-N [(2R)-2-[(2R,3R,4S)-3,4-dihydroxyoxolan-2-yl]-2-hydroxyethyl] (E)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O NWGKJDSIEKMTRX-HSACVWGTSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000000665 anti-chemotactic Effects 0.000 description 1
- 230000000947 anti-immunosuppressive Effects 0.000 description 1
- 230000000781 anti-lymphocytic Effects 0.000 description 1
- 230000000078 anti-malarial Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000038129 antigens Human genes 0.000 description 1
- 108091007172 antigens Proteins 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229960000070 antineoplastic Monoclonal antibodies Drugs 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- 201000001320 atherosclerosis Diseases 0.000 description 1
- 201000009596 autoimmune hypersensitivity disease Diseases 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 235000015241 bacon Nutrition 0.000 description 1
- 239000003899 bactericide agent Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000000035 biogenic Effects 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000019437 butane-1,3-diol Nutrition 0.000 description 1
- PUPZLCDOIYMWBV-UHFFFAOYSA-N butylene glycol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 230000005591 charge neutralization Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000003040 circulating cell Anatomy 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229960005188 collagen Drugs 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000000295 complement Effects 0.000 description 1
- 230000001010 compromised Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000012531 culture fluid Substances 0.000 description 1
- PMATZTZNYRCHOR-UHFFFAOYSA-N cyclosporine A Chemical compound CCC1NC(=O)C(C(O)C(C)CC=CC)N(C)C(=O)C(C(C)C)N(C)C(=O)C(CC(C)C)N(C)C(=O)C(CC(C)C)N(C)C(=O)C(C)NC(=O)C(C)NC(=O)C(CC(C)C)N(C)C(=O)C(C(C)C)NC(=O)C(CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 201000004624 dermatitis Diseases 0.000 description 1
- 231100000080 dermatitis contact Toxicity 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- QXNVGIXVLWOKEQ-UHFFFAOYSA-N disodium Chemical compound [Na][Na] QXNVGIXVLWOKEQ-UHFFFAOYSA-N 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 231100001003 eczema Toxicity 0.000 description 1
- 239000008157 edible vegetable oil Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000029578 entry into host Effects 0.000 description 1
- 230000002327 eosinophilic Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000000417 fungicide Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 230000002068 genetic Effects 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 230000003899 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 229960003943 hypromellose Drugs 0.000 description 1
- 230000002519 immonomodulatory Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000000984 immunochemical Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 239000003589 local anesthetic agent Substances 0.000 description 1
- 229940064003 local anesthetic throat preparations Drugs 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001926 lymphatic Effects 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 229960000060 monoclonal antibodies Drugs 0.000 description 1
- 210000002864 mononuclear phagocyte Anatomy 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 230000001264 neutralization Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- PDTFCHSETJBPTR-UHFFFAOYSA-N nitrooxy(phenyl)mercury Chemical compound [O-][N+](=O)O[Hg]C1=CC=CC=C1 PDTFCHSETJBPTR-UHFFFAOYSA-N 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000003182 parenteral nutrition solution Substances 0.000 description 1
- 230000036961 partial Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 230000000737 periodic Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000000770 pro-inflamatory Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000001681 protective Effects 0.000 description 1
- 239000003909 protein kinase inhibitor Substances 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000000717 retained Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 239000004296 sodium metabisulphite Substances 0.000 description 1
- 239000001593 sorbitan monooleate Substances 0.000 description 1
- 235000011069 sorbitan monooleate Nutrition 0.000 description 1
- 229940035049 sorbitan monooleate Drugs 0.000 description 1
- 230000002269 spontaneous Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960001814 trypan blue Drugs 0.000 description 1
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Definitions
- the present invention relates to a new class of C-C chemokine antagonists that are useful for treating inflammatory conditions or diseases, for example.
- Chemokines are peptides that mediate chemotaxis and other pro-inflammatory phenomena
- chemokines are subdivided into two distinct subfamilies, C-X-C and C-C, based on the arrangement of the first two cysteines of the primary amino acid sequence.
- C-C chemokine subfamily have remarkable similarities in their structural organization and biochemical properties and have similar biological effects, both in vitro and in vivo.
- RANTES, MlP-l ⁇ , and MIP-1 / 3 are C-C chemokines that are all potent inducers of T-cell and mononuclear phagocyte chemotaxis and exert diverse effects on eosinophilic and basophilic polymorphonuclear leukocytes (Schall, Cytokine 3:165, 1991).
- the biological properties of C-C chemokines have prompted speculation that these chemokines are mediators in autoimmune and allergic disorders.
- Chemokines bind to a variety of receptors that contain seven-transmembrane regions and thus are known as STM receptors. In the nanomolar (nM) range, chemokines activate G proteins, initiate signal transduction, and mobilize receptor-expressing inflammatory cells. Higher ( ⁇ M) doses bind to STM receptors but uncouple G proteins, resulting in an attenuation or desensitization of leukocyte response and a concomitant inhibition of migration.
- Several receptors that bind RANTES, MIP-l ⁇ , and MIP-10 with high affinity have recently been identified and cloned (Neote et al., Cell 72:415, 1993; Gao et al, J. Exp. Med.
- RANTES, MlP-l ⁇ , MIP-l ⁇ , and MCP-1 genes have been isolated and expressed in heterologous systems (see, e.g., Schall and Bacon, Curr. Opin. Immunol. 6:865-873, 1994.
- the human immunodeficiency virus (HIV) utilizes chemokine receptors, such as CCR5 and fusin, as co-receptors to enter monocytes and T lymphocytes (Berger et al., Science 272:872- 877, 1996; Jon, Science 272:809-810, 1996). HIV-1 infection can be blocked by MIP-1- ⁇ , MIP-1-/3, and RANTES (Cocchi et al , Science 270:1811-1815, 1995).
- CD4 + cells such as monocytes and T-cells
- CD4 + cells such as monocytes and T-cells
- CD4-binding substances suppress CD4 + cells such as monocytes and T cells to chemoattractants such as chemokines, reducing migration of such cells to an inflammatory site at which such chemoattractants are produced.
- compositions for reducing chemotaxis of a CD4 + cell in response to a chemoattractant such as a C-C chemokine (e.g., MIP-l ⁇ , MIP-1/3, RANTES, MCP-1, and MCP-3), SDF-l ⁇ , and fMLP.
- a chemoattractant such as a C-C chemokine (e.g., MIP-l ⁇ , MIP-1/3, RANTES, MCP-1, and MCP-3), SDF-l ⁇ , and fMLP.
- Such pharmaceutical compositions comprise an effective amount of one or more of gpl20, gp41, and variants thereof, and a pharmaceutically suitable excipient.
- Variants of gpl20 and gp41 useful in the practice of the present invention include, but are not limited to, the V3 loop or PND domain of gpl20 and CD4- binding fragments of gpl20 and gp41 such as peptide F.
- Such pharmaceutical compositions can also include an anti-inflammatory substance other than gpl20, gp41, or variants thereof.
- methods are provided for reducing a chemotactic response of a CD4 + cell that comprise administering a pharmaceutical composition that includes an effective amount of one or more of gpl20, gp41, or variant forms thereof.
- methods are provided for treating inflammatory conditions or diseases comprising administering to a mammal (e.g., a human) a pharmaceutical composition that includes an amount of one or more of gpl20, gp41, and variant forms thereof, that is effective in significantly reducing a chemotactic response of a monocyte or T lymphocyte and a pharmaceutically suitable excipient.
- methods of treating an inflammatory condition of a subject comprise administering to the subject a pharmaceutical composition comprising an amount of a CD4-binding compound that is effective to significantly reduce migration of said CD4 + cells to an inflammatory site.
- methods for inhibiting chemotaxis of a CD4 + cell comprising contacting the cell with an effective concentration of a CD4- binding compound.
- assays for chemokine activity or chemokine binding are provided wherein a CD4 + cell is contacted with a test substance and the effect of the test substance on migration of the cell is determined.
- FIG. 1 shows that five different preparations of purified gpl20, from various, laboratory- adapted strains of HIV-1, display dose-dependent chemotaxis effects on fresh, human peripheral blood monocytes in the dose range of 0.1 to 50 nM, similar to the effects of chemokines MCP-1 , MIP-l ⁇ and MIP-1/3.
- FIG. 2 shows that preincubation with gpl20 (E109) inhibited the binding of I 125 - radiolabeled MIP-1 3 to the surface of monocytes.
- the degree of competitive binding was roughly equivalent to that shown by MlP-l ⁇ .
- the inhibition of binding of I 125 -radiolabeled MIP-1/3 was significantly increased by preincubation of monocytes with gpl20.
- FIG. 3 shows inhibition of binding to monocytes of I 125 -radiolabeled MIP-1/3, MIP-l ⁇ , and RANTES, mediated by gp41-2, a gp41 preparation.
- FIGS. 4A-E show reduction of binding of 125 I-labeled C-C chemokines to monocytes pretreated with gpl20 (shaded bars), and competition by gpl20 for chemokine binding to monocytes
- FIG. 4F shows the effect of gpl20 on neutrophil binding of 125 I-IL-8. Shaded bars represent the percent reduction of neutrophil binding of labeled IL-8. Hatched bars indicate the levels of direct competition with IL-8 for binding by gpl20. The horizontal line depicts the maximal level of direct competition of IL-8 binding by unlabeled IL-8 (60 nM).
- FIG. 5 shows inhibition of monocyte binding for MIP-/3 by anti-CD4 monoclonal antibodies. *P ⁇ 0.05 in comparison to MIP-1/3 binding to cells incubated with medium.
- FIGS. 6A-E shows the percent inhibition by gp41 of total binding of various C-C chemokines by monocytes. Hatched bars show results of direct competition of gp41 with C-C chemokines for monocyte binding. Shaded bars show results of preincubation of monocytes with gp41.
- A MIP-1 3 (120 nM); B, MlP-l ⁇ (120 nM); C, RANTES (120 nM); D, MCP-1 (120 nM); E, MCP-3 (120 nM).
- 6F shows the percent inhibition of total binding of the C-X-C chemokine IL-8 by neutrophils after treatment with 0-5 nM gp41. Hatched bars show results of direct competition of gp41 with IL-8 for monocyte binding. Shaded bars show results of preincubation of monocytes with gp41.
- FIG. 7 shows fluorescence-activated cell sorting (FACS) analyses showing cell surface expression of CCR5 by monocytes after preincubation with gp41.
- A untreated cells
- B MIP 1-/3
- C gp41
- D anti-CD4 monoclonal antibody
- E PMA
- F anti-CD14 monoclonal antibody.
- FIG. 8 shows the inhibitory effect of gpl20 (MN) on binding of SDF-l ⁇ by T cells after pretreatment with herbimycin A.
- a variant of gpl20 or gp41 is a fragment thereof that retains gpl20 or gp41 biological activity, e.g., that inhibits a C-C cytokine from binding monocytes and/or that antagonizes chemotaxis, preferably a CD-4 binding fragment such as peptide F (EGSDTITLPCRIKQFINMWQE), a fragment of gpl20 or the following peptide fragments derived from the DP178 region of gp41 that potently inhibit HIV-1 virus entry and replication: LAI YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF MN YTSLIYSLLEKSQTQQEKNEQELLELDKWASLWNWF RF YTGIIYNLLEESQNQEKNEQELLELDKWASLWNWF
- SF2 YTNTIYTLLEESQNQQEKNEQELLELDKWASLWNWF Fragments of g ⁇ l20 or gp41 are preferably at least 10-50, more preferably 10-20 amino acids in length.
- Variant polypeptides also include amino-acid sequence variants of a native or wild-type gpl20 or gp41 polypeptide or fragment thereof that include substitutions, deletions, or insertions of one or a small number of amino acid residues but retain the ability to inhibit a C-C cytokine from binding monocytes or that antagonizes chemotaxis.
- Such amino-acid sequence variants have at least
- Such conservative replacements are: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine, glutamine, or glutamate; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; valine to isoleucine or le
- variant polypeptides include conventional protein modifications to increase stability or solubility or to alter protein configuration, including the incorporation of a rare amino acid, a D- amino acid, a glycosylation site, or a cysteine for disulfide-bridge formation.
- a variant can be synthesized chemically, or the isolated gene can be site-directed mutagenized, or a synthetic gene can be synthesized and expressed in bacteria, yeast, baculovirus, tissue culture, etc., by conventional methods.
- the genetic construct can be designed to produce a gene fusion or to add C-terminal or N-terminal amino acid residues that would facilitate purification by trapping on columns or use of antibodies.
- Conventional methods for producing variant polypeptides are describe, for example, in Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, ed.
- the gpl20 protein has five loops.
- the V3 loop stimulates production of neutralizing antibodies that bind to HIV-1 , preventing it from infecting cells (Brolinden et al. , Proc. Nat 'I Acad.
- V3 is a variable region
- PND immunodominant neutralizing domain
- V3BP and V3MNP two V3-loop fragment preparations, V3BP and V3MNP, were observed to inhibit binding of RANTES, MlP-l ⁇ , and MIP-l ⁇ .
- V3BP and V3MNP are described by Berzofsky et al., Annals ofN.Y. Acad. of Sci. 754: 161-8 (1995). Accordingly, polypeptides that include a V3 loop of gpl20 are encompassed by the variant gpl20 polypeptides of the present invention.
- V3 loop and residues associated with known immunological responses to V3 are provided, for example, in Moore and Nara, AIDS 1991 5 (suppl. 2):S21-S33 (see, especially FIG. 2).
- Purified V3 and fragments of V3 are commercially available, for example, from Intracell (Cambridge, MA).
- assays for chemokine binding and chemotaxis are provided for identifying inhibitory factors useful as antiinflammatory agents, i.e. , substances that bind to CD4 and have anti-chemotactic effects. Binding assays and assays related to chemotaxis and calcium mobilization are described in the Examples below. Other binding assays and assays related to determination of chemotaxis and calcium mobilization are discussed, for example, in Xu et al., Eur. J. Immunol. 25:2612-2617, 1995.
- chemotaxis e.g., conventional assays for leukocyte infiltration into skin or peritoneal fluid of mice following injection of chemokines, can be used to confirm the antiinflammatory activity of a test substance (see, e.g., Wang et al., Methods: A Companion to Methods in Enzymology 10:135-144, 1996).
- the proteins gpl20 and gp41, and variants thereof interfere with migration of inflammatory cells in vivo and therefore are useful as anti- inflammatory agents.
- These polypeptides are useful, for example, in treating a wide range of autoimmune, allergic, and other acute and chronic inflammatory diseases and conditions in which chemotaxis of CD4 + cells (e.g. , monocytes, eosinophils and T cells) in response to a chemoattractant (e.g., a chemokine) results in migration of the cells to a site of inflammation.
- chemotaxis of CD4 + cells e.g. , monocytes, eosinophils and T cells
- a chemoattractant e.g., a chemokine
- Such inflammatory and autoimmune diseases and conditions include, but are not limited to: multiple sclerosis; rheumatoid arthritis; glomerulonephritis; post-viral myocarditis; atherosclerosis, hypersensitivity reactions (types I-IV, e.g., contact dermatitis, eczema, acute and chronic allergic reactions such as asthma, and autoimmune disease), etc.
- Other inflammatory or autoimmune diseases or conditions that can be treated using the pharmaceutical compositions of the present invention are described, for example, in Harrison, Principles of Internal Medicine (McGraw Hill 1994).
- Pharmaceutical compositions according to the present invention can also be used for immunosuppression, e.g., in the context of organ transplantation.
- Embodiments of the present invention are useful therapeutically, i.e., curing or reducing the severity of a disease or condition, and prophylactically, i.e., reducing or avoiding one or more symptoms of a disease or condition.
- compositions according to the present invention encompass formulations comprising (1) an amount (for example, a unit dosage) of one or more polypeptides according to the present invention together with (2) one or more well-known non- toxic pharmaceutically acceptable excipients, including carriers, diluents, and/or adjuvants, and optionally (3) one or more biologically active ingredients other than gpl20, gp41, or a variant thereof.
- Standard pharmaceutical formulation techniques are used, such as those disclosed in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, PA (latest edition).
- the pharmaceutical composition can be in the form of tablets, capsules, powders, granules, lozenges, liquid or gel preparations, such as oral, topical, or sterile parenteral solutions or suspensions (e.g., eye or ear drops, throat or nasal sprays, etc.), transdermal patches, and other forms known in the art.
- Such pharmaceutical compositions can be administered systemically or locally in any manner appropriate to the treatment of a given condition, including orally, parenterally, rectally, nasally, buccally, vaginally, topically, optically, by inhalation spray, or via an implanted reservoir.
- parenterally includes, but is not limited to subcutaneous, intravenous, intramuscular, intrasternal, intrasynovial, intrafhecal, intrahepatic, intralesional, and intracranial administration, for example, by injection or infusion.
- Parenteral administration e.g., intravenous, intramuscular, etc., is a preferred mode of administration for many inflammatory conditions, since gpl20, gp41, and variants thereof distribute well throughout the body.
- Pharmaceutically acceptable carriers include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins (such as human serum albumin), buffers (such as phosphates), glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, and wool fat, for example.
- Tablets and capsules for oral administration can be in a form suitable for unit dose presentation and can contain conventional pharmaceutically acceptable excipients.
- binding agents such as syrup, acacia, gelatin, sorbitol, tragacanth, and polyvinylpyrrolidone
- fillers such as lactose, sugar, corn starch, calcium phosphate, sorbitol, or glycine
- tableting lubricants such as magnesium stearate, talc, polyethylene glycol, or silica
- disintegrants such as potato starch
- dispersing or wetting agents such as sodium lauryl sulfate.
- the tablets can be coated according to methods well known in normal pharmaceutical practice.
- Oral liquid preparations can be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups or elixirs, or can be presented as a dry product for reconstitution with water or other suitable vehicle before use.
- Such liquid preparations can contain conventional additives such as suspending agents, e.g. , sorbitol, syrup, methyl cellulose, glucose syrup, gelatin, hydrogenated edible fats, emulsifying agents, e.g.
- non-aqueous vehicles including edible oils, e.g., almond oil, fractionated coconut oil, oily esters such as glycerine, propylene glycol, or ethyl alcohol; preservatives such as methyl or propyl p-hydroxybenzoate or sorbic acid, and, if desired, conventional flavoring or coloring agents.
- edible oils e.g., almond oil, fractionated coconut oil, oily esters such as glycerine, propylene glycol, or ethyl alcohol
- preservatives such as methyl or propyl p-hydroxybenzoate or sorbic acid, and, if desired, conventional flavoring or coloring agents.
- compositions according to the present invention can also be administered parenterally in a sterile aqueous or oleaginous medium.
- the composition can be dissolved or suspended in a non-toxic parenterally-acceptable diluent or solvent, e.g., as a solution in 1,3- butanediol.
- Adjuvants such as local anesthetics, preservatives, and buffering agents can also be dissolved in the vehicle.
- Commonly used vehicles and solvents include water, physiological saline, Hank's solution, Ringer's solution, and sterile, fixed oils, including synthetic mono- or di-glycerides, etc.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- oils such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as Ph. Helv or a similar alcohol.
- the drug may be made up into a solution, suspension, cream, lotion, ointment in a suitable aqueous or non-aqueous vehicle.
- Additives may also be included, e.g., buffers such as sodium metabisulphite or disodium edeate; preservatives such as bactericidal and fungicidal agents, including phenyl mercuric acetate or nitrate, benzalkonium chloride or chlorhexidine, and thickening agents, such as hypromellose.
- the dosage unit involved depends, for example, on the condition treated, nature of the formulation, nature of the condition, embodiment of the claimed pharmaceutical compositions, mode of administration, and condition and weight of the patient.
- compositions according to the present invention can be found, for example, in Remington, Pharmaceutical Sciences, Easton, PA: Mack Publishing Co.; The National Formulary, Washington: American Pharmaceutical Association; Goodman and Gilman's, The Pharmacological Basis of Therapeutics, Gilman et al. (eds.), New York: Macmillan; and Munson, Principles of Pharmacology, New York: Chapman and Hall.
- Active ingredients that can be included in pharmaceutical compositions according to the present invention include, but are not limited to, one or more well-known antiinflammatory, immunomodulatory, or immunosuppressive substances such as cyclophosphamides, methotrexate, cyclophosphamide, antimalarials, glucocorticoids (e.g. , hydrocortisone), cyclosporine A, azathioprine, penicillamine, antilymphocyte globulin (ALG), FK506, rapamycin, gold salts, interferons, etc.
- one or more well-known antiinflammatory, immunomodulatory, or immunosuppressive substances such as cyclophosphamides, methotrexate, cyclophosphamide, antimalarials, glucocorticoids (e.g. , hydrocortisone), cyclosporine A, azathioprine, penicillamine, antilymphocyte globulin (ALG), FK506, rapa
- Effective amount is meant the quantity of a composition according to the invention that is sufficient to reduce the chemotactic response of a target cell, e.g., a monocyte or T cell, to a chemokine by a statistically significant degree.
- the amount of the composition is effective to prevent, to cure, or at least reduce one or more symptoms of an inflammatory response, condition or disease, whether acute or chronic. Amounts effective for this use depend on the severity of the disease and the weight and general state of the patient.
- Dosages used in vitro provide useful guidance in the amounts useful for in vivo administration of the pharmaceutical composition, and animal models may be used to determine effective dosages for treatment of particular disorders. See, e.g., Goodman and Gilman, supra, and
- an effective in vivo concentration of peptide F is expected to be in the range of about 0.25 ⁇ g/mL to about 2500 ⁇ g/mL, preferably about 2.5 ⁇ g/mL to about 250 ⁇ g/mL.
- the administered dosage would be calculated to achieve such an effective concentration in blood serum or another body fluid or in a tissue, e.g., at the affected site.
- the dosage can be adjusted by determining the concentration of peptide F or gpl20, for example, in blood serum (or another body fluid or tissue) of a subject by conventional methods.
- compositions and methods of the present invention are useful for treatment of humans or for veterinary purposes, i.e., for treatment of animals, e.g., non-human mammals.
- EXAMPLE 1 HIV Envelope gp!20 Activates CD4 to Desensitize Chemoattractant Receptors on Monocytes
- HIV-1 infection is initiated by high-affinity binding of the virus envelope glycoprotein, gpl20, to CD4, the primary receptor for HIV-1 (Klatzmann et al., Nature 312:767-768, 1984;
- HIV-1 cell-type tropism seems to be dictated by chemokine receptor usage and T-cell line tropic viruses appear to use CXCR4, while monocytotropic viruses primarily use CCR5 as fusion co-receptors.
- C-C chemokine receptors such as CCR2b and CCR3 as their fusion cofactors (Oberlin et al., Nature 382:833-835, 1996; Feng et al, Science 272:872-877, 1996; Deng et al., Nature 381:661-666, 1996; Dragic et al., Nature 381:667-673, 1996; Alkhatib et al., Science 272:1955-
- Dual tropic HIV-1 strains presumably interact with either type of chemokine receptors. Furthermore, both T lymphocytes and monocytes express
- monocyte-macrophages are also targets of the virus infection.
- monocytes from AIDS patients exhibited a significantly compromised capacity to migrate in response to several chemotactic factors, including activated complement component C5a, bacterial peptide fMLP, and undefined lymphocyte-derived chemotactic factors (Smith et al., J. Clin. Invest. 74:2121-2128, 1984).
- Incubation of monocytes with soluble gpl20 has also been reported to suppress the expression of receptors for C5a and fMLP (Wahl et al., J. Immunol. 142:3553-3559, 1989).
- gpl20 which is shed in copious quantities in AIDS patients (Gelderblom et al., Virology 156: 171-176, 1987) may contribute to the anti-inflammatory and immunosuppressive effects of HIV-1 by antagonizing interactions of chemoattractant receptors on monocytes with their ligands.
- Natural gpl20 was isolated from the culture fluid of HIV-1 (MN or RF)-infected H9 cells by immunoaffinity chromatography (Pyle et al., J. Virol. 62:2258-2264, 1988).
- Recombinant gpl20 strain MN and IIIB
- recombinant soluble CD4 were purchased from Intracel (Cambridge, MA). At the highest concentration tested, the gpl20 preparations had ⁇ 0.2 ng/mL of endotoxin activity.
- Monoclonal and anti-CD4 antibodies were purchased from Biogenesis (Poole, United Kingdom).
- clone A6 and E9 were able to stain CD4 on the cell surface and clone E9 was able to block HIV binding, as described by the manufacturer.
- Monoclonal and anti-CD14 antibody (clone K4) was purchased from DAKO Corp. (Carpinteria, CA).
- Recombinant chemokines were from PeproTech (Rocky Hill, NJ). (Recombinant chemokines are also available, for example, from Sigma Immunochemicals [St. Louis, MO] and R&D Systems [Minneapolis, MN]). Radioiodinated chemokines were purchased from Dupont NEN (Boston, MA).
- Human peripheral blood monocytes were isolated from Buffy Coat (NIH Clinical Center, Transfusion Medicine Department, Bethesda, MD) enriched for mononuclear cells by using isosmotic Percoll gradient as described (Xu et al., Eur. J. Immunol. 25:2612-2617, 1995).
- Neutrophils were isolated from Buffy Coat blood with Dextran sedimentation as described (Xu et al. , Eur. J. Immunol. 25:2612-2617, 1995).
- the purity of the cell preparations was examined by morphology and was >90% for monocytes and >98% for neutrophils.
- the CCR3 and CCR5 transfected HEK 293 cells were obtained from Dr. P.
- CCR1 and CXCR4/fusin cDNA were isolated in this laboratory and were transfected into 293 cells as described (Ben-Baruch et al., J. Biol. Chem. 270:22123-22128, 1995).
- CCR2b cDNA was supplied by Dr. I. Charo (University of California at San Francisco, San Francisco, CA) and was stably transfected into 293 cells in this laboratory. The viability of monocytes or HEK293 cells before and after gpl20 treatment was examined by trypan-blue exclusion and was more than 95% after up to 18 hr treatment at 37 °C.
- Binding assays were performed by preincubating duplicate samples of monocytes (2 x lOVsample) or chemokine receptor transfected 293 cells (1 x lOVsample) with different concentrations of gpl20 for 60 min at 37 °C in a volume of 200 ⁇ L/sample of binding medium (RPMI 1640, 1% bovine serum albumin, 5 mM HEPES, and 0.5% sodium azide). 125 I-labeled chemokines (0.12 nM) were then added to each sample. To parallel duplicate samples, different concentrations of gpl20 or unlabeled chemokines (as controls) were added simultaneously with radiolabeled chemokines.
- the percentage reduction of chemokine binding to monocytes by gpl20 treatment was calculated by the formula: (1 cpm associated with cells preincubated with gpl20)/(cpm associated with cells incubated with medium alone) x 100.
- the upper and lower wells were separated by a polycarbonate filter (5 ⁇ m pore size, polyvinylpyrrolidone-free for neutrophils; Nucleopore, Pleasanton, CA).
- a polycarbonate filter 5 ⁇ m pore size, polyvinylpyrrolidone-free for neutrophils; Nucleopore, Pleasanton, CA.
- the filter of 10 ⁇ m pore size was precoated with collagen IV as described (Ben-Baruch et al., J. Biol. Chem. 270:22123-22128, 1995).
- C.I. (Number of migrated cells in response to chemoattractant)/(Number of randomly migrated cells [in response to medium]).
- monocytes (or neutrophils) and HEK 293 cells transfected with chemokine receptors were preincubated with chemoattractants or gpl20 for 30 min or 60 min at 37°C then washed 3x with PBS.
- the cell migration in response to various chemoattractants was assessed and computed as described above.
- the percentage deactivation of chemotaxis to a given chemoattractant was calculated by the formula: [1 - (Migration of cells preincubated with gpl20)/(Migration of cells preincubated with medium)] x 100.
- CXCR4/fusin Internalization of CXCR4/fusin was examined by pretreatment of CD4 + /CXCR4 + HEK 293 cells with gpl20 and anti-CD4 antibody.
- HEK293 cells expressing CXCR4 and intact CD4 were pretreated for 3 hr at 37°C with recombinant gpl20 (MN, 25 nM) or anti-CD4 monoclonal antibody (A6, 5 ⁇ g/mL). The cells were centrifuged onto slides and permeabilized. The slides were then stained with an anti-CXCR4/fusin monoclonal antibody (12G5) followed by incubation with FITC- labeled goat anti-mouse IgG F(ab') 2 fragments.
- MN recombinant gpl20
- A6 anti-CD4 monoclonal antibody
- gpl20 Since preincubation increased the inhibitory effect, and, in addition, since gpl20 was active at relatively low concentrations, these results showed that gpl20 also has desensitizing effects on the receptor(s), in addition to competitive effects. Similarly, gp41 was demonstrated to inhibit binding of RANTES, MlP-l ⁇ and MIP-1 / 3 in a dose-dependent fashion (FIG. 3).
- gpl20 The effect of gpl20 on chemokine binding was further investigated by adding soluble gpl20 purified from HIV (MN) (Pyle et al., J. Virol. 62:2258-2264, 1988) and radiolabeled chemokines simultaneously to human peripheral blood monocytes as described (Xu et al. , Eur. J. Immunol 25:2612-2617, 1995). Monocytes were preincubated in duplicate with medium alone or with different concentrations of purified gpl20 (MN) for 60 min at 37°C. I25 I-labeled chemokines were added and the cultures were incubated for 40 min at room temperature. The cells were then centrifuged through a sucrose cushion and measured for radioactivity.
- FIG. 4 shows one of three representative experiments. While all unlabeled chemokines (60-120 nM) showed significant competition for binding by radiolabeled ligands (FIG. 4, horizontal lines), gpl20 resulted in only a weak or no competition for binding sites with radiolabeled chemokines on monocytes or neutrophils (FIG. 4, hatched bars).
- the IC50 for gpl20 inhibition of monocyte binding for chemokines (0.1, 1.0, and 5.0 nM for MlP-l ⁇ , MIP-1/3, and RANTES, respectively) was similar to that for the native ligands when they were used as direct competitors (0.3, 0.6, and 1.0 nM for MlP-l ⁇ , MIP-1/3, and RANTES, respectively). Consequently, preincubation of monocytes with gpl20 not only markedly inhibited their capacity to bind MIP-1/3, which utilizes exclusively CCR5 (Murphy, Cytokine and Growth Factor Reviews 7:47-64, 1996; Combadiere et al , J. Leuk. Biol.
- CD4 antibodies on monocyte binding of chemokines monocytes were preincubated with recombinant gpl20 (rgpl20) (MN and IIIB) or different concentrations of monoclonal anti-CD4 antibodies for 60 min. at 37°C). 125 I-MIP-1 was added to the cells at room temperature for 40 min. The cells were then pelleted through a sucrose cushion and cell-associated radioactivity was determined. Antibodies from clones A6 and E9 stained CD4 + cells, but only clone E9 blocked HIV binding by HIV-1 (as per Biogenics Poole, UK). Unlabeled MIP-1/3 was used to define the level of maximal direct competition by native ligand.
- HIV-1 gpl20 and CD4/co-receptor-mediated cell fusion were reported to be resistant to pertussis toxin, suggesting that the virus competes for chemokine receptor occupancy without activating G-protein signaling (Cocchi et al, Nature Med. 2:1244-1247, 1996; Oravecz et al., J. Immunol. 157:1329-1332, 1996).
- the need to preincubate monocytes for 1 h with gpl20 in our study suggested that binding of CD4 by gpl20 may result in signal transduction.
- gpl20 is chemotactic for monocytes (Kornfeld et al., Nature 335:445-448, 1988; Cmikshank et al., Biomed. Pharm. 44:5-11, 1990).
- gpl20 is chemotactic for monocytes (Kornfeld et al., Nature 335:445-448, 1988; Cmikshank et al., Biomed. Pharm. 44:5-11, 1990).
- the chemotactic effect of gpl20 purified from a native MN strain was inhibited by neutralizing anti-gpl20 and was also sensitive to pertussis toxin at concentrations that did not affect spontaneous cell migration, suggesting that gpl20 can activate G-proteins.
- the binding of gpl20 with CD4 may compete with chemokines simply by causing conformation changes, resulting in the exposure of an epitope(s) that enables the gpl20 to occupy chemokine receptors (Trkola et al., Nature 384:184-187, 1996; Wu et al., Nature 384:179-183, 1996).
- Preincubation with gpl20 may additionally trigger intracellular signals, such as PKC or arachidonic acid activation (Parada e/ ⁇ /., Cell Immunol. 168:100-106, 1996; Wahl etal, Proc. Natl. Acad. Sci.
- CD4 signals are required to down-regulate the chemoattractant receptors.
- HEK 293 cells to bind MIP-1 / 3 could not be inhibited by preincubation of the cells with gpl20 or anti-CD4 antibody if the cells were expressing CCR5 and CD4 lacking intracytoplasmic tail, whereas the binding capacity of the cells transfected with intact CD4 were inhibited by gpl20 or anti-CD4 antibody (Table 3), even though cells containing tailless or intact CD4 were both >90% positive by anti-CD4 staining and fluorescence-activated cell sorting (FACS) analysis.
- FACS fluorescence-activated cell sorting
- CD4 is an active rather than a passive participant in the down-regulation of chemokine receptor expression by gpl20.
- monocytic cells were incubated at a concentration of 10 7 /mL for 60 min at 37 °C in RPMI 1640 containing 10% FCS and Indo-IAM (2 ⁇ M; Molecular Probes, Eugene, OR). After washing once with medium, the cells were suspended in DPBS with Ca ++ , Mg ++ , and 5 mM glucose. Indo-1 excitation was assessed at 358 nm with detection of bound dye at 402 nm (violet) and free dye at 486 (blue).
- Gpl20 (MN) at 50 nM did not induce significant Ca ++ mobilization in monocytes under our experimental conditions, nor did it attenuate the monocyte response to a subsequent challenge (100 sec after gpl20) by chemokines or fMLP.
- preincubation of monocytes with gpl20 (MN, 50 nM) for 1 h at 37°C almost completely abolished the Ca ++ mobilization in these cells induced by MlP-l ⁇ , RANTES, SDFl ⁇ (12 nM), as well as fMLP (10 nM).
- the Ca ++ mobilization induced by MCP-1 (12 nM) was also significantly reduced by preincubation of monocytes with gpl20 (50 nM) (Ueda et al. , unpublished).
- peptide F (EGSDTITLPCRIKQFINMWQE) has been found to be a potent chemoattractant for monocytes, and its activity was abolished by soluble CD4 (Ueda and Wang, unpublished).
- gpl20 Down-regulation of chemokine receptors by gpl20 may interfere with the initial entry of HIV-1 into CD4 cells, provided sufficient soluble "shed" gpl20 is available to internalize all the receptors. Although in the course of the disease some of the gpl20 detected in the sera of patients may in fact be complexed by anti-g ⁇ l20, it is unlikely that the effect of gpl20 is blocked by anti- gpl20 antibodies, because there are considerable variations in the specificity, amount, and timing of anti-gpl20 antibody production (Moore et al. , J. Virol. 68:5142-5155, 1994; Moore and Jarrett, AIDS Res. Hum. Retroviruses 4:369-379, 1988).
- gpl20 that is not associated with virion can be detected on the surface of explanted CD4 T cells from patients (Sunila et al., AIDS 11:27-32, 1997).
- tissues such as lymphatic organs
- the dense packing of cells could facilitate high affinity gpl20-CD4 interaction even in the presence of excess circulating blocking antibodies (Mittler and Hoffmann, Science 245:1380- 1382, 1989; Cmikshank et al., Biomed. Pharmacother. 44:5-11, 1990), which may not block the binding of gpl20 to CD4.
- HIV-1 may be using envelope proteins such as gpl20 to "disarm" the inflammatory host defense processes. Such a mechanism would have profound implications for the pathogenesis of HlV-induced disease.
- Our observations also provide a mechanistic basis for the phenomenon of viral interference (Volsky et al., J. Virol. 6:3823-3833, 1996; Arya and Gallo, Proc. Natl. Acad. Sci. USA 93:4486-4491, 1996), since interaction of gpl20 with CD4 can potentially make cells refractory to subsequent invasion by additional viruses by a general down-regulation of co-receptors.
- a Monocytes were preincubated with medium alone or rgpl20 (MN, lOnM) w/wo sCD4 for 60 min. at 37°C, and their capacity to bind C-C chemokines assessed.
- the binding data were analyzed using the Macintosh program LIGAND, and the results shown are representative of three experiments performed.
- rgpl20 was preincubated with molar concentrations of sCD4 at a ratio of 1:25 for 30 rah. and the mixture was then added to the monocyte cultures.
- c P ⁇ 0.05 (Student t test) compared to cells incubated with medium alone.
- gpl20 was preincubated in the presence or absence of sCD4 for 30 min. at 37°C, then was further incubated with monocytes for 60 min. at 37°C. After washing, the cell migration in response to C-C chemokines (lOnM) SDFl ⁇ (100 nM) or fMLP (lOnM) was determined. The results represent a summary of five experiments performed.
- b P ⁇ 0.05 (Student t test) compared to the migration of monocytes preincubated with medium alone.
- the cells were washed and were cultured for 10 h at 37°C in DMEM containing 400 ⁇ g/ml, 10% FCS and antibiotics. The cells were then gently detached with trypsin/EDTA, resuspended in binding medium, aliquoted, and incubated for 10 h in the presence or absence of gpl20 or anti-CD4 mAb. Binding assays utilizing 125 I-MIP-l ⁇ were performed at room temperature for 40 min. Both VCB2 and VCB7 infected CCR5/293 cells were more than 90% CD4+ as assessed by FACS analysis (not shown).
- a Monocytes were incubated with medium alone or recombinant gpl20 (MN, 25 nM) for 60 min at 37°C. After washing, duplicate aliquots of the cells were incubated with 0.12 nM radioiodinated MlP-l ⁇ in the presence of increasing concentrations of unlabeled ligand. The samples were cultured at room temperature for 40 min then were harvested and measured for radioactivity. The data was analyzed with LIGAND program. Results obtained with cells from 6 donors are shown.
- b Cells were first preincubated with Staurosporine (1 ng/ml) for 15 min at 37°C followed by treatment with gpl20.
- c Significant reduction of MlP-l ⁇ binding sites on monocytes treated with gpl20 (p ⁇ 0.05, Student's t test).
- HIV-1 envelope protein gp41 plays a critical role in viral fusion and infection. After binding of gpl20 to CD4 and subsequently to chemokine receptors, HIV-1 uses gp41 to fuse with and penetrate the target cell membrane, which leads to the injection of the viral genome into the target cell. In order to clarify whether HIV-1 may use gp41 in addition to gpl20 to subvert the host immune response, we examined the affect of gp41 on monocyte binding and chemotactic response to chemokines.
- Gp41 did not directly compete with C-C chemokines for binding sites on monocytes (FIGS. 6A-E, hatched bars). However, monocytes preincubated with gp41 for 60 min at 37°C showed remarkably reduced binding for a number of C-C chemokines, including MIP-l ⁇ , MIP-1/3, RANTES, MCP-1, and MCP-3 (FIGS. 6A-E, shaded bars). The ability of neutrophils to bind the C-X-C chemokine IL-8 was not inhibited by preincubation of the cells with g ⁇ 41 (FIG. 6F).
- Fluorescence-activated cell sorting (FACS) analyses performed on human monocytes showed that the expression of CCR5 on monocytes was down-regulated by preincubation of the cells with gp41 (FIG. 7 A, C).
- the degree of CCR5 down-regulation by gp41 was comparable to down- regulation by the CCR5 ligand MIP-1 jS and an anti-CD4 monoclonal antibody (FIG. 7B, D), whereas an anti-CD14 monoclonal antibody did not show any effect (FIG. 7F).
- PMA a potent protein kinase C activator, also down-regulated cell surface expression of CCR5 (FIG. 7E).
- soluble CD4 sCD4
- MN monocyte chemotaxis
- Recombinant gp41 0.5 nM was preincubated in the presence or absence of sCD4 (10 nM) for 30 min at 37 °C then further incubated with monocytes for 60 min at 37 °C. After washing, the cell migration in response to chemokines (10 nM) or fMLP (10 nM) was determined. Gp41 was not chemotactic for monocytes and did not induce Ca ++ flux in monocytes.
- monocytes after incubation with gp41, monocytes showed remarkably reduced chemotactic response (Table 5) and Ca ++ flux induced by C-C chemokines and bacterial peptide fMLP.
- the inhibition of monocyte chemotactic response by gp41 to chemoattractants apparently required the presence of cellular CD4, because pretreatment of gp41 with a soluble CD4 reduced the effect of gp41 on monocytes (Table 5).
- gp41 did not inhibit the chemotactic response of CD4 " neutrophils to the C-X-C chemokine IL-8 and fMLP.
- confocal microscopy showed that gp41 induced internalization of CXCR4/fusin in HEK 293 cells that co-express CD4 but not in HEK cells expressing only CXCR4/fusin.
- CCR5/293 cells were infected with control vaccinia virus or recombinant vaccinia virus encoding tail-less CD4 (VCB2) or intact CD4 (VCB7) at 37 °C for 1 hr at a multiplicity of infection (MOI) of 5 in DMEM containing 400 ⁇ g/mL, 10% FCS and antibiotics.
- MOI multiplicity of infection
- the cells were then gently detached with trypsin/EDTA, resuspended in binding medium, aliquoted, and incubated for 10 hr in the presence or absence of gp41 or anti-CD4 monoclonal antibody.
- Binding assays utilizing 125 I-MIP-l/3 were performed at room temperature for 40 min. Both VCB2 and VCB7 infected CCR5/293 were more than 90% CD4 + as assessed by FACS analysis.
- the cells were preincubated with medium and binding was performed in the presence of 120 nM unlabeled MIP-1 3.
- CD4 The requirement of signaling mediated by CD4 was suggested by the observation that the binding capacity for MIP-1/3 of HEK 293 cells was inhibited by gp41 only when the cells expressed both CCR5 and a CD4 molecule with the cytoplasmic domain but not a tail-less CD4 molecule, that is, CD4 lacking the cytoplasmic domain (Table 6).
- CCR5/293 cells were transfected with CD4 and were preincubated for 10 hr with gp41 (MN) or anti-CD4 antibodies at 37°C.
- MN gp41
- anti-CD4 antibodies at 37°C.
- the migration of HEK 293 cells induced by MIP-1/3 was also inhibited by gp41 when the cells expressed both CCR5 and an intact CD4 (Table 7).
- gp41 is a potent inhibitor of monocyte binding and function in response to chemoattractants.
- the effect of gp41 on monocytes requires the presence of CD4, which may activate protein kinases, resulting in the down-regulation of receptors for chemoattractants, including those chemokine receptors used by HIV-1 as fusion cofactors.
- CD4 may activate protein kinases, resulting in the down-regulation of receptors for chemoattractants, including those chemokine receptors used by HIV-1 as fusion cofactors.
- gp41 may also contribute to the phenomenon of viral interference and provide a means by which HIV-1 disarms host defenses by inhibiting the capacity of monocytes to migrate to inflammatory sites.
- gpl20 MN strain
- CEM-SS cells (1 x 10 6 ) in 0.5 % FBS-RPMI were incubated with herbimycin A (0, 0.1 , 1.5, or 2.0 ⁇ M) for 18 hr at 37°C. After incubation with herbimycin A, the cells were incubated with gpl20-MN (1 x 10 6 cells/tube/200 ⁇ L, 50 nM gpl20-MN, 37°C for 60 min) and then tested for binding of SDF-l ⁇ .
- Gpl20 did not directly compete with C-X-C chemokine SDF-1 for binding on CEM or blood CD4 + T cells. After incubation of the cells with gpl20, the binding of SDF-l ⁇ was significantly reduced (FIG. 8). This down-regulation of SDF-1 a binding on T cells by gpl20 apparently requires signaling, since T cells pretreated with herbimycin A, a protein tyrosine kinase inhibitor, completely retained their capacity to bind SDF-l ⁇ (FIG. 8). These results suggest that gpl20 was able to down-regulate CXCR4/fusin expression on T cells through a mechanism that involves the activation of tyrosine kinase(s). Thus, like its effect on monocytes, gpl20 may also inhibit the T cell response to chemokines by down- regulating chemokine receptor expression on cell surfaces.
- Recombinant gp41 (0.5 nM) was preincubated in the presence or absence of sCD4 (10 nM) for 30 min. at 37°C, (hen was further incubated with monocytes for 60 min. at 37°C. After washing, the cell migration in response to chemokines ( 10 nM),or fMLP (10 nM) was determined.
- CCR5/293 cells were infected with control vaccinia virus, or recombinant vaccinia virus encoding tailless CD4 (VCB2) or intact CD4 (VCB7) at 37°C for Ih, at multiplicity of infection of 5 in DMEM containing 2% FCS and antibiotics.
- the cells were ⁇ vashed and were cultured for 10 h at 37°C in DMEM containing 400 ⁇ g/ml, 10% FCS and antibiotics. The cells were then gently detached with trypsin/EDTA. resuspended in binding medium, aliquoted, and incubated for 10 h in the presence or absence of gp41 or anti-CD4 mAb. Binding assays utilizing
- CCR5/293 cells were transfected with CD4 and were preincubated for 10 h with gp41(MN) or anti-CD4 antibodies at 37°C. Cell migration in response to MlP- l ⁇ was then evaluated. b c
- Monocytes were incubated with medium alone or recombinanl gp41 (MN, 5 nM) for 60 min. at 37°C. After washing, duplicate aliquots of the cells were incubated with 0.12 nM radioiodinated MIP-1 b in the presence of increasing concentrations of unlabeled ligand. The samples were cultured at room temperature for 40 min. then were harvested and measured for radioactivity. The data was analyzed with LIGAND program. Results are from r ⁇ prejentive experiments oul of 12 performed.
- EXAMPLE 4 A gp!20 Peptide that Includes the CD4 Binding Domain Inhibits Chemoattractant Receptors on Monocytes
- peptide F 20 amino acid peptide corresponding to the CD4 binding region of gpl20. This peptide (g ⁇ l20 MN aa 414-434, designated peptide F) was found to be a potent chemoattractant for human monocytes and T lymphocytes. It is also moderately chemotactic for human neutrophils at high concentration. Preincubation of monocytes with peptide
- Peptide F inhibits monocyte chemotaxis in response to chemokines and fMLP
- Pir.incubalioii : ⁇ l 37"(. ' for 60 min.
- Chcmoatraccmi.s Medium SP120 fP-l ⁇ FMLP (414-434)
- Results are expressed as Chemotaxis Index ⁇ srandard error of migra t ion.
Abstract
La présente invention a pour objet des polypeptides liant des cellules CD4, y compris les protéines de coque VIH-1 gp120 et gp41, réduisant la migration de cellules CD4+ telles que des monocytes et des cellules T en réponse à des chémo-attractifs, y compris des chémokines C-C, SDF-1α et fMLP. Ces polypeptides sont utiles dans le traitement d'états ou de maladies inflammatoires.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU42511/97A AU4251197A (en) | 1996-09-06 | 1997-09-05 | Therapeutic chemokine antagonists |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US2470896P | 1996-09-06 | 1996-09-06 | |
US60/024,708 | 1996-09-06 |
Publications (3)
Publication Number | Publication Date |
---|---|
WO1998009642A2 WO1998009642A2 (fr) | 1998-03-12 |
WO1998009642A3 WO1998009642A3 (fr) | 1998-07-09 |
WO1998009642A9 true WO1998009642A9 (fr) | 1998-08-13 |
Family
ID=21821982
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1997/015594 WO1998009642A2 (fr) | 1996-09-06 | 1997-09-05 | Antagonistes de chemokines therapeutiques |
Country Status (2)
Country | Link |
---|---|
AU (1) | AU4251197A (fr) |
WO (1) | WO1998009642A2 (fr) |
Families Citing this family (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2245224A1 (fr) | 1998-08-14 | 2000-02-14 | Jiang-Hong Giong | Antagonistes du recepteur de la chimiokine et chimiotherapie |
WO2000009152A1 (fr) * | 1998-08-14 | 2000-02-24 | The University Of British Columbia | Antagonistes therapeutiques du recepteur de la chimiokine |
WO1999047158A2 (fr) * | 1998-03-13 | 1999-09-23 | The University Of British Columbia | Antagonistes therapeutiques du recepteur de chemokine |
CA2305787A1 (fr) | 2000-05-09 | 2001-11-09 | The University Of British Columbia | Traitement antagoniste cxcr4 de cellules hematopoietiques |
EP1066047A4 (fr) * | 1998-03-25 | 2004-10-13 | Mayo Foundation For Medicaledu | Procedes et substances de traitement des maladies inflammatoires |
EP1100527A2 (fr) | 1998-06-01 | 2001-05-23 | University Of Maryland Biotechnology Institute | Complexes d'antagonistes a ligand pour recepteur et leur application dans le traitement ou la prophylaxie de maladies declenchees par un recepteur |
AU4696899A (en) * | 1998-06-19 | 2000-01-05 | General Hospital Corporation, The | Modulating platelet function |
WO2000044365A1 (fr) * | 1999-01-29 | 2000-08-03 | Millennium Pharmaceuticals, Inc. | Methodes de prevention des rejets de greffes et des lesions par ischemie/reperfusion |
US6448054B1 (en) | 1999-04-08 | 2002-09-10 | The General Hospital Corporation | Purposeful movement of human migratory cells away from an agent source |
US20050059584A1 (en) | 2002-08-16 | 2005-03-17 | Ahmed Merzouk | Novel chemokine mimetics synthesis and their use |
US7378098B2 (en) | 2000-04-12 | 2008-05-27 | The University Of British Columbia | CXC chemokine receptor 4 agonist peptides |
US7368425B2 (en) | 2006-03-24 | 2008-05-06 | Chemokine Therapeutics Corp. | Cyclic peptides for modulating growth of neo-vessels and their use in therapeutic angiogenesis |
WO2006137934A2 (fr) | 2004-11-05 | 2006-12-28 | The General Hospital Corporation | Eloignement volontaire de cellules migratoires humaines d'une source d'agents |
EP1674077A1 (fr) * | 2004-12-27 | 2006-06-28 | Université de Liège | Formulation muco-adhésive refermant des chemokine |
CA3044526A1 (fr) | 2016-12-07 | 2018-06-14 | Progenity, Inc. | Methodes, dispositifs et systemes de detection pour le tractus gastro-intestinal |
CA3045310A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity, Inc. | Traitement d'une maladie du tractus gastro-intestinal avec une chimoikine/un inhibiteur du recepteur de chimiokine |
EP3883636A1 (fr) | 2018-11-19 | 2021-09-29 | Progenity, Inc. | Dispositif ingérable pour administrer un agent thérapeutique au tube digestif |
EP4309722A2 (fr) | 2019-12-13 | 2024-01-24 | Biora Therapeutics, Inc. | Dispositif ingérable pour l'administration d'un agent thérapeutique au tractus gastro-intestinal |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU6515394A (en) * | 1993-04-16 | 1994-11-08 | Syntello Vaccine Development Ab | Peptides for use in vaccination and induction of neutralizing antibodies against human immunodeficiency virus |
US5464933A (en) * | 1993-06-07 | 1995-11-07 | Duke University | Synthetic peptide inhibitors of HIV transmission |
-
1997
- 1997-09-05 AU AU42511/97A patent/AU4251197A/en not_active Abandoned
- 1997-09-05 WO PCT/US1997/015594 patent/WO1998009642A2/fr active Application Filing
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO1998009642A9 (fr) | Antagonistes de chemokines therapeutiques | |
WO1998009642A2 (fr) | Antagonistes de chemokines therapeutiques | |
De Clercq | Potential clinical applications of the CXCR4 antagonist bicyclam AMD3100 | |
Princen et al. | HIV chemokine receptor inhibitors as novel anti-HIV drugs | |
CA2245224A1 (fr) | Antagonistes du recepteur de la chimiokine et chimiotherapie | |
Agrawal et al. | Anti-HIV therapy: Current and future directions | |
Wells et al. | Chemokine receptors—the new frontier for AIDS research | |
Wang et al. | HIV-1 envelope gp120 inhibits the monocyte response to chemokines through CD4 signal-dependent chemokine receptor down-regulation | |
US20120213790A1 (en) | Methods of treatment using il-16 antagonist peptides | |
MX2007016573A (es) | Vacunas y peptidos terapeuticos. | |
Ruff et al. | Peptide T inhibits HIV-1 infection mediated by the chemokine receptor-5 (CCR5) | |
Redwine et al. | Peptide T blocks GP120/CCR5 chemokine receptor-mediated chemotaxis | |
AU781780B2 (en) | Chemokine receptor CCR3 antagonists | |
US20030220482A1 (en) | Novel peptide antagonist of CXCR4 derived from the N-terminus of the viral chemokine vMIP-II | |
De Clercq | The emerging role of fusion inhibitors in HIV infection | |
Luo et al. | The role of positively charged residues in CXCR4 recognition probed with synthetic peptides | |
RU2290197C2 (ru) | Фармацевтическое средство для лечения вич-инфекции, содержащая его композиция и способы его применения | |
Huang et al. | Potential drug targets on the HIV-1 envelope glycoproteins, gp120 and gp41 | |
US20040116653A1 (en) | Compositions containing anti-HIV peptides and methods for use | |
RU2126266C1 (ru) | Способ ингибирования ретровирусной инфекции (варианты), ингибитор протеазы, кодирующая его нуклеиновая кислота и способ рекомбинантного продуцирования серинового ингибитора | |
Heveker | Chemokine receptors as anti-retroviral targets | |
Su et al. | Inhibition of the expression and function of chemokine receptors on human CD4+ leukocytes by HIV-1 envelope protein gp120 | |
Redshaw et al. | Fusion/entry inhibitors as therapies for HIV | |
Spisani et al. | Chemotactic response of human monocytes to pentapeptide analog derived from immunodeficiency virus protein gp 120 | |
Rusconi et al. | Entry and fusion inhibitors of HIV |