ANTIMICROBIAL AGENTS, DIAGNOSTIC REAGENTS, AND VACCINES BASED ON UNIQUE APICOMPLEXAN PARASITE COMPONENTS
The U.S. government may have rights in this patent by means of partial support under: NIH NIAID TMP R01 Al 16945; NIH NIATD TMP R01 Al 27530.
This invention relates uses of components of plant-like metabolic pathways not including psbA or PPi phosphofructokinase and not generally operative in animals or encoded by the plastid DNA, to develop compositions that interfere with Apicomplexan
growth and survival. Components of the pathways include enzymes, transit peptides
and nucleotide sequences encoding the enzymes and peptides, or promoters of these nucleotide sequences to which antibodies, antisense molecules and other inhibitors are directed. Diagnostic and therapeutic reagents and vaccines are developed based on the
components and their inhibitors.
BACKGROUND Apicomplexan parasites cause the serious diseases malaria, toxoplasmosis,
cryptosporidiosis, and eimeriosis. Malaria kills more than 2 million children each year. Toxoplasmosis is the major opportunistic brain infection in AIDS patients, causes loss
of life, sight, hearing, cognitive and motor function in congenitally infected infants, and considerable morbidity and mortality in patients immunocompromised by cancer,
transplantation, autoimmune disease and their attendant therapies. Cryptosporidiosis is
an untreatable cause of diarrhea in ADDS patients and a cause of epidemics of
gastrointestinal disease in immunocompetent hosts Eimeria infections of poultry lead to billions of dollars in losses to agricultural industries each year Other Apicomplexan
infections, such as babesiosis, also cause substantial morbidity and mortality Although
there are some methods for diagnosis and treatment of Apicomplexan caused diseases, these are ineffective and often toxic to the subject being treated
The tests available to diagnose Apicomplexan infections include assays which isolate the parasite, or utilize light, phase, or fluorescence microscopy, ELISAs,
agglutination of parasites or parasite components to detect antibodies to parasites, or polymerase chain reaction (PCR) to detect a parasite gene Most of the assays utilize whole organisms or extracts of whole organisms rather than recombinant proteins or
purified parasite components In many instances, the available assays have limited
ability to differentiate whether an infection was acquired remotely or recently, and are limited in their capacity to diagnose infection at the outpatient or field setting
The primary antimicrobial agents used to treat toxoplasmosis are
pyrimethamine (a DHFR inhibitor) and sulfadiazine (a PABA antagonist) The use of
pyrimethamine is limited by bone marrow toxicity which can be partially corrected by the concomitant administration of folinic acid. T. gondu cannot utilize folinic acid but
mammalian cells can. Another problem is that pyrimethamine is potentially teratogenic
in the first trimester of pregnancy The use of sulfonamides is limited by allergy,
gastrointestinal intolerance, kidney stone formation and Stevens-Johnson syndrome
There are a small number of antimicrobial agents utilized less frequently to treat toxoplasmosis. These include clindamycin, spiramycin, azithromycin, clarithromycin and atovaquone. Usefulness of these medicines for treatment of toxoplasmosis is limited by toxicities including allergy and antibiotic-associated diarrhea, (especially
Clostridium difficile toxin associated colitis with clindamycin use). Lesser or uncertain efficacy of macrolides such as spiramycin, azithromycin, and clarithromycin also limits use of these antimicrobial agents. Atovaquone treatment of toxoplasmosis
may be associated with lack of efficacy and/or recrudescent disease. There are no
medicines known to eradicate the latent, bradyzoite stage of T. gondii, which is very important in the pathogenesis of toxoplasmosis in immunocompromised individuals or
those with recurrent eye disease.
Medicines used to treat malaria include quinine sulfate, pyrimethamine,
sulfadoxine, tetracycline, clindamycin, chloroquine, mefloquine, halofantrine, quinidine gluconate, quinidine dihydrochloride, quinine, primaquine and proguanil. Emergence of resistance to these medicines and treatment failures due to resistant parasites pose
major problems in the care of patients with malaria. Toxicities of mefloquine include nausea, vomiting, diarrhea, dizziness, disturbed sense of balance, toxic psychosis and
seizures. Melfoquine is teratogenic in animals. With halofantrene treatment, there is consistent, dose-related lengthening of the PR and Qt intervals in the
electrocardiogram. Halofantrene has caused first degree heart block. It cannot be used for patients with cardiac conduction defects. Quinidine gluconate or dihydrochloride also can be hazardous. Parenteral quinine may lead to severe
hypoglycemia. Primaquine can cause hemolytic anemia, especially in patients whose
red blood cells are deficient in glucose 6-phosphate dehydrogenase Unfortunately,
there are no medicines known to be effective in the treatment of cryptosporidiosis
To more effectively treat Apicomplexan infections, there is an urgent need for discovery and development of new antimicrobial agents which are less toxic than those currently available, have novel modes of action to treat drug resistant parasites that
have been selected by exposure to existing medicines, and which are effective against presently untreatable parasite life cycle stages (e g , Toxoplasma gondu bradyzoites)
and presently untreatable Apicomplexan parasites (e g , Cryptosporidiu parvum) Improved diagnostic reagents and vaccines to prevent these infections are also needed
Information available on Apicomplexan parasites has not yet provided keys to solutions to health problems associated with the parasites Analogies to other organisms could provide valuable insights into the operations of the parasite There
are reports of Apicomplexan parasites having plastids, as well as the nuclear encoded
proteins, tubulin, calmodulin, PPi phosphofructokinase and enolase, which are reported to be similar in part to, or homologous with, counterparts in plant-like, lower life forms and higher plants There are reports of a plastid genome and components of a protein
synthetic system in a plastid-like organelle of Apicomplexans Plasmodium and
T. gondu plastid DNA sequences were reported to have homologies to algal plastid DNA sequences The plastid membrane of T. gondu was reported to be composed of
multiple membranes that appear morphologically similar to those of plant/algal
chloroplasts, except for the presence of two additional membranes in the T. gondu
plastid, suggesting that it may have been an ancient algal endosymbiont Some of these Apicomplexan proteins such as tubulin, calmodulin and enolase with certain plant-like
features also are found in animals, and therefore may appear in the host as well as the parasite. A homologue to a gene, psbA encoding a plant protein important for
photosynthesis, also was said to be present in Apicomplexans.
Certain herbicides have been reported to inhibit the growth of Apicomplexans.
The herbicides which affect growth of Apicomplexans are known to affect plant microtubules or a plant photosynthetic protein. In addition, a compound, salicylhydroxamic acid, (SHAM), had been found to inhibit Plasmodium falciparum
(malaria) and Babesia microti.
Techniques of medicinal chemistry and rational drug design are developed sufficiently to optimize rational construction of medicines and their delivery to sites where Apicomplexan infections occur, but such strategies have not yet resulted in
medicines effective against Apicomplexans. Rational development of antimicrobial agents has been based on modified or alternative substrate competition, product competition, change in enzyme secondary structure, and direct interference with
enzyme transport, or active site. Antisense, ribozomes , catalytic antibodies, disruption
of cellular processes using targeting sequences, and conjugation of cell molecules to toxic molecules are newly discovered strategies employed to interrupt cellular functions and can be utilized to rationally develop novel antimicrobial compounds, but
they have not yet been utilized to design medicines effective against Apicomplexans.
Reagents to diagnose Apicomplexan parasite infections have been developed targeting components of Apicomplexans or immune responses to the parasites, using
ELISA, western blot, and PCR technologies, but improved diagnostic reagents, especially those that establish duration of infection or that can be used in outpatient
settings are needed to diagnose Apicomplexan infections No vaccines to prevent
Apicomplexan infections are available for humans and only a live vaccine prepared for prevention of toxoplasmosis in sheep is available for livestock
To summarize, Apicomplexan parasites cause substantial morbidity and
mortality, and treatments against the parasites are suboptimal or non-existent
Improved antimicrobial compounds that attack Apicomplexan parasites are needed Because the diseases Apicomplexan parasites cause in some instances are due to recrudescence of latent parasites, an especially pressing clinical problem is that there are
no effective antimicrobial agents effective for treatment of these latent parasite life cycle
stages, especially in sequestered sites such as the brain or eye New approaches and drug targets are required Better in vitro and in vivo assays for candidate compounds are also needed Better diagnostic and therapeutic methods, reagents and vaccines to prevent these infections are needed
SUMMARY OF THE INVENTION
This invention relates uses of components of plant-like metabolic pathways (not
usually associated with animals, not encoded in the plastid genome, and not including
psbA or PPi phosphofructokinase) to develop compositions that interfere with Apicomplexan growth and survival Components of the pathways include enzymes,
transit peptides and nucleotide sequences encoding the enzymes and peptides, or
promoters of these nucleotide sequences, to which antibodies, antisense molecules and
other inhibitors are directed Diagnostic and therapeutic reagents and vaccines are
developed based on the components and their inhibitors Attenuation of live parasites
through disruption of any of these components provides vaccines protective against Apicomplexans.
Transit peptides are used to identify other proteins and their organelle targeting sequences that enter and exit from unique Apicomplexan organelles. The identified components are potential for production of medicines, reagents and assays, and
vaccines. The protein which includes the transit peptide is not necessarily an enzyme in
a biochemical pathway.
The methods and compositions of the present invention arise from the
inventors' discovery that metabolic pathways, and targeting signals similar to those
found in plants and algae, especially, but not exclusively those encoded within the
nucleus, are present in Apicomplexan parasites. These plant-like pathways in Apicomplexan parasites are targetable by inhibitors, as measured by determining whether the inhibitors, either singly or in combination, are effective in inhibiting or
killing Apicomplexan parasites in vitro and/or in vivo.
The present invention includes new methods and compositions to treat,
diagnose and prevent human and veterinary disease due to Apicomplexan infections. The invention is based on applications and manipulations of components of algal and higher plant-like metabolic pathways discovered in Apicomplexan parasites. "Plant¬
like" means that products of the pathways, enzymes and nucleotide sequences encoding enzymes in the pathways, are homologous or similar to products, enzymes and
nucleotide sequences known in plants, wherein plants include algae. As used herein,
"plant-like" excludes metabolic pathways generally operative in animals and pathways involving psbA or phosphofructokinase and those encoded by the plastid genome The
limits of a "pathway" are defined as they are generally known to those of skill in the art Methods to detect plant counterparts in Apicomplexan include, a) immunoassays using antibodies directed to products and enzymes known in plants, b) hybridization assays
using nucleotide probes that hybridize to specific sequences in plants; c) determining
homologies of Apicomplexan nucleotide or protein sequences with plant nucleotide or protein sequences, and/or d) substrate tests for specific enzymatic activity The "plant-like" pathways of the present invention are identified by
a) identification of metabolic pathways characteristic of plants but not generally
present in animals, b) identification and characterization of Apicomplexan enzymes, nucleic acids
and transit sequences as components similar or homologous to those in a),
c) identification and development of compounds (inhibitors) which abrogate the effect of the components of the pathways in vitro and in vivo, singly or in a plurality, against one or more types of Apicomplexan parasites and in conjoint Apicomplexan,
bacterial and fungal infections
The identified pathways are then used for a) rational design of compounds more active than the known compounds (inhibitors), with good absoφtion following oral administration, with appropriate tissue
distribution and without toxicity or carcinogenicity;
b) testing of such rationally designed compounds alone and together for safety, efficacy and appropriate absoφtion and tissue distribution in vitro and in vivo.
c) development and testing of diagnostic reagents and assays,
d) development and testing of live attenuated and component based vaccines By locating new targets in Apicomplexan pathways, doors now are open for
development of more effective antimicrobial agents to treat Apicomplexan parasites in humans and agricultural animals In addition, enzymes in these plant-like pathways
provide improved diagnostic tests for diseases caused by Apicomplexans Vaccines
against infectious diseases caused by Apicomplexan parasites are derived from the
novel compositions of the invention.
A method for inhibiting an Apicomplexan parasite, includes selecting the metabolic pathway of the present invention and interfering with the operation of the
pathway in the parasite The Apicomplexan parasite is preferably selected from the
group that includes Toxoplasma, Plasmodium, Cryptosporidia, Eimeria, Babesia and Theileria The pathway may utilize a component encoded by an Apicomplexan nuclear
gene
Suitable metabolic pathways or components include a) synthesis of heme from glutamate and tRNA glu by the plant-like, heme synthesis (5 carbon) pathway (hereinafter the "heme synthesis pathway"), b) synthesis of C4 acids (succinate) by the breakdown of lipids into fatty acids
and then acetyl CoA, and their use in the glyoxylate cycle (hereinafter the "glyoxylate cycle"),
c) synthesis of chorismate from phosphoenolpyruvate and erythrose 4
phosphate by the shikimate pathway (hereinafter the "shikimate pathway"),
d) synthesis of tetrahydrofolate from chorismate by the shikimate pathway,
e) synthesis of ubiquinone from chorismate by the shikimate pathway; f) electron transport through the alternative pathway with use of the alternative oxidase (hereinafter the "alternative oxidase pathway");
g) transport of proteins into or out of organelles through the use of transit
sequences; h) synthesis of aromatic amino acids (phenylalanine, tyrosine and tryptophan) from chorismate by the shikimate pathway;
i) synthesis of the menaquinone, enterobactin and vitamin Kl from chorismate by the shikimate pathway; j) synthesis of the branched chain amino acids (valine, leucine and isoleucine) from pyruvate and ketobutyrate by the plant-like branched chain amino acid
synthesis pathway; k) synthesis of the "essential" (i.e., not synthesized by animals) amino acids,
histidine, threonine, lysine and methionine by the use of plant-like amino acid synthases;
1) synthesis of linoleneic and linoleic acid; m) synthesis of amylose and amylopectin with starch synthases and Q
(branching) enzymes and their degradation; n) synthesis of auxin growth regulators from indoleacetic acid derived from
chorismate; o) synthesis of isoprenoids (diteφenes, 5 carbon units with some properties of
lipids) such as giberellins and abscidic acid by the mevalonic acid to
giberellin pathway.
The interfering compositions are selected from the group consisting of enzyme inhibitors including competitors, inhibitors and competitive or toxic analogues of
substrates, transition state analogues, and products, antibodies to components of the pathways; toxin conjugated antibodies or components of the pathways; antisense molecules, and inhibitors of transit peptides in an enzyme In particular, the interfering
compositions include gabaculine, 3-NPA, SHAM, 8-OH-quinoline, NPMG
Interfering with the operation of the metabolic pathway is also accomplished by introducing a plurality of compositions to the pathway, wherein each of the compositions singly interferes with the operation of the metabolic pathway In certain
instances, the plurality of compositions inhibits the parasite to a degree greater than the
sum of the compositions used singly, that is, exhibits a synergistic effect Embodiments of a plurality of compositions include gabaculine and sulfadiazine,
NPMG and sulfadiazine; SHAM and gabaculine; NPMG and pyrimethamine, NPMG
and cycloguanil (which inhibits Apicomplexan DHFR [TS]), and other inhibitors and
competitors of interrelated cascades of plant-like enzymes Wherein the effect of inhibitors together is greater than the sum of the effects of each alone, the synergistic combination retards the selection of emergence of resistant organisms and is more
effective than the individual components alone
In various embodiments, the interfering composition acts on a latent bradyzoite
form of the parasite, or multiple infecting Apicomplexan parasites simultaneously, or on conjoint infections with other pathogenic microorganisms which also utilize the
plant-like metabolic pathway
A method of determining the effectiveness of a composition in reducing the deleterious effects of an Apicomplexan in an animal, include: a) identifying a composition that inhibits growth or survival of an Apicomplexan parasite in vitro by
interfering with a plant-like metabolic pathway and b) determining a concentration of
the composition in an animal model that is non-toxic and effective in reducing the survival of the parasite in the animal host and/or the deleterious effects of the parasite
in the animal.
Developing a lead compound that inhibits an Apicomplexan parasite is
accomplished by a) identifying a plant-like metabolic pathway in an Apicomplexan parasite and b) identifying a composition that interferes with the operation of the pathway as a lead compound.
A composition which inhibits a specific life cycle stage of an Apicomplexan parasite by interfering with a plant-like metabolic pathway that utilizes a component encoded by a nuclear gene includes gabaculine; a composition including an enzyme in a
metabolic pathway in an Apicomplexan parasite that is selectively operative in a life-
cycle stage of the parasite includes the enzymes alternative oxidase, and UDP glucose starch glycosyl transferase. A composition comprising SHAM and 8-OH-quinoline
inhibits the alternative oxidase in the latent bradyzoite form of an Apicomplexan
parasite. A method to identify a plant-like gene encoding a component of a plant-like metabolic pathway in an Apicomplexan parasite is a) obtaining a strain of E. coli that is deficient for a component of the metabolic pathway, said deficiency causing the strain
to require supplemented media for growth; b) complementing the E. coli with a gene
or portion of the gene encoding a component of the metabolic pathway in the
Apicomplexan parasite; and c) determining whether the complemented E. coli is able
to grow in unsupplemented media, to identify the gene.
Another method for identifying a plant-like gene product of a metabolic pathway in an Apicomplexan parasite is a) contacting the parasite with a gene probe,
and b) determining whether the probe has complexed with the parasite from which the
identity of the gene product is inferred
A method for identifying a plant-like gene product of a metabolic pathway in an Apicomplexan parasite also includes: a) cloning and sequencing the gene; and b)
determining whether the gene is homologous to a plant gene which encodes a plant
enzyme with the same function.
A method for identifying a plant-like gene product in a metabolic pathway in an
Apicomplexan parasite is a) contacting the parasite or its enzyme with a substrate for
the plant -like enzyme; b) measuring enzyme activity; c) determining whether the
enzyme is operative; and d) inhibiting activity of the enzyme in vitro with an inhibitor.
Identifying a gene or gene product in an Apicomplexan parasite which possesses an organelle transit sequence which transports a protein, wherein the protein
is not necessarily an enzyme in a metabolic pathway, but is identified because it has a characteristic organelle transit sequence is also within the scope of the invention.
The invention also relates to a diagnostic reagent for identifying the presence of
an Apicomplexan parasite in a subject, where the subject includes a domestic or
livestock animal or a human. The reagent may include all or a portion of a component of the plant-like pathway, an antibody specific for an enzyme that is a component of a
plant-like metabolic pathway in the parasite, or all or part of a nucleotide sequence that hybridizes to a nucleic acid encoding a component of the pathway A diagnostic assay that identifies the presence of an Apicomplexan parasite or specific life-cycle stage of
the parasite may use the diagnostic reagents defined herein
A diagnostic reagent for identifying the presence of an Apicomplexan parasite, includes an antibody specific for an enzyme that is part of a plant-like metabolic
pathway
A diagnostic assay for the presence of an Apicomplexan parasite in a biological
sample includes a) contacting the sample with an antibody selective for a product of a plant-like metabolic pathway that operates in an Apicomplexan parasite, and b) determining whether the antibody has complexed with the sample, from which the
presence of the parasite is inferred Alternatively, the assay is directed towards a nucleotide sequence In both these cases, appropriate antibody or nucleotide sequences are selected to distinguish infections by different Apicomplexans
An aspect of the invention is a vaccine for protecting livestock animals,
domestic animals or a human against infection or adverse consequences of infection by an Apicomplexan parasite The vaccine may be produced for an Apicomplexan
parasite in which a gene encoding a component of a plant-like metabolic pathway in
the parasite is manipulated, for example, deleted or modified When the gene is
deleted or modified in the live vaccine, the component of the pathway may be replaced by the presence of the product of an enzymatic reaction in tissue culture medium The
vaccine strain can then be cultivated in vitro to make the vaccine
A vaccine for protecting animals against infection by an Apicomplexan parasite
is based on an Apicomplexan parasite in which the parasite or a component of a metabolic pathway in the parasite is used
The vaccine may use a component of the pathway that is operative at a
particular life stage of the parasite A suitable component is the AroC gene from T. gondu or P. falciparum.
A method of treatment for an infection in a subject by an Apicomplexan
parasite includes the following steps a) obtaining an inhibitor of a plant-like metabolic
pathway in an Apicomplexan parasite, and b) administering an effective amount of the inhibitor to the subject
BRIEF DESCRIPTIONS OF DRAWINGS
FIG. 1A-C illustrates the heme synthesis pathway and the effect of GSAT in T. gondu
FIG. 1A diagrams the heme synthesis pathway FIGS. IB and 1C show that
uptake of tritiated uracil by tachyzoites (RH strain) is inhibited by gabaculine, an inhibitor of GSA aminotransferase P/S = pyrimethamine and sulfadiazine Note that ALA synthase is also present in T. gondu and constitutes an alternative pathway for heme synthesis
FIG. 2A-B shows unique lipid degradation in the glyoxylate cycle m T. gondu
FIG. 2 A is a schematic representation of the glyoxylate cycle FIG. 2B shows
uptake of tritiated uracil by tachyzoites (RH strain) is inhibited by 3-NPA (0 005 to 5
mg G/ML) Note this inhibitor also effects succinate dehydrogenase, so its inhibitory
effect does not unequivocally support presence of the glyoxylate pathway
FIG. 3A is a schematic representation of a pathway which demonstrates alternative oxidase as an alternative pathway for generation of energy in Apicomplexan
parasites FIG. 3B shows that uptake of tritiated uracil by tachyzoites (RH strain) is
inhibited by SHAM
FIG. 4A is a schematic representation of the pathway for conversion of shikimate to chorismate in T. gondu. The inhibitor of EPSP synthase is NMPG
FIG. 4B shows uptake of tritiated uracil by tachyzoites (RH strain) is inhibited by
NPMG Toxicity ofNPMG was assessed by its ability to prevent growth of human foreskin fϊbroblasts (HFF) after 4 days, as measured by tritiated thymidine uptake and
microscopic evaluation FIG. 4C shows product rescue of NPMG' s inhibitory effect
on EPSP synthase by PABA The effect of P ABA on sulfadiazine is similar, but the
effect on pyrimethamine, as predicted reduces the enzyme to the levels that were
present when media alone was utilized, as measured by the uracil uptake
S = sulfadiazine
PYR = pyrimethamine
PABA = para amino benzoic acid
FIG. 5 is a schematic representation of interrelationships of metabolic pathways
in Apicomplexan parasites
FIG. 6 shows inhibitory effects ofNPMG, gabaculine, SHAM 8-OH-quinoline
and on Cryptosporidia. 3NPA also inhibited Cryptosporidia
FIG. 7 shows the effects of gabaculine (20 mM) on growth of tachyzoites/bradyzoites (R5) in human foreskin fibroblasts, over 8 days as determined by uracil uptake Note increased uptake of uracil by the 8th day.
FIG. 8 shows the effect ofNPMG, pyrimethamine, and pyrimethamine plus
NPMG on survival of mice following intraperitoneal infection with 500 tachyzoites of the RH strain of T. gondii. Dosage ofNPMG was 200 mg/kg/day and pyrimethamine was 12.5 mg kg/day).
FIG. 9 shows nucleotide and deduced amino acid sequences of T. gondii
chorismate synthase cDNA. The asterisk indicates the stop codon.
FIG. 10 shows results of CLUSTAL X alignments of the deduced amino acid sequences of the putative T. gondii, chorismate synthase with the corresponding
sequences from Synechocystis, S. cerevisiae, S. lycopersicu , N. crassa and H. influenza Dashes were introduced to maximize alignment. Amino acids which are identical in all 6 organisms are underlined. The percent identity of the chorismate
synthase from each organism with the T. gondii protein was calculated to be as follows
Synechocystis (51.4%), S. cerevisiae (49.6%), S. lycopersicum (47.2%), N. crassa (45.0%) and H. influenza (44.5%). The large internal regions in the T. gondii sequence
which have no counteφarts in the chorismate synthases of other organisms, were not included in this calculation.
FIG. 11 shows the transit sequences of Zea mays and T. gondii chorismate synthases. The sequences of the transit peptide directing the transport of the wx+ protein into maize amyloplasts and chloroplasts and the portion of the T. gondii
chorismate synthase sequence which is homologous are aligned. The amino acid
sequence is given in one letter code * indicates an identical amino acid in the Wx Zea
mays and T. gondu sequences • indicates homologous amino acids in the Wx Zea
mays and T. gondii sequences
The transit sequence in the Wx Zea mays protein (UDP-glucose-starch-glycosyl
transferase) begins at amino acid number 1 and ends at amino acid number 72 The
portion (amino acids 359 to 430) of P. falcφarum AroC which corresponds to the novel internal sequence of the T. gondii AroC which includes the amino acids homologous to the maize protein, is as follows
IPVΕNMSTKKESDLLYDDKGECKNMSYHSTIQ1TOEDQI NSTKGFMPPKNDKNFNNIDDYNVTFNNNEEKLL The T. gondu portion of the AroC (chorismate synthase) sequence which demonstrates 30% homology begins at amino acid number 330 and ends at amino acid number 374 The first (single) arrow indicates the processing site of Zea mays UDP glucose glycosyl transferase transit peptide and the second (double) arrow indicates the location at which
the mature protein begins FIG. 12 shows P.falciparum, chorismate synthase, cDNA and deduced amino
acid sequences
DESCRIPTION OF THE PREFERRED EMBODIMENT
This invention uses components of plant-like interrelated metabolic pathways that are essential for growth or survival of Apicomplexan parasites The pathways are
generally not operative in animals and do not include psbA or PPi phosphofructokinase
and are not encoded in the plastid Components include enzymes, products, targetting
peptides, nucleotide sequences encoding the enzymes or peptides, and promoters, as
targets for specific inhibitors. Use of these pathways provide a rational and novel framework to discover, characterize and develop medicines, diagnostic reagents and vaccines for Apicomplexan parasites.
Medicines, diagnostic reagents and vaccines are based upon interrelated plant-
like enzyme cascades involved in the synthesis or metabolism or catabolism of Apicomplexan nucleic acids, amino acids, proteins, carbohydrates or lipids, energy transfer and unique plant-like properties of these enzymes which are shared with, and
provide a basis for, discovery of other parasite proteins which have unique organelle
targeting signals or unique promoter regions of the genes which encode the proteins. Synergistic combinations of inhibitors of the enzymes or proteins or nucleic acids
which encode them are particularly useful in medicines.
To select pathways for use in the invention:
a) plant textbooks and the published literature are reviewed for properties characteristic of plants, but generally not animals, databases such as Genbank or the Apicomplexan ESTs are reviewed to identify homologous Apicomplexan and plant-like
genes; and b) Western, northern and southern analyses, PCR, and ELIS.As are used to
recognize, or are based upon, for example, plant proteins and genes, to determine whether components of the pathways are present in Apicomplexans;
c) cloning, isolation and sequencing of genes and creation of gene constructs are used to identify Apicomplexan plant-like genes and their functions;
d) assays of enzyme activity are used to determined the operation of plant¬
like systems;
e) functions of parasite enzymes or part of a parasite enzyme are
demonstrated by complementation of a yeast or bacteria deficient in the enzyme, or
product rescue, or other methods to demonstrate enzyme activity, f) activity of compounds, (i.e., inhibitors) known to abrogate effect of the plant-like enzyme, protein, or nucleic acid which encodes them in vitro and in vivo,
are tested singly or in a plurality, against Apicomplexan parasites alone or together, and in conjoint Apicomplexan, bacterial and fungal infections, The general compositions of this invention are A. Inhibitory compounds based on
a) targeting proteins by
(i) substrate competition and transition state analogues
(ii) product competition
(iii) alteration of active site directly or by modification of secondary structure or otherwise altering function of the active site (iv) interfering with protein function with antibody
(v) targeting an organelle or protein within an organelle using a toxic
compound linked to a targeting sequence
b) targeting nucleic acids encoding proteins (antisense, ribozymes) c) targeting a component of the protein or nucleic acid (as above)
B. Diagnostic reagents (genes, proteins, antibodies) in ELISAs, western blots,
DNA, RNA assays
C. Vaccines (live knockout, live mutated, components - genes, proteins,
peptides, parts of genes constructs, etc )
Specific examples of components of plant-like Apicomplexan pathways are in Table 1 Compounds known to inhibit these enzymes or properties in Apicomplexans
and/or other microorganisms are listed in Table 1, as are novel ways to target them in Apicomplexans.
Table 1 A Apicomplexan plant-like metabolic pathways, components and inhibitors
Function Gene Enzyme or property Known inhibitors of Basis for novel name enzymes or property inhibitor
HEME SYNTHESIS HβmL glutamate-1 -semialdehyde 3-amιno-2,3-dιhydrobenzoιc S AS R aminotransferase (GSAT) acid (Gabaculine) 4-amιno- 5-hexynoιc acid 4-amιno-5- fluoropentanoic acid 4- amιno-5-hexynoιc acid (γ acetylenic GABA), 2-amιno- 3-butanoιc acid (vinyl glycine), 2-amιno-4- methoxy-trans-3-butanoιc, -amιno-5-fluoropentanoιc
GltX glutamyl-tRNA synthase HemA glutamyl-tRNA reductase
SHIKIMATE PATHWAY
Chonsmate AroA 3-enolpyruvylshιkιmate N-(phosphonomethyl) S.AS R synthesis phosphate synthase (3- glycine (glyphosphate) phosphoshι ιmate-1 sulfosate EPSP synthase carboxyvinyitransferase) inhibitors 4 and 5 hydroxymaonate inhibitors of EPSP synthase"
AroB dehydroquinate synthase (5- dehydroquinate dyhdrolase) AroC chorismate synthase 5- enolpyruvylshikimate 3- phosphate phospholyase)
AroC-ts AroC transit sequence
AroD dehydroquinate dehydratase ArvE shikimate dehydrogenase AroF 3-deoxy-d-arabιno- heptulosonate 7 phosphate synthase
AroG chonsmate mutase (7-phospho- 2-dehydro-3-deoxy-arabιno- heptulate aldolase)
AroH 3-deoxy-d-arabιno-heptulosante 7 phosphate synthase Ami shikimate 3- phosphotransferase (shikimate kinase)
Key S, modified substrate competitor, AS, antisense, R, πbozyme, Directed at active site, D None known,
*EPSP synthase inhibitor 4 refers to 3-(phosphonooxy)-4-hydroxy-5-[N-(phosphonomethyl-2- oxoethyl)amιno-1-cyclohexene-1-carboxylιc acid (3α, 4α, 5β), compound with diethyl ethanamide EPSP synthase inhibitor 5 refers to shortened R phosphonate
**A new, aromatic analogue of the EPSP synthase enzyme reaction intermediate 1 has been identified, which contains a 3- hydroxymalonate moiety in place of the usual 3-phosphate group This simplified inhibitor was readily prepared in five steps from ethyl 3,4-dιhydroxybenzoate The resulting tetrahedrai intermediate mimic is an effective, competitive inhibitor versus S3P with an apparent K(ι) of 0 57 +/- 0 06 muM This result demonstrates that 3- hydroxymalonates exhibit potencies comparable to aromatic inhibitors containing the previously identified 3-malonate ether replacements and can thus function as suitable 3-phosphate mimics in this system These new compounds provide another example in which a simple benzene ring can be used effectively in place of the more complex shikimate ring in the design of EPSP synthase inhibitors Furthermore, the greater potency of the tetraheral intermediate mimic versus the glycolate derivative and the 5- deoxy analog, again confirms the requirement for multiple anionic charges at the dihydroxybenzoate 5-posιtιon in order to attain effective inhibition of this enzyme
The following were identified inhibition of Toxoplasma gondii (Tg), Plasmodium falαparum (Pf), and Cryptospoπdium parvum (Cp) EPSP synthase by N-phosphonomethylglycine (NPMG), Tg and Pf chorismate synthase (AroC) cDNA and deduced ammo acid sequences, a novel sequence in the Tg chorismate synthase gene (AroC-ts) a portion of which is homologous with the plastid transit sequence of Zea mays (sweet corn) The Pf chorismate synthase (AroC) also has a corresponding novel and unique internal region Cp, Eimeπa bovis (Eb) genomic DNA which hybridizes with Tg AroC (chorismate synthase) Inhibition of Tg in vitro by NPMG abrogated by para-aminobenzoate (PABA) Synergism of NPMG with pyrimethamine, with sulfadiazine and with SHAM for Tg in vitro, Synergy of NPMG with pyrimethamine against Tg in vivo, SHAM and 8-hydroxyquιnolιne inhibited Tg, Pf, Cp
ιn vitro, reactivity of Tg protein of ~66Kd with 5 antibodies (monoclonal and polyclonal to VooDoo lily and 7 brucei alternative oxidases) and reduction to monomer similar to VooDoo lily and T brucei alternative oxidases on a reducing gel, Identification of Tg cDNA and genomic DNA PCR products using primers based on conserved sequences in other alternative oxidases which are probed and sequenced, Tg, Pf, Cp inhibited by high concentrations of gabaculine Reactivity of Tg protein of ~40Kd with 3 antibodies to GSAT (polyclonal α soybean, barley and synechococcus GSATs and not preimmune sera) Reactivity of Cp protein of ~40Kd with α barley GSAT Inhibition of Tg, Pf, Cp in vitro by 3NPA, Reactivity of Tg protein with polyclonal antibodies to cotton malate synthase and cotton isocitrate lyase but not preimmune sera In screening Tg cDNA library α GSAT antibody reactive clones are identified and are sequenced Tg chorismate synthase and dehydroquinase enzymatic activities are demonstrated
Table IB Components of Plant-Like Metabolic Pathways and Inhibitors
Function Gene Enzyme or Known inhibitors of enzyme or Basis for name property novel inhibitor
BRANCHED- anas acetyhydroxy Imidazolinones ιmazquιn=2-[4,5- S,AS,R
CHAIN AMINO acid synthase dιhydro-4-methyl-4-( 1 -
ACID methylethyl)-5-oxo-1 H-imidazol-
SYNTHESIS
(VALINE,
LEUCINE,
ISOLEUCINE)
nιcosulfurn=2-[[[[(4,6-dιmethoxy-
2-pyrιmιdιnyl) ammo] carbonyl] amιno]sulfonyl]-N,N-dιmethyl-3- pyndinecarboxamide, prιmιsulfuron=2-[[[[(4,6- bιs(dιfluoromethoxy)-2- pyπmidinyl) ammo] carbonyl] amιno]sulfonyl]benzoιc acid, thιfensulfuron=3-[[[[(4-methoxy-6- methyl-1 ,3,5-tnazιn-2-yl) am o] carbonyljammo] sulfonyl]-2- thiophene-carboxylic acid, trιbenuron=2-[[[[(4-methoxy-6- methyl-1 ,3,5-trιazιn-2- yl)methylamιno]carbonyl]amιno]s ulfonyl]benzoιc acid, sulfometuron=2-[[f[(4,6-dιmethyl-
2-pyrιmιdιnyl) am o] carbonyl] amιno]sulfonyl]benzoιc acid, metsulfuron=2-[[[[(4-methoxy-6- methyl-1 ,3,5-tπazιn-2- yl)amιno]carbonyl]amιno]sulfonyl] benzoic acid, halosulfuron=,
Sulfonaπilides flumetsulam=N-
(2,6-dιfluorophenyl)-5- methyl[1,2,4]tπazolo[1 ,5- a]pyrιmιdιne-2-sulfonamιde
Kar Keto-acid HOE 704 reducto isomerase ipd isopropylmalate 0-oιsobutenyl oxalhydroxamate dehydrogenase
Key S, modified substrate competitor, AS, antisense, R, πbozyme, D, direct inhibitor, alteration of target These are suitable because they are unique to Apicomplexans Unique to Apicomplexans means that either they do not exist in animals (e g , acetohydroxyacid synthase, linoleic acid synthase, starch-amylose or amylopectin synthase, Q or branching enzyme, UDP glucose, starch glycosyl transferase or have unique antigenic or biochemical properties distinct from those of animals (e g acetylco A carboxylase)
*Also present in animals
♦Other enzymes in these pathways unique to Apicomplexans
Additional herbicides which disrupt cell membranes include Diphenyl ethers [nitro phenyl ethers=] (acιfluorfen=5-[2-chloro-4-(trιfluoromethyl)phenoxy]-2-nιtrobenzoιc acid, fomeasafen=5-[2- chloro-4-(tπfluoromethyl)phenoxy]-N-(methylsulfonyl)-2-nιtrobenzamιde, lactofen=()-2-ethoxy-1- methyl-2-oxoethyl 5-[2-chloro-4-(trιfluoromethyl)phenoxy]-2-nιtrobenzoate, oxyflurfen=2-chloro-1-(3-
ethoxy-4-nιtrophenoxy)-4-(tπfluoromethyl)benzene), Other bentazon=3-(1-methylethyl)-(1H)-2, 1 3- benzothιadιazιn-4(3H)-one 2,2-dιoxιde above Additional herbicides which disrupt pigment production include clomazone=2-[(2-chlorophenyl)methyl]-4,4-dιmethyl-3-ιsoxazolιdιnone, amιtrole=1H-1 2,4- trιazol-3-amιne, norflurazoπ=4-chloro-5-(methyl amιno)-2-(3-(trιfluoromethyl) phenyl)-3(2H)- pyπdazinone, flurιdone=1-methyl-3-phenyl-5-[3-(tπfluoromethyl)phenyl]-4(1H)-pyrιdιnone
Enzymes in the heme synthesis [with a default ALA synthase pathway],
shikimate pathway, alternative generation of energy and glyoxylate cycle are
exemplified (Table IA) and the others (Table IB) are suitable for the practice of the invention
As outlined succinctly above, the present invention includes new methods and
compositions to treat, diagnose and prevent human and veterinary disease due to Apicomplexan parasites Apicomplexan infections include those due to Toxoplasma gondii (toxoplasmosis), Plasmodia (malaria), Cryptosporidia (cryptosporidiosis), Eimeria (eimeriosis), Babesia (babesiosis), Theileria (theileriosis), Neospora canmum,
and others An Apicomplexan parasite, Toxoplasma gondu, is a representative of other Apicomplexan parasites because Apicomplexan parasites appear to be phylogenetically related and have organelles and enzymes which are critical for their growth and
survival The presence of plant-like pathways/enzymes is confirmed in Apicomplexans
by a) the effect of known inhibitors of the pathways in plants using in vitro and in vivo assays, b) Western, Northern and Southern hybridization analyses, c) isolation and
comparison of relevant genes, d) demonstration of enzymatic activity, e) demonstration of immunologically reactive proteins which cross-react with proteins in plants,
f) complementation of organisms which lack a gene or part of the gene encoding an enzyme with a parasite gene which encodes the enzyme, and/or g) recognition of plant¬
like transit sequences In vitro assays include product rescue (i.e., complete or partial
abrogation of the effect of an inhibitor by providing the product of the reaction and thus
bypassing the need for the enzyme which catalyzes the reaction The assays are based
on inhibition of the parasite i.e. restriction of growth, multiplication or survival of the parasite Another measure of infection is "parasite burden" which refers to the amount (number) of parasites present as measured in vivo in tissues of an infected host
Another measure of infection is destruction of host tissues by the parasites Inhibitors
reduce parasite burden and destruction of host tissues caused by the parasites Preferably the inhibitors must not be toxic or carcinogenic to the parasites' host and for in vitro assays not be toxic to cells in culture
Enzymes of the newly detected plant-like pathways provide novel, unique and useful targets for antimicrobial therapy These unique pathways and enzymes are within the plastid, glyoxosomes, cytoplasm or mitochondria In addition, not suggested
before for these parasites, some enzymes used in these pathways are encoded by genes
within the nucleus Plant-like pathways detected in Apicomplexan parasites include a) the 5-carbon heme biosynthesis pathway that utilizes glutamate as a carbon skeleton for synthesis
and requires the unique enzyme glutamate- 1-semialdehyde aminotransferase, b) the
mobilization of lipids in the glyoxylate cycle which is a unique pathway that includes the enzymes isocitrate lyase and malate synthase, c) the generation of energy by an
alternative pathway which includes a unique alternative oxidase and/or other unique
pathways and enzymes for generating energy in the mitochondria or plastid, and, d) the
conversion of shikimate to chorismate utilized in the synthesis of ubiquinone, aromatic
amino acids and folate by plants, but not humans The shikimate pathway includes the
enzyme 3-phospho-5-enolpyruvylshikimate (EPSP) synthase, chorismate synthase, and chorismate lyase, as well as a number of enzymes unique to plants, fungi, bacteria, and mycobacteria, but not to animals. Inhibitors of some of these enzymes also provide information about the functioning and targeting of the enzymes.
The heme synthesis pathway involves enzymes encoded in the nucleus and imported to the plastid. This pathway is present in Apicomplexans including 7. gondii, P. falciparum, and Cryptosporidia parvum . Inhibitors of the enzyme GSAT in the
pathway include gabaculine (3-amino-2,3-dihydro benzoic acid), 4-amino-5-hexanoic
acid, and 4-amino-5-fluropentanoic acid. The glyoxylate cycle, reported to be present in plants, fungi, and algae, is also present in T. gondii. The cycle uses lipids and converts them to C4 acids through a
series of biochemical reactions. One of the last steps in this series of reactions is
dependent on the isocitrate lyase enzyme and another on the malate synthase enzymes. Inhibitors of these enzymes include 3-nitropropionic acid and itaconic acid. The alternative respiratory pathway, present in a range of organisms including
some bacteria, plants, algae and certain protozoans (trypanosomes), is present in T. gondii, Cryptosporidia parvum, and Plasmodium falciparum (in the latter parasite, two clones designated W2 and D6 were inhibited). The pathway is inhibited by a range of compounds including salicylhydroxamic acid, 8-hydroxyquinoline, Benzyhydroxamic
acid (BHAM), m-Chlorohydroxamic acid (m-CLAM), Propylgallate, Disulfliram and
others.
Enzymes involved in the synthesis of chorismate, including those which convert
shikimate to chorismate, and enzymes which generate folate, aromatic amino acids and
ubiquinone from chorismate in plants, are present in T. gondu, Plasmodium falciparum,
Cryptosporidium parvum, and Eimeria Inhibitors include N-(phosphonomethyl)
glycine (glyphosate, sulfosate and others) A full-length T. gondu cDNA sequence encoding a chorismate synthase from this pathway and the deduced amino acid
sequence provide information useful in developing novel antimicrobial agents The
T. gondu chorismate synthase has features in common with other chorismate synthases
and entirely unique features as well The unique features are novel sequences not shared with chorismate synthases from other organisms but with homology to an amyloplast/chloroplast transit sequence of Zea mays (sweet corn) A P. falciparum
cDNA sequence encoding chorismate synthase and its deduced amino acid sequence also provide information useful for developing novel antimicrobial agents
The genomic sequences provide information about regulation of the gene (e g , unique promoter regions) and such unique regions enable targeting their regulatory elements with antisense
A part of the novel internal sequence (i e , SCSFSESAASTIKHERDGSAATLS E
RASDGRTTSRHEEEVERG) in the T. gondii AroC (chorismate synthase) gene has homology
with the chloroplast/amyloplast targeting sequence of Zea mays (sweet corn) wx (UDP
glucose-starch-glycosyl transferase) protein (i e , MAAIATSQLVATRAGLGVPDASTFRRG
AAQGLRGARASAAADTLSMRTSARAAPRHQQQARRGGRFPSLWC) This transit sequence provides a
novel way to target T. gondu enzymes that move from the cytoplasm into the plastid
and is generally applicable to targeting any subcellular organelle The P. falciparum
AroC (chorismate synthase) has a corresponding novel internal sequence
Additional pathways found in Apicomplexan parasites include the synthesis of
branched chain amino acids (valine, leucine and isoleucine) and acetohydroxy acid synthase is the first enzyme in the branched chain amino acid synthesis pathway, inhibited by sulfonylureas and imidazolinones, as well as the synthesis of other
"essential" amino acids, such as histidine, methionine, lysine and threonine. Starch synthesis, including starch synthases, the UDP-glucose-starch glycosyl transferase, and debranching enzymes and enzymes of lipid, terpene, giberellin and auxin synthesis, are
part of other pathways in Apicomplexan parasites. Down modulation of the UDP-
glucose starch glycosyl transferase pathway leads to a switch from amylose to amylopectin synthesis and thus the bradyzoite phenotype.
Demonstration of presence of one enzyme or the gene that encodes it in a
known pathway implies presence of the full pathway. Thus, enzymes in parasite metabolic pathways that can be inhibited include: glutamyl-tRNA synthetase; glutamyl-
tRNA reductase; prephenate dehydrogenase; aromatic acid aminotransferase (aromatic transaminase); cyclohexadienyl dehydrogenase; tryptophan synthase alpha subunit;
tryptophan synthase beta subunit; indole-3-glycerol phosphate synthase (anthranilate isomerase), (indoleglycerol phosphate synthase); anthranilate phosphoribosyltransferase; anthranilate synthase component I; phosphoribosyl anthranilate isomerase; anthranilate synthase component II; prephenate dehydratase
(phenol 2-monooxygenase); catechol 1,2-deoxygenase (phenol hydroxylase);
cyclohexadienyl dehydratase; 4-hydroxybenzoate octaprenyltransferase; 3-oxtaprenyl-4-
hydroxybenzoate carboxylyase; dehydroquinate synthase (5-dehydroquinate hydrolase);
chorismate synthase (5-enolpyruvylshikimate 3-phosphate phosph-lyase);
dehydroquinate dehydratase, shikimate dehydrogenase, 3-deoxy-d-arabino-
heptuloonate 7 phosphate synthase, chorismate mutase (7-phospho-2-dehydro-3-
deoxy-arabino-heptulate aldolase), 3-deoxy-d-arabino-heptuloonate 7 phosphate
synthase, shikimate 3-phosphotransferase (shikimate kinase), UDP glucose starch glycosyl transferase, Q enzymes, acetohydroxy acid synthase, glutamate- 1-
semialdehyde 2, 1 -aminotransferase, chorismate lyase, malate synthase, isocitrate lyase, and 3-enolpyruvylshikimate phosphate synthase (3-phosphoshikimate-l carboxyvinyltransferase)
Recombinant protein produced by constructs with genes encoding these
enzymes in E coli or in other expression systems is useful for producing antibodies and obtaining a crystal structure Native enzyme is isolated The expressed and native proteins are used to design and test new inhibitors in enzyme assays Expressed and
native (from varied life-cycle stages) proteins are used and the expressed protein is a
source of the enzyme, and the enzyme assay is carried out in the presence and absence
of the inhibitors, either alone or in combination and controls include the buffer for the enzyme alone The crystal structure is useful for characterizations of enzyme active
site(s), secondary structure, transit sequence, substrate and product interactions The
design of additional inhibitors is carried out using published methods such as modifying substrates as had been done with inhibitors of EPSP synthase
Certain pathways are shown to be affected by inhibitors which are synergistic in
vitro Examples of synergistic inhibitors in vitro are gabaculine (heme synthesis) and
SHAM (alternative energy generation), NPMG and SHAM; NPMG and sulfadiazine;
and NPMG and pyrimethamine. Gabaculine and sulfadiazine are an additive combination in vitro.
An aspect of the invention is identifying potential targets for therapeutic intervention by considering nuclear as well as organellar genes as part of the production of enzymes for unique plant-like pathways. For example, the protein synthesis of plant¬
like proteins that is also demonstrated in Apicomplexan parasites suggests not only
conservation of plastid genes but also conservation of nuclear genes which encode enzymes that act inside or outside the plastid, from an ancestor that is common to Apicomplexan parasites and algae. Many vital metabolic pathways of algae (often
shared with their evolutionary relatives, higher plants) also are conserved in the
Apicomplexan parasites, whether or not the pathways involve the plastid. Consequently, Apicomplexan parasites are sensitive to inhibitors that block several of these unique pathways. Combined attack on multiple targets retards the emergence/selection of resistant organisms. Considering nuclear and organellar genes
has the dual advantage of rapidly identifying conservation of specific pathways and simultaneously identifying both target sites and lead compounds for therapeutic drug development.
An aspect of the invention is a plurality of inhibitors, singly or in combination,
directed against enzymes and/or genes encoding a different metabolic pathway. Examples of inhibitors suitable for practice of the present invention include GSAT,
3NPA, SHAM, 8-OH-quinoline, and NPMG, sulfonylureas, imidazolinones, other
inhibitors of EPSP synthase or chorismate synthase which include competitive substrate
analogues, transitional state inhibitors and direct active site inhibitors as well as other known compounds (Table I). Some pluralities of inhibitors produce synergistic effects.
Improved treatments against Apicomplexan parasites result from a variety of
options:
1. some compositions may inhibit the operation of more than one pathway, thereby producing a strong effect and lessening the probability of resistance to the drug emerging because more than one mutation may be required;
2. some compositions may inhibit more than one step in a pathway;
3. some pluralities of compositions may have synergistic effects, producing more effective drugs; and
4. some compositions may target pathways operative exclusively during a life cycle of the parasite, making them more selective e.g. against the latent phase.
5. some compositions may inhibit other microorganisms (including other Apicomplexans.) An additional detail of the invention is that representative Apicomplexan
parasites, notably T. gondii, are used for assaying candidate inhibitors. The invention is directed at effects of inhibitors of the unique plant-like pathways in Apicomplexan,
alone and in combination. Organisms used for the assays include T. gondii tachyzoites,
bradyzoites and a mutant that expresses 50% tachyzoite and 50% bradyzoite antigens.
Unique plant enzymes and pathways that were found to be inhibited by compounds shown to inhibit plant pathways in Apicomplexans include: (1) glutamate- 1
semialdehyde amino transferase, an enzyme important in heme synthesis, (2) isocitrate
lyase, an enzyme important in utilization of lipids, (3) alternative oxidase enzyme
complex, enzymes important in energy production and (4) 3-phospho-5-
enolpyruvylshikimate synthase (EPSP synthase), an enzyme important in conversion of
shikimate to chorismate which is a precursor for synthesis of folate, ubiquinone, and certain amino acids essential for survival
The invention provides a rational, conceptual basis for development of novel
classes of antimicrobial agents that inhibit Apicomplexan parasites, unique diagnostic
reagents, and attenuated vaccines The inhibitors provide lead compounds for the development of antimicrobial agents Conserved enzyme active sites or parts of the molecules or genes that encode the protein which are targeted by the inhibitors provide
the basis for development of new but related ways to target the enzymes, such as related protein inhibitors, intracellular antibodies, antisense DNA, and ribozymes
Inhibitors are effective against more than one parasite (e.g. T. gondu, P. falciparum and C. parvum) and enzymes in these pathways also are present in other
bacterial and fungal pathogens such as Pneumocystis carinii, Mycobacterium tuberculosism Staphylococcus aureus, and Hemophilus influenza, but not animals
Thus, inhibitors of these pathways affect susceptible microorganisms which concurrently infect a host Because enzymes are utilized differentially in different
parasite life-cycle stages, stage-specific inhibitors are within the scope of the invention Genes encoding the enzymes in Apicomplexans are identifiable The genes encoding
the enzymes are effectively knocked out in these parasites by conventional techniques "Knockout" mutants and reconstitution of the missing genes of the parasite demon¬
strate the importance of gene products to the varying life-cycle stages of the parasite which are identified using antibodies to proteins and ability to form cysts in vivo which
define the life cycle stages The parasites in which a gene is knocked out are a useful basis for an attenuated vaccine The genes encoding the enzymes or parts of them (e g , a novel targeting sequence) or the proteins themselves alone or with adjuvants
compnse a useful basis for a vaccine The pathways and enzymes of the invention are useful to design related antimicrobial agents The sequences and definition of the active sites of these enzymes, and pathways, and organelle (e g , plastid) targeting sequences
provide even more specific novel and unique targets for rational design of antimicrobial
agents effective against Apicomplexan parasites For example, proteins which interact with the enzyme and interfere with the function of the enzyme's active site, or are competitive substrates or products or intracellular antibodies (i.e., with a gene encoding the Fab portion of an antibody that targets the protein the antibody recognizes), or
antisense nucleic acid or targeted ribozymes that function as inhibitors are useful, novel antimicrobial agents Enzymes of the invention are a novel basis for unique diagnostic
tests Because some of these pathways are important in dormant parasites, or in selecting the dormant or active life cycle stages, they are especially important as
antimicrobial agent targets for life cycle stages of the parasite for which no effective antimicrobial agents are known or as diagnostic reagents which ascertain the duration
of infection
Identification of the pathways in Apicomplexan parasites provides additional
enzyme targets present in these pathways which are not present in or are differentially expressed in animal cells Identification of the interrelatedness of these pathways with
each other provides the basis for the development and demonstration of combinations
of inhibitors which together have an effect which is greater than the expected additive
effect (i.e., synergistic) The meaning of synergism is that compound A has effect A',
compound B has effect B', compounds A+ B have an effect greater than A'+ B' Synergism is characteristic of inhibitors of these pathways because an initial pathway affected by an inhibitor often provides a product used as a substrate for another pathway so the inhibition of the first enzyme is amplified These pathways or their
products are interrelated Therefore, the enzymes or DNA which encodes them are targeted by using two or more inhibitors leading to an additive or synergistic effect
Examples include the additive effect of gabaculine and sulfadiazine and the synergistic
effects ofNPMG and sulfadiazine and NPMG and pyrimethamine One or more of the
inhibitors preferentially affect one of the life cycle stages of Apicomplexan parasites Some enzymes are preferentially used by specific stages of the parasites Detection of an enzyme of this type or a nucleic acid encoding it offers a novel
diagnostic test not only for presence of a parasite, but also for identification of the stage
of the parasite Genes encoding enzymes in pathways of the present invention are "knocked out" using techniques known in the art A parasite with a gene knocked out is said to
be attenuated either because the gene expression of the enzyme is stage specific so the parasite cannot become latent, or because the knocked out enzyme is essential for
parasite survival The importance of an enzyme's functions in various life-cycle stages is determined using a mutant-knockout-complementation system In the former case,
the attenuated parasite is useful as a vaccine because the "knocked out" gene is critical for the parasite to establish latency Its administration to livestock animals results in
immunity without persistence of latent organisms Mutants with the gene "knocked
out" also can be selected because when the parasites are grown in vitro they are grown
in the presence of product of the enzymatic reaction to allow their survival. However, such attenuated parasites do not persist in vivo in the absence of the product and,
consequently they are useful as vaccines, for example, in livestock animals. The genes that encode the protein also are used in DNA constructs to produce proteins themselves or the proteins or peptides are used in immunized animals. These constructs
are used to elicit an immune response and are used for vaccines alone or with
adjuvants. Specific examples are incorporation of the gene for alternative oxidase or chorismate synthase in a construct which has a CMV promoter and expresses the protein following intramuscular injection (i.e., a DNA vaccine). This type of construct,
but with genes not identified or described as plant-like, has been used as in a vaccines that protect against bacterial and protozoal infections
Plant-like pathways in Apicomplexans were inhibited in vitro. An Apicomplexan GSAT enzyme that is part of a heme synthesis pathway was targeted
with inhibitors. A gene with homology to ALA synthase was identified by analysis of the T. gondii ESTs (Washington University T. gondii gene Sequencing project), indicating that T. gondii has alternative methods for synthesis of ALA. An
Apicomplexan glyoxylate cycle was analyzed to determine the sensitivity of tachyzoites
and bradyzoites to glyoxylate cycle inhibitors. Specifically, Apicomplexans have
isocitrate lyase and malate synthase which present a unique pathway for lipid
metabolism that is targeted by inhibitors. Apicomplexan alternative oxidase is targeted,
as evidenced by effects of inhibitors of alternative oxidase on this pathway and its
expression and immunolocalization in tachyzoites and bradyzoites; Apicomplexan
parasites have a metabolically active EPSP synthase enzyme involved in conversion of
shikimate to chorismate These four metabolic pathways, i e., heme synthesis, shikimate pathway, alternative generation of energy, and the glyoxylate cycle are all
exemplified in T. gondii To show that inhibition was specific for key enzymes in these
pathways that are generally absent or used only rarely in mammalian cells, product
inhibition studies were used in vitro For example, growth of T. gondii is sensitive to NPMG that inhibits the synthesis of folic acid via the shikimate pathway Because mammalian hosts lack the entire shikimate pathway, it is unlikely that the parasites can
obtain either PABA or its precursor chorismate from the host cells so provision of PABA circumvents the need for the substrate pathway for folate synthesis and rescues the EPSP synthase inhibition by NPMG
Further proof of the presence of the plant-like pathways arises from biochemical
assays for an enzyme in analogous plant pathways and isolation of encoding genes
Genes are identified by search of available expressed sequence tags (ESTs, i e , short, single pass cDN A sequences generated from randomly selected library clones) by PCR
amplification using primer sequences derived from published conserved sequences of
plant genes with parasite genomic DNA or parasite DNA libraries (Chaudhun et al , 1996), by the screening of Apicomplexan DNA expression libraries with antibodies to previously isolated homologous proteins or the DNA which encodes them and by
complementation of E. coli or yeast mutants deficient in an enzyme Genes isolated by
these techniques are sequenced which permits identification of homologies between plant and Apicomplexan genes using sequence databases such as Genbank These
assays confirm that an enzyme and the gene encoding it are present in Apicomplexan
parasites. E. coli mutants and yeast deficient in the enzyme are complemented with plasmid DNA from T. gondii cDNA expression libraries or the isolated gene or a
modification (e.g., removing a transit sequence) of the isolated gene which allows the
production of a functional protein in the E. coli or yeast, demonstrating that the gene encoding the enzyme is functional. Homologous genes in T. gondii, P. malaria,
Cryptosporidia, Neospora, and Eimeria are identified when relevant plant or T. gondii
genes are used as probes to DNA obtained from these organisms and the genes are identified either by cloning and sequencing the DNA recognized by the probe or by using the probe to screen the relevant parasite libraries Genomic DNA is sequenced
and identifies unique promoters which are targeted Unique parts of the genes were identified in the sequences and provide additional antimicrobial agent targets, diagnostic reagents and vaccine components or bases for vaccines Clade and bootstrap analyses (Kohler et al., 1997) establish the phylogenetic origin of novel, sequenced, parasite
genes and this indicates other related antimicrobial agent targets based on components, molecules, and pathways of phylogenetically related organisms Gene products are
expressed and utilized for enzyme assays and for screening novel inhibitors, for making antibodies for isolation of native protein, for x-ray crystallography which resolves
enzyme structures and thus establishes structure-function relationships and enzyme
active sites which are useful for the design of novel inhibitors lmmunoelectronmicroscopy using antibodies to enzymes such as chorismate
synthase, alternative oxidase, malate synthase or isocitrate lyase immunolocalizes the
enzymes within the parasite and determines their location, in particular whether they are in plant-like organelles. Apicomplexan transit peptides are identified by their homology
to known transit peptides in other species Attachment of reporter proteins to the wild type transit peptide, or deletion or mutations of the transit peptide or portion of the peptide or gene encoding it, and then characterization of targeting of these constructs
alone or in association with reporter constructs establishes that the amino acid
sequences of the transit peptide determine intracellular localization and site of function of proteins with this sequence Stage specificity of these enzymes is determined in vitro by using antibodies to stage-specific antigens in inhibitor-treated cultures, by Western
or Northern analyses (detection), by enzyme assays using selected parasite life cycle
stages, by using RT PCR (Kirisits, et al, 1996) and a DNA competitor as an internal standard to quantitate the amount of mRNA in parasite samples, by ELISA
(quantitation) and by determining whether a parasite with the gene knocked out can
develop a bradyzoite phenotype in vitro in the appropriate bradyzoite inducing culture conditions Stage specificity in vivo is determined by observing effects of the inhibitors on different life cycle stages in acutely vs chronically infected mice and by determining
whether a parasite with the gene knocked out can form cysts in vivo Useful techniques
to develop diagnostic reagents for detection of these proteins or nucleic acids include ELISAs, Western blots, and specific nucleotides used as probes
EXAMPLES
Example 1: Novel In Vitro Assay Systems to Assess Antimicrobial Effects on T. gondii
New in vitro and in vivo assay systems were developed to determine whether
plant metabolic pathways are present in Apicomplexans. New elements include use of
longer culture times (e.g., extending the duration of the assay to > 6 days is also a unique and useful aspect of this invention, because it allows demonstration of antimicrobial effect for compounds which have to accumulate prior to exerting their effect), use of Me49 PTg and R5 strains in vitro, employing synergistic combinations of
NPMG and low dosage pyrimethamine in vivo, and assays of parasitemia m vivo using competitive PCR
Improvements were developed in the assays reported by Mack et al (1984) and Holfels et al. (1994) to measure T. gondii replication in tissue culture The
improvements are based on microscopic visual inspection of infected and inhibitor treated cultures, and on quantitation of nucleic acid synthesis of the parasite by measuring uptake of 3H uracil into the parasite's nucleic acid Uracil is not utilized by
mammalian cells Parasites present as tachyzoites (RH, Ptg, a clone derived from the
Me49 strain), bradyzoites (Me49), and R5 mutants (mixed tachyzoite/bradyzoites of the Me49 strain that can be stage switched by culture conditions) (Bohne et al , 1993,
Soete et al , 1994, Tomovo and Boothroyd, 1995 , Weiss et al. , 1992) are suitable for
assay systems used to study effects of inhibitors Only the RH strain tachyzoites,
cultured for up to 72 hours, had been used in previously reported assays The use of
Me49, Ptg, and R5 mutant are unique aspects of the methods used in these assays in this invention
Results using the assay systems are shown in FIGS. 4, 6-8 In these assays
toxicity of a candidate inhibitor was assessed by its ability to prevent growth of human
foreskin fibroblasts (HFF) after 4 days and after 8 days as measured by tritiated thymidine uptake and microscopic evaluation Confluent monolayers of HFF were infected with tachyzoites or bradyzoites Inhibitor was added one hour later Non-
toxic doses were used in parasite growth inhibition assays Parasite growth was measured by ability to incorporate tritiated uracil during the last 18 hours of culture Example 2: Detection of Plant-like Pathways in Apicomplexans
Using assays disclosed herein, some of which were novel, Apicomplexan
parasites were found to contain at least four metabolic pathways previously thought to be unique to plants, algae, bacteria, dinoflagellates, and fungi. Specifically, the presence of a unique heme synthesis pathway, an alternative oxidase pathway, a glyoxylate cycle and a pathway necessary for the biosynthesis of chorismate and its
metabolites were explored Growth of the parasite, T. gondii, depends upon these pathways To examine T. gondii for the presence of plant-like and algal metabolic
pathways, certain inhibitors of metabolic pathways are suitable to apply because of their ability to prevent growth of the parasite in tissue culture
Pathways which are present in Apicomplexans were analyzed as follows First,
T. gondii tachyzoites were tested to see if they were sensitive in vitro to inhibition by
specific inhibitors of target pathways. Then bradyzoites are tested Positive results for
each pathway provided presumptive evidence that the inhibitor targets were present and
that their activities are important for parasite survival and growth The inhibitors
effective in vitro were screened for activity in vivo in mice An example of an effective combination in vivo is NPMG and low dosage pyrimethamine
The presence of an enzyme was further confirmed by product rescue in vitro, in
which the product abrogates the need for its synthesis by the enzyme An example was
rescue by PABA for the reaction catalyzed by EPSP synthase Other methods to
demonstrate the presence of an enzyme and thus the pathway include functional enzyme assays, complementation of mutant E. coli strains, PCR, screening of a T. gondu expression library with antibodies or DNA probes, and immunostaining of Western
blots For some enzymes, identification of a partial sequence of a gene in an EST library in the gene database led to cloning and sequencing the full length gene Demonstration of the enzymes also is diagnostic for presence of the parasites
Examples are demonstration of T. gondii and C. parvum GSAT and T. gondii
alternative oxidase and T. gondii isocitrate lyase and malate synthase by Western analysis and cloning and sequencing of the 7. gondii and P. falciparum chorismate
synthase gene Reagents (gene probes and antibodies) obtained during characterization of genes from T. gondii are used to detect homologous enzymes and pathways in other
Apicomplexan parasites Examples were using the T. gondii chorismate synthase gene to probe P. falciparum, Eimeria bovis and Cryptosporidium parvum genomic DNA
Other examples are using heterologous plant DNA to detect Apicomplexan GSAT,
isocitrate lyase, malate synthase, and alternative oxidase genes Such genes are used as
DNA probes to screen libraries to clone and sequence the genes to identify PCR
products
Example 3: Effects of Inhibitors In Vitro on T. gondii
Using the assays described in Example 1, five compounds that restrict the growth of T. gondii in vitro were identified
(i) Gabaculine
(ϋ) NPA
(Hi) SHAM (Salicylhydroxamic Acid),
(iv) 8-hydroxyquinoline
(v) NPMG Specifically these inhibitors act as follows i. The Effect of Gabaculine, An Inhibitor Of The 5-Carbon Heme
Synthesis Pathway, On the Growth of T. gondii
FIG. 1A compares heme biosynthesis in plants, algae and bacteria with heme biosynthesis in mammals In higher plants and algae, ALA is produced in the plastid by
the action of GSA aminotransferase on glutamate 1-semialdehyde In mammals, ALA
is formed through the condensation of glycine and succinyl CoA ALA is subsequently
converted to heme In one dinoflagellate and 7. gondii both pathways are present
Inhibitors of plant heme synthesis pathway restrict the growth of Toxoplasma
gondii in vitro As shown in FIG. 1A, the synthesis of δ-aminolevulinic acid (ALA),
the common precursor for heme biosynthesis, occurs in the plastid of plants, algae and Apicomplexan parasites by the 5-carbon pathway and ALA synthesis occurs by a
different pathway in animals The pathway in animals involves the condensation of
glycine and succinyl CoA The data in FIG. 1B-C and a Western blot utilizing an
antibody to the homologous soybean, and barley, and synechococcus GSATs,
demonstrate that Toxoplasma gondii utilizes the 5-carbon pathway for ALA synthesis
and therefore heme biosynthesis. 3-amino 2,3-dihydroxybenzoic acid (gabaculine) inhibits GSA in the heme synthesis pathway
First the toxicity of gabaculine was assessed by its ability to prevent growth of
human foreskin fibroblasts (HFF) as measured by 3H-thymidine uptake and microscopic
evaluation. Non-toxic doses were used in parasite growth inhibition assays In vitro parasite growth inhibition assays included confluent monolayers of HFF infected with
tachyzoites (RH) or mutant Me49 (R5). Gabaculine was added 1 hour later Parasite
growth was measured by the ability to incorporate 3H-uracil during the last 18 hours of
culture. In addition, parasite growth was evaluated microscopically in Giemsa stained slides.
Toxoplasma organisms were grown in human foreskin fibroblasts alone and in
the presence of different concentrations of gabaculine (3-amino-2,3-dihydrobenzoic acid) Growth was measured by the ability of T. gondii to incorporate tritiated uracil This compound was effective at inhibiting the growth of T. gondii at the 20mM
concentration FIG. IB demonstrates the ability of gabaculine (a specific inhibitor of
GSA aminotransferase) to restrict the growth of T. gondii in an in vitro assay over a 4 day period. T. gondii growth is measured by ability of the parasites to incorporate
tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis The X-axis
describes how the T. gondii cultures were treated. Cultures that were grown in
medium (medium) produced a CPM of around 45,000 If no T. gondii were added to
the cultures (no RH), a CPM of around 2,000 was observed Pyrimethamine (0 1
μm/ml) and sulphadiazine (12 5 μg/ml) added to cultures resulted in a marked
reduction in CPM compared with untreated cultures At a dose of 5 mM gabaculine
restricted around 50% of CPM and at a dose of 20 mM it almost completely inhibited parasite growth, with counts of about 5,000 CPM
FIG. IC demonstrates the ability of gabaculine to inhibit the growth of T. gondii over 8 days in culture T. gondii growth is measured by ability of the
parasites to incorporate tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis The X-axis represents days post infection Parasite growth was evident in the cultures where no drug was added (medium) over the entire time course Parasite
growth was restricted in cultures with 20 mM gabaculine (gabaculine) over the 8 day
time course Similarly, parasite growth was restricted in cultures with pyrimethamine and sulphadiazine (P/S) over the 8 day time course Similar concentrations showed no toxicity to the foreskin fibroblasts indicating the specificity of this compound for
T. gondii Parallel cultures, fixed and stained with Giemsa and examined by
microscopy, clearly demonstrated that T. gondii growth was substantially inhibited in the presence of 3-amino-2,3-dihydrobenzoic acid The results in FIGS. IB and IC indicate that T. gondii utilizes the 5-carbon ALA synthesis pathway
FIG. 7 demonstrates the ability of gabaculine to inhibit the growth of the
mutant R5 strain of T. gondii over 8 days in culture This mutant strain is atovaquone resistant and possesses certain characteristics of the tachyzoite stage and certain
characteristics of the bradyzoite stage T. gondii growth is measured by their ability to
incorporate tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis
The X-axis represents days post infection Parasite growth was evident in the cultures where no drug was added (medium) over the entire time course Parasite growth was
restricted in cultures with 20mM gabaculine (gabaculine) over the first 6 days of culture, after which a marked increase in parasite growth was detected. Furthermore
groups of proliferating organisms which resembled tissue cysts were observed in
similarly treated cultures. Parasite growth was restricted in cultures with pyrimethamine and sulphadiazine (P/S) over the entire 8 day time course. Residual R5 organisms in treated cultures at 8 days begin to incorporate uracil again and some of
them appeared cyst-like. Therefore, T. gondii cyst-like structures are selected by
gabaculine treatment of cultures. Specific immunostaining of such cultures treated with gabaculine for tachyzoite and bradyzoite specific antigens demonstrates that gabaculine selects bradyzoites. Table 2 is a schematic representation of experiments designed to test the hypothesis that tachyzoites utilize both conventional oxidase and alternative oxidases, but bradyzoites only use alternative oxidases, therefore interfering with generation of iron sulfated proteins by gabaculine treatment will select bradyzoites. The design and predicted results of stage specific immunostaining (Kasper et al, 1983)
if the hypothesis were correct are shown in Table 2 and confirm the hypothesis These
results suggest that T gondii has stage-specific utilization of alternative oxidases which
are utilized when cell cultures are treated with gabaculine because it depletes heme and
thus depletes iron sulfated proteins used in conventional respiration.
In summary, 3-amino-2,3-dihydrobenzoic acid (gabaculine) is an inhibitor of the 5 carbon heme synthesis pathway present in Apicomplexan parasites. Heme synthesis occurs by a different pathway in mammalian cells and is therefore unaffected by 3-
amino-2,3-dihydrobenzoic acid.
Table 2. Gabaculine treatment of cultures selects bradyzoites.
Antibody Treatment Tachy- BradyIFA result on culture day used for of zoite zoite IFA culture Control Control 0 2 6
α BSAG Media (expressed on bradyzoites one day after stage Gabaculine switch)
α BAG5 Media (expressed on bradyzoites by five day Gabaculine after stage switch in culture)
IFA is immunofluorescent assay. SAG1 is surface antigen 1. BSAG is bradyzoite surface antigen 1. BAGS is bradyzoite antigen 5. A. Hypothesis. B. Design and predicted results of stage specific immunostaining if hypothesis were to be correct. < indicates no specific fluorescence of the organism; ^ indicates specific surface fluorescence of the organism due to presence of the antigen recognized by the antibody (e.g., αSAGI or αBSAG); ^^ indicates specific internal fluorescence in the organism due to presence of the antigen within the parasite recognized by the antibody (e.g., αBAGδ).
ii. An inhibitor of the glyoxylate cycle restricts the growth of
T. gondii in vitro.
3-Nitropropionic acid is an inhibitor of isocitrate lyase in the degradation of
lipid to C4 and inhibits replication of T. gondii in vitro FIG. 2A illustrates how the
glyoxylate cycle manufactures C4 acids Acetyl CoA, a byproduct of lipid breakdown combines with oxaloacetate to form citrate By the sequential action of a series of enzymes including isocitrate lyase, succinate is formed Glyoxalate, the byproduct of
this reaction is combined with a further molecule of acetyl CoA by the action of malate synthase Malate is then converted to oxaloacetate, thus completing the cycle 3-NPA
and itaconic acid are inhibitors of this pathway FIG. 2B demonstrates the ability of
3-NPA (an inhibitor of isocitrate lyase) to restrict the growth of T. gondii in an in vitro
assay over a 4 day period This result indicates it is likely that T . gondu degrades lipids using isocitrate lyase 7". gondii growth is measured by their ability to incorporate tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis The X-axis
described how the T gondu cultures were treated Cultures that were grown in medium (medium) produced a CPM of about 30,000 If no T. gondu were added to
the cultures (no RH), a CPM of about 2,000 was observed Pyrimethamine (0 1 μg/ml)
and sulphadiazine (12 5 μg/ml) added to cultures resulted in a marked reduction in
CPM compared with untreated cultures A dose of 0 006 mg/ml 3-NPA (3-NPA)
restricted around 60% of CPM 3-NPA inhibits the glyoxylate cycle (isocitrate lyase) and/or succinate dehydrogenase in Apicomplexan parasites
iii. and iv. Effect of SHAM and 8-hydroxyquinoline on alternative
oxidase in T. gondii
There is a metabolic pathway found in most plants and algae and in
Apicomplexans, but absent in most multicellular animals. FIG. 3A describes the electron transport respiratory chain that normally occurs on the inner membrane of
mitochondria In animals, NADH and succinate produced by the action of the citric acid cycle diffuse to the electron transport chain. By a series of oxidation reactions mediated in part through the cytochromes, free energy is released This free energy
yields the potential for the phosphorylation of ADP to ATP. In plants, in addition to
the conventional electron transport chain complexes, there is an alternative pathway of respiration Alternative pathway respiration branches from the conventional pathway at ubiquinone and donates released electrons directly to water in a single four electron
step An important feature of this pathway is that it does not contribute to
transmembrane potential and thus free energy available for the phosphorylation of ADP to ATP The pathway provides a source of energy and is preferred for conditions with relatively low ATP demands A key enzyme in this pathway is an alternative oxidase
that is cyanide insensitive and does not require heme Toxoplasma gondii utilizes the alternative oxidase for respiration
FIG. 3B demonstrates the ability of SHAM (a specific inhibitor of alternative oxidase) to restrict the growth of T. gondii in an in vitro assay over a 4 day period
The ability of these compounds to inhibit the growth of T. gondii was examined by the assay described in Example 1. T. gondii growth is measured by their ability to
incorporate tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis
The X-axis describes how the T. gondii cultures were treated Cultures that were grown in medium (medium) produced a CPM of around 54,000 If no 7. gondii were
added to the cultures (no RH), a CPM of around 1,000 was observed Pyrimethamine
(0 1 μg/ml) and sulphadiazine (12 5 μg/ml) added to cultures resulted in a marked
reduction in CPM compared with untreated cultures A dose of 0 19 μg/ml SHAM
(0 19) restricted around 50% of CPM and at a dose of 0 78 μg/ml it essentially
inhibited parasite growth, with counts of about 8,000 CPM
Salicylhydroxamic acid (SHAM) and 8-hydroxyquinoline are inhibitors of the alternative oxidase and are also effective against T. gondu, presumably by inhibiting the alternative pathway of respiration Salicylhydroxamic acid and 8-hydroxyquinoline inhibit the alternative oxidase of T. gondii tachyzoites Since alternative oxidative respiration does not occur in mammals, this makes antimicrobial compounds targeting this pathway therapeutic candidates
v Effect of NPMG The shikimate pathway is common to plants, fungi and certain other
microorganisms and Apicomplexan parasites, but it is not present in mammalian cells
FIG. 4A details the events that result in the production of tetrahydrofolate, aromatic
amino acids and ubiquinone in plants, algae, bacteria and fungi In this pathway,
chorismate is formed through the sequential action of a number of enzymes including EPSP-synthase and chorismate synthase EPSP-synthase is inhibited by NPMG
Chorismate is further processed to yield tetrahydrofolate or ubiquinone by a further
series of enzymatic reactions This pathway has not been described in mammals which
are dependent on diet for folate and therefore for tetrahydrofolate production This
pathway is required for the synthesis of certain aromatic amino acids and aromatic
precursors of folic acid and ubiquinone. It is likely that Toxoplasma gondii utilizes the shikimate pathway for synthesis of folic acid, ubiquinone and aromatic amino acids. N-(phosphonomethyl) glycine, an inhibitor of 3-phospho-5-
enolpyruvylshikimate (EPSP) synthase and thus an inhibitor of shikimate to chorismate
conversion, affects the pathway (Table 1). The ability of this compound to inhibit the growth of T. gondii was examined by the assay described in Example 1. FIG. 4B demonstrates the ability ofNPMG (a specific inhibitor of EPSP-synthase) to restrict the growth of T. gondii in an in vitro assay over a 4 day period. T. gondii growth is
measured by their ability to incorporate tritiated uracil and is expressed as counts/minute (CPM) on the Y-axis. The X-axis describes how the T. gondii cultures
were treated. Cultures that were grown in medium (medium) produced a CPM of
around 72,000. If no T. gondii were added to the cultures (no RH), a CPM of around
2,000 was observed. Pyrimethamine (0.1 μg/ml) and sulphadiazine (12.5 μg/ml) added
to cultures resulted in a marked reduction in CPM compared with untreated cultures. At a dose of 3.12 mM NMPG (3.12) restricted around 60% of CPM and at a dose of 4.5 mM it inhibited parasite growth by around 80%, with counts of about 12,000 CPM.
In FIG. 4C the ordinate shows uptake of tritiated uracil into T. gondii nucleic
acids; inhibitory effects ofNPMG on nucleic acid synthesis is shown; where PABA at
increasing concentrations is added to such cultures, PABA abrogates the inhibitory
effects ofNPMG on EPSP synthase restoring nucleic acid synthesis.
vi. Branched Chain Amino Acid Synthesis
Imidazolinones and sulfonylureas inhibit acetohydroxy acid synthase in
Apicomplexan parasites.
vii. Starch (a ylopectin) Synthesis and Degradation UDP glucose starch glycosyl transferase is inhibited by substrate competition in
Apicomplexan parasites
viii. Transit Sequences
Antisense, ribozymes, catalytic antibodies, (Pace et al. , 1992; Cate et al., 1996, Charbonnier 1997; Askari et al., 1996) conjugation with toxic compounds allow targeting of parasite molecules using transit sequences
Identification of transit sequences in Apicomplexans provides many means for disruption of metabolic pathways. Antisense or ribozymes prevent the production of
the transit peptide and associated protein. Alternatively production of transit peptide
sequences, and the conjugation to toxic molecules, allow disruption of organellar
function. Catalytic antibodies also are designed to destroy the transit sequence These antisense compounds or ribozymes or toxic molecules targeted to transit sequences with intracellular antibodies are used as medicines to inhibit the parasite.
Example 4: Plant-like Pathways and Enzymes in Apicomplexan Parasites
Plasmodium falciparum and Cryptosporidia parvum Based on the effects of inhibitors of plant-like pathways, abrogation of inhibitor
effects, and detection of specific enzymes and/or genes, Apicomplexans, in general, have plant-like pathways. Results shown in this example broaden the observations of
the presence of plant-like pathways in Apicomplexans beyond the representative parasite T. gondii.
i. Heme Synthesis
Gabaculine inhibited the heme synthesis pathway (GSAT) in Apicomplexan parasites (FIGS. IB and IC, T. gondii, FIG. 6, Cryptosporidia) but with modest or no affect on P. falciparum (Table 3, Malaria).
FIG. 6 demonstrates the effect ofNPMG, gabaculine, SHAM and 8-hydroxyquinoline and 3-NPA on Cryptosporidia in vitro. C. parvum oocysts at
50,000/well were incubated at 37° C (8% CO2) on confluent MDBKF5D2 cell
monolayers in 96 well microtiter plates with the following concentrations of each drug.
The concentrations used were: SHAM (0.2% ETOH was added) 100, 10, 1, 0.1 μg/ml; 8-hydroxyquinoline 100, 10, 1, 0.1 μg/ml; NPMG 4.5, 0.45, 0.045 μg/ml;
gabaculine 20, 2, 0.2 μg/ml. The level of infection of each well was determined and
analyzed by an immunofluorescence assay at 48 hours using an antibody to C. parvum
sporozoites made in rabbits at a concentration of 0.1%. Fluorescein-conjugated goat anti-rabbit antibody was used at a concentration of 1%. 95% Cl count was the mean parasite count per field when 16 fields counted at lOx magnification ± s.d. of the mean. The approximate 95% Cl counts were as follows: media and ethanol ~ 1200;
paromomycin (PRM) and ethanol ~ 100; SHAM 100 μg/ml ~ 400; SHAM
10 μg/ml ~ 1100; SHAM 1 μg/ml ~ 1100; SHAM 0.1 μg/ml ~ 1200; media alone ~ 800 μg/ml; PRM -200; 8-OH-quinoline 100 μg/ml; -300; 8-OH-quinoline 10 μg/ml; - 900; 8-OH-quinoline 1 μg/ml ~1100; 8-OH-quinoline 0.1 μg/ml - 1300; NPMG
4.5 μg/ml - 900; NPMG 0.45 μg/ml - 1200; NPMG 0.045 - 1200; gabaculine
20 μg/ml - 200; gabaculine 2 μg/ml -600; and gabaculine 0.2 μg/ml - 1300. Thus
each of these compounds are promising lead compounds as antimicrobial agents effective against Cryptosporidia.
ii. Glyoxylate cycle
3-NPA inhibited the glyoxylate cycle (isocitrate lyase) and/or succinate dehydrogenase in Apicomplexan parasites (FIG. 2B, T. gondii) and also inhibited P. falciparum and C. parvum.
To determine whether there is an Apicomplexan glyoxylate cycle, to analyze the sensitivity of T. gondii tachyzoites and bradyzoites to glyoxylate cycle inhibitors and to determine whether Apicomplexan parasites have isocitrate lyase which presents a
unique pathway for lipid metabolism that can be targeted with inhibitors, the following methods are suitable.
The inhibitor of isocitrate lyase is 3-nitropropionic acid (concentration ranging from 0.005 to 5mg/ml in vitro, and 5 to 50 mg/kg/day in vivo). Mutants [Yale Stock
Center] used for complementation are as follows: E. coli strains; DV 21A01 (aceA
which lacks isocitrate lyase) and DV21 A05 (aceB which lacks malate synthase). Plant gene sequences suitable for comparison are those described by Kahn et al. (1977),
Maloy et al. (1980); and Maloy et al. (1982). A biochemical assay for isocitrate lyase
activity is the method of Kahn et al. (1977). The polyclonal antibodies to cotton malate
synthase and cotton isocitrate lyase which hybridize to T. gondii proteins of
approximately 60 kd are used to identify these enzymes in other Apicomplexan
parasites.
in. Alternative Oxidase
SHAM and 8-hydroxyquinoline inhibited the alternative pathway of respiration, i.e., the alternative oxidase in Apicomplexan parasites [FIG. 3, T gondii; FIG. 6,
Cryptosporidia parvum, Table 3, Plasmodium falciparum (clones W2, D6),
pyrimethamine resistant or sensitive clones Because Cryptosporidia appear to lack
mitochondria, the plastid is a likely site for the alternative pathway of respiration
Effect of SHAM on wild type malaria in vitro had been described earlier (Fry and Beesley, 1991) However, this observation was presented without knowledge that SHAM affected alternative oxidase function
IV. Shikimate/Chorismate
NPMG inhibited the shikimate pathway in Apicomplexan parasites (FIG. 4B,
T. gondii, Table 4, Mαlαriα; FIG. 6, Cryptosporidia)
Presence of a product of the enzymatic reaction in the pathways of the present invention abrogates the effect of the inhibitor on a specific enzyme because the product
no longer has to be made by enzyme catalysis of a substrate. Thus, addition of the
product proves the specificity of the effect of the inhibitor on the enzyme. The addition of PABA abrogates the exogenous effect ofNPMG which is an inhibitor of EPSP
synthase (FIG. 4B, T. gondii). Because PABA ablates the effect of the inhibitor
NPMG on EPSP synthase, the presence of the shikimate pathway in Apicomplexan parasites is demonstrated.
Other specific methods to determine whether Apicomplexan parasites have a metabolically active EPSP synthase enzyme involved in conversion of shikimate to
chorismate and further characterize this metabolic pathway in T. gondii are as follows: Use of the inhibitor N-(phosphonomethyl) glycine (concentrations of 3.125mM
in vitro and 100 mg/kg/day in vivo). The product rescue assays are performed with PABA. The mutants for complementation are as follows: E. coli, AroA; E. coli, AroC,
and yeast, AR. [Yale Stock Center] Plant gene sequences for comparison are outlined by Klee et al. (1987). A biochemical assay for EPSP synthase activity in cellular lysates is as described by Mousdale and Coggins (1985). Other enzymes in this pathway also
are characterized (Nichols and Green, 1992). The full length nucleotide sequence of
chorismate synthase was obtained following restriction digestion and primer-based sequencing of the Tg EST zyllc05.rl clone obtained from the "Toxoplasma EST Project at Washington University" and of P. falciparum EST czap PFD d2.1 clone
obtained from the "malaria EST project," D Chakrabarti, Florida. The Toxoplasma
gondii sequence has substantial homology with tomato and several other chorismate
synthases and a region of the 71 gondii protein has 30% identity and 45% homology with the transit sequence of Zea mays (sweet com). Other inhibitors of EPSP synthase
are Inhibitors 4 and 5, sulfosate (Marzabadi et al., 1996). Other inhibitors of enzymes in this pathway also have been developed by others and provide a paradigm for the
rational synthesis of competitive substrate inhibitors of Apicomplexan parasites. v. Branched Chain Amino Acid and Other Essential
Amino Acid Synthesis
Acetohydroxy acid synthase is an enzyme present in plants but not animals and
is inhibited by imindazolinones and sulfonylureas in Apicomplexan parasites. Inhibitors of histidine synthesis restrict growth of Apicomplexan parasites. vi. Starch (Amylose/Amylopectin) Synthesis and Degradation
UDP glucose starch glycosyl transferase, starch synthetase and Q (branching)
enzymes are inhibited by substrate competitors in Apicomplexan parasites. vii. Lipid Synthesis
The plant-like acetyl coA decarboxylase is inhibited by a number of inhibitors
shown in Table IB. Linoleic acid and linoleneic acid synthases are inhibited by newly
designed competitive substrates. viii. Auxins and Giberellins The known auxin mimics and Giberellin synthesis and Giberellin inhibitors
inhibit Apicomplexan parasites' growth.
ix. Glutamine/Glutamate Synthesis
Glufosinate inhibits Apicomplexan glutamine/glutamate synthesis because the critical enzyme is plant-like. x. Transit Sequence
The transit sequence is conjugated with toxic molecules such as ricins and used
to disrupt plastid function in Apicomplexans. Other strategies, such as antisense, ribozymes or the use of catalytic antibodies prevent translation of DNA to protein or catalyze the destruction of mature protein. This interferes with functioning of the
molecule and thus the parasite's growth and survival.
Example 5: The Combined Effects of lnhibitors of Apicomplexan Parasites The effect of enzymes in pathways "in parallel" are additive and in "series" are more
than the additive effect of either inhibitor used alone (i.e., synergistic). FIG. 5
demonstrates the inter-relationship of the shikimate pathway and heme synthesis with the electron transport chain. The shikimate pathway produces 3,4-dihydroxybenzoate which is converted to ubiquinone, an essential component of the electron transport
chain. Thus, NPMG, an inhibitor of EPSP-synthase, indirectly affects ubiquinone production and, thus, the electron transport chain. Similarly, heme is required for the production of cytochromes in the electron transport chain. Thus, inhibition of heme
production by gabaculine also indirectly affects the conventional electron transport chain. This scheme allows synergistic combinations of drugs. Thus, NPMG and
sulphadiazine (a competitive PABA analogue) which act at different points of the folate synthesis pathway are predicted to be synergistic, whereas the effects of gabaculine and sulphadizine (a competitive PABA analogue) which act on different pathways, are
predicted to be additive Similarly, gabaculine and SHAM are a predicted synergistic combination of inhibitors Table 4 demonstrates the additive inhibitory effect of
sulphadiazine and gabaculine on the growth of T. gondii over 4 days in culture T. gondii growth is measured by their ability to incorporate tritiated uracil and is expressed as counts/minute (CPM) Cultures that were grown in medium (medium)
produced a CPM of about 36,000 If no T gondii were added to the cultures (no RH),
a CPM of about 2,000 was observed Pyrimethamine (0 1 μg/ml) and sulphadiazine
(12 5 μg/ml) added to cultures resulted in a marked reduction in CPM compared with
untreated cultures The growth of T. gondii was inhibited by about 60% in cultures
treated with 5 mM gabaculine (gabaculine) The growth of T. gondii in cultures treated
with sulphadiazine (1 56 μg/ml) was reduced by approximately 60% When this dose
of sulphadiazine was used in combination with 5 mM gabaculine, as expected, the
combined effect of gabaculine plus sulfadiazine is additive because the pathways are in
parallel In contrast, NPMG and sulfadiazine combine in a synergistic manner
Because heme is needed for conventional mitochondria! respiration, it is expected that if both the heme synthesis and alternative oxidase pathways are present, then 3-amino- 2,3-dihydrobenzoic acid and SHAM will demonstrate synergy Similarly, ubiquinone or
end products of the shikimate pathway are needed for mitochondrial respiration and
NPMG plus SHAM therefore demonstrate synergy Table 4 also shows that, the
effects of gabaculine and SHAM are not synergistic as would be predicted by this
simple model The likely reason for this is that ALA synthase is present in T. gondii
and provides a default pathway for the synthesis of δ-aminolevulinic acid Thus, the
effects of gabaculine plus SHAM are not synergistic Cycloguanil which affects the
plant-like DHFR-TS of T. gondii (McAuley et al, 1994) also is synergistic with NPMG and other inhibitors of enzymes in the shikimate pathway which provides an improved, novel method to treat this infection. Use of synergistic combinations provide an
improved strategy for the development of new medicines for the treatment of disease
and eradication of the parasite.
Example 6: Effects of Inhibitors In Vivo
Candidate inhibitors are administered to animals by daily intraperitoneal
injection or by addition to the drinking water To inhibit EPSP synthase, in vivo,
NPMG is administered at a dose of 1 OOmg/kg/day
a) Survival Five hundred tachyzoites of the RH strain are administered intraperitoneally to BALB/c mice Cumulative mortality is followed in groups of mice given inhibitor compared to untreated controls
b) Formation of Cysts. C3H/HeJ mice that have been infected perorally with the Me49 strain of T. gondii for 30 days are treated with the inhibitor for 30 days
Cyst burden and pathology in the brains of inhibitor-treated and control mice are compared using methods described previously (Roberts, Cruickshank and Alexander,
1995, Brown et al., 1995, McLeod, Cohen, Estes, 1984, McLeod et al, 1988) Cyst numbers present in a suspension of brain are enumerated, or cyst numbers in formalin fixed paraffin embedded sections are quantitated
c) Persistence of Cvsts C3H/HeJ mice are infected orally with 100 cysts
of T. gondii (Me49 strain) Inhibitors are administered to groups of mice from day 30 post infection to day 50 post infection Cyst burden, mortality and pathology are compared in treated and control mice on days 30 and 50 post infection and in mice that
receive antibody to gamma interferon which leads to recrudescence of disease
d) Synergy If marked synergistic effect is demonstrated in vitro by showing that the subinhibitory concentrations used together exert an effect greater than
the additive effects of each used separately, for any combinations, their effect alone and
together in vivo is compared e) New Assays Which Determine the Effects of Antimicrobial Agents on T. gondii In Vivo
Previously reported assay systems measure protection against death following
intraperitoneal infection if an animal is infected with the virulent RH strain of T. gondii Novel aspects of the assay systems in the present invention are using the Me49 (AIDS
repository) strain of T. gondii to determine the effect on brain cyst number following acute peroral infection by an Apicomplexan parasite, the effect on the established number of brain cysts during subacute/chronic infection, and use of the Me49 and RH strains to demonstrate synergy of inhibitors of plant-like pathways of the present invention which are "in series," and a novel system to demonstrate reduction of parasitemia which is quantitated using a competitive PCR technique In this
competitive PCR method the T. gondii B 1 gene is amplified by PCR in the presence of a construct which produces a product slightly smaller than the wild type B 1 gene The
amount of construct can be quantitated to semiquantitate the amount of the competing
wild type gene For example, presence of a greater amount of the wild type gene will
result in lesser use of the competitor f) Effect of Antimicrobial Agents on Apicomplexan Parasites In Vivo
A demonstration of the effect of inhibitors of plant-like metabolic pathways
m vivo is the synergistic effect ofNPMG and low dosage pyrimethamine NPMG is an inhibitor of infection and promotes survival of mice infected with the virulent RH strain
of T. gondii when utilized in conjunction with a low dose of pyrimethamine, whereas neither low dosage pyrimethamine nor NPMG alone are protective Sulfadiazine reduced manifestations of infection in vivo SHAM affects parasitemia and number of
brain cysts
FIG. 8 demonstrates the ability ofNPMG and pyrimethamine administered in combination to protect mice from an otherwise lethal challenge with the virulent RH strain of T. gondii Mice were infected intraperitoneally with 500 tachyzoites and left
untreated (control) or treated by the addition of pyrimethamine (PYR), NPMG
(NPMG) or both pyrimethamine and NPMG (PYR NPMG) to their drinking water Percent survival is marked on the Y-axis and days post infection on the X-axis
Untreated mice and those treated with either pyrimethamine or NPMG died between
day 7 and 9 post infection In contrast 66 percent of mice treated with pyrimethamine and NPMG survived until day 9 post infection and 33 percent survived until the conclusion of the treatment (day 30 post infection) After the withdrawal of treatment, all of these mice survived until the conclusion of the experiment (day 60 post infection)
Example 7: Presence of an Enzyme in a Specific Life Cycle Stage Predicts
Efficacy of lnhibitors of the Enzyme on this Stage of the Parasite The effect of candidate inhibitors on different life cycle stages and their effect
on stage conversion is of considerable interest and clinical importance The bradyzoite
form of T. gondu was studied by electron microscopy and was found to have a plastid
Intraparasite immunolocalization of the enzymes is also performed Gabaculine treated
cultures are stained with antibodies to tachyzoites and bradyzoites Tachyzoites of the
RH strain are grown in the peritoneum of ND4 mice for 3 days Tachyzoites are
harvested in saline (0 9%) from the peritoneal cavity of euthanized mice and purified by filtration through a 3 μm filter. Bradyzoites are isolated as described herein in the Material and Methods The tachyzoites are pelleted by centrifugation and the pellet is fixed in 2 5% glutaraldehyde Cysts and bradyzoites are purified from the brains of
C57BL10/ScSn mice as described herein in the Materials and Methods and then fixed in 2.5% glutaraldehyde
lmmunoelectronmicroscopy is as described by Sibley and Krahenbuhl (1988) using gold particles of different sizes with antibodies to the enzymes to identify the
enzyme localization in different organelles which are identified morphologically lmmunoelectronmicroscopy localization is accomplished with Amersham Immunogold
kit and cryosectioning using standard techniques in the electronmicroscopy facility at
the University of Chicago or at Oxford University, Oxford, England Extracellular
organisms are studied as well as tachyzoites and bradyzoites at intervals after invasion Morphology of the parasites, their ultrastructure and the localization of the intracellular
gold particles conjugated to the antibodies is characterized Invasion is synchronized
by placing tachyzoites and bradyzoites with P815 cells at 4°C, then placing cultures at
37°C Intervals to be studied are before 1, 5, and 10 minutes and 4 hours after
invasion
Immunostaining and immunoelectronmicroscopy using an antibody to soybean,
or synechococcus, or barley GSAT indicate whether the enzyme is present or absent in
both the tachyzoite and bradyzoite life cycle stages and localizes the enzyme in the
parasite. a) Immunostaining for tachyzoites and bradyzoites
Immunostaining of tachyzoites and bradyzoites is evaluated with fluorescent
microscopy. This is performed on cultures of fibroblasts in Labtech slides infected with
tachyzoites (RH strain) or bradyzoites and permeabilized using triton, or saponin or methanol, as described by Weiss et al., 1992; Dubremete and Soete, 1996; Bohne et al. (1996). Slides are stained 1, 2, 4, 6, and 8 days post infection with anti-BAG (Weiss
et al., 1992) and anti-SAGl (Mineo et al., 1993; McLeod et al., 1991; Roberts and
McLeod, 1996). b) Antibodies
Antibodies to the bradyzoite antigens (Weiss et al., 1992; and Bohne et al.,
1993) and monoclonal and polyclonal antibodies to SAG1 (Kasper et al. 1983) as a
marker for tachyzoite stage specific antigens are used for immunostaining of parasites to establish stage of the parasite. Transgenic parasites with bradyzoite genes with reporter genes are also useful for such studies.
c) Inhibitors and Stage Switching
The effect of inhibitors of conventional (KCN, Rotenone, Antimycin A or
Myxothiazol) respiration and alternative respiration on inhibition of growth of
tachyzoites and bradyzoites are compared using standard inhibition experiments in
conjunction with immunostaining techniques. Tachyzoites use conventional and alternative pathways of respiration whereas the bradyzoite stage relies on alternative
respiration Inhibitors of conventional respiration favor tachyzoite to bradyzoite
switching whereas inhibitors of alternative respiration inhibit tachyzoite and bradyzoite
stages d) Synergy studies, gabaculine treatment Synergy studies with gabaculine are of particular interest because heme is used in the conventional oxidase pathway If there is synergy, iron influences stage switch¬
ing For alternative oxidase, immunostaining for bradyzoites and tachyzoite antigens is performed using gabaculine treated and control cultures This is especially informative concerning whether bradyzoites utilize alternative oxidases exclusively, because gabaculine treatment of cultures would limit use of conventional oxidases and thereby
select bradyzoites. e) Western Blot Analysis, and ELISAs to determine stage specific expression of enzymes
Bradyzoites and tachyzoites also are compared directly for the relative amounts
of alternative oxidase, using northern blot analyses, enzyme assays of parasites, isolation of mRNA and RT-PCR, using a competitor construct as an internal standard,
and by Western blotting and ELISAs using antibodies to the enzymes (e.g., alternative
oxidase) UDP-glucose-starch glycosyl transferase, chorismate synthase, isocitrate lyase, GSAT also are studied in a similar manner
Example 8: Probing Apicomplexan DNA with Homologous Plant-like Genes or
Potentially Homologous Genes From Other Parasites
The presence of the gsa genes, alternative oxidase genes, EPSP synthase genes,
chorismate synthase genes, isocitrate lyase genes, and malate synthase genes are identified by probing, and then sequenced. For example, the cDNA clone of soybean gsa is labeled for chemiluminescent detection (ECL) or 32P detection to identify
homologous gsa sequences in T. gondii. Probes are used on a membrane containing the genomic DNA of T. gondii and soybean (positive control). When T. gondii genes are isolated, they are used to probe other Apicomplexan DNA. Thus, the gsa genes of Cryptosporidia, Eimeria, and Malaria are detected in the same manner as the T. gondii
gsa. In addition, DNA probes complementary to Trypanosome alternative oxidase
DNA are used to probe the Apicomplexan DNA. The gene for T. gondii alternative oxidase is identified by screening T. gondii cDNA expression libraries using the 7D3
monoclonal antibody or the tobacco alternative oxidase gene used as a probe and thus detecting the gene expressing the relevant protein. This gene is used to detect the
alternative oxidase genes of other Apicomplexan parasites by Southern analysis and screening other Apicomplexan cDNA libraries.
A nucleotide sequence generated from random sequencing of a T. gondii
tachyzoite cDNA library and placed in the Genbank database was found to encode a protein with homology to tomato chorismate synthase. The EST was obtained, cloned
and the full length sequence of the T. gondii chorismate synthase gene and deduced
amino acid sequences were obtained (FIGS. 9 and 10). This provides evidence for
these plant-like pathways and information useful in preparing a probe to isolate and
sequence this full gene from other Apicomplexan parasites as well. This gene was used as a probe and identified a chorismate synthase in Eimeria bovis DNA and
Cryptosporidium parvum DNA. A P. falciparum EST has also been cloned and sequenced. Probes for gsa (soybean) alternative oxidase (soybean and tobacco),
isocitrate lyase (cotton), UDP glucose starch glycosyl transferase (sweet com), and acetohydroxy acid synthase (sweet co ) also are used to screen for clone, and
sequence Apicomplexan genes. Large numbers of T. gondii genes from tachyzoite and bradyzoite cDNA libraries are being sequenced and deposited in Genbank. Putative
homologous genes encoding plant enzymes are used to compare with these sequences to determine whether they are identified in the libraries and if so to determine whether
the enzymes are encoded in the nucleus or plastid.
Example 9: Identification of Genes Encoding Enzymes of the Plant-Like Biochemical Pathways in Apicomplexan Genes are isolated from a cDNA library by hybridization using specific probes
to genes known to encode enzymes in metabolic pathways of plants, (see Example 9) Genes are cloned by complementation from a T. gondii cDNA expression library using
a series of E. coli mutants that lack these enzymes and thus depend on the addition of exogenous additives for their optimal growth. Transformed bacteria are used to isolate
and sequence plasmid DNA and from those sequences, probes are generated to determine whether other Apicomplexans have genes homologous to those in T. gondii.
1 ) cDNA libraries A cDNA library was constructed by Stratagene from
mR A isolated from T. gondii tachyzoites of the Me49 strain of T. gondii using the
Uni-ZAP XR cDNA library system. The titer of the amplified library is 1-2 X lθ'7ml. Other cDNA libraries also are utilized.
The phagemids were excised with R408 or VCS-M13 helper phage and
transduced into XLl-Blue Cells. The plasmid DNA was purified using the Qiagen maxiprep system. Other libraries, e.g. , early Me49 bradyzoite, in vivo Me49
bradyzoite, and Me49 tachyzoite libraries also are suitable, as are other tachyzoite and bradyzoite libraries prepared by Stratagene.
2) Screening of library for genes. This is done in a standard manner using monoclonal or polyclonal antibodies or a radiolabeled gene probe. 3) cDNA expression libraries are probed with DNA from the genomes of: a) Toxoplasma gondii;
b) Plasmodium malar iae; c) Cryptosporidium parvum; d) Eimeria.
The existence of plant-like pathways is confirmed in members of the
Apicomplexa by demonstrating the existence of genes encoding the enzymes required for the pathways. Genomic DNA is examined by Southern blot analysis for the
presence of the sequences encoding enzymes required for specific algal or plant metabolic pathways. Genomic DNA is extracted from Apicomplexan parasites by
proteinase K digestion and phenol extraction. DNA(5-10μg) is digested with restriction enzymes, electrophoresed through 1% Agarose and transferred to a nylon
membrane. The ECL (Amersham) random prime system is used for labeling of DNA
probes, hybridization and chemiluminescence detection Alternatively, the Boehnnger
Mannheim Random Prime DNA labeling kit is used to label the DNA with 32P with unincorporated nucleotides removed using G-50 Sephadex Spin columns Hybridiza¬
tion with the 32P-labeled probe is carried out in [1M NaCl, 20 mM NaH2 PO4 pH 7 0, 1% SDS, 40% formamide, 10% dextran sulfate, 5 mg/ml dry milk, 100 μg/ml salmon
sperm DNA] at 37°C Washes are optimized for maximum signal and minimum background Probes are prepared from T. gondii cDNA clones obtained and characterized as described in Example 9 If lack of overall sequence conservation limits
ability to detect homology, highly conserved regions are useful For example, two highly conserved regions of the gsa gene are useful to generate oligonucleotide probes (Matters et al., 1995)
4) PCR An alternative approach for identifying genes encoding enzymes of the present invention is by using PCR with primers selected on the basis of homologies already demonstrated between plant protein sequences for the relevant gene For example, for the gsa gene, polymerase chain reaction technology is used to amplify homologous sequences from a T. gondii cDNA library or T. gondii genomic
DNA using primers generated from two highly conserved regions of GSAT The
Neurospora crassa alternative oxidase gene has been isolated using degenerate primers designed from conserved regions in alternative oxidase sequences from plant species
(Li et al., 1996) These primers are used to detect and clone the alternative oxidase
gene from T. gondii Candidate PCR products are cloned using the Invitrogen TA
cloning kit.
5) Sequencing DNA from candidate cDNA clones is extracted using the Promega Wizard Miniprep System Clones of interest are purified in large scale using
the Maxiprep Protocol (Qiagen) and are sequenced by modified Sanger method with an
automated sequencer (ABI Automated Sequencer) by the University of Chicago Cancer Research Center DNA Sequencing Facility
6) Homology Search to determine whether there is homology of isolated
genes with other genes, e.g. gsas, sequences are compared against those in Genbank
using the BLASTN (DNA → DNA) and BLASTX (DNA → Protein) programs
T. gondu sequence data is available in Genbank Sequences for plasmodia also are available as are some isolated sequences for the other Apicomplexan parasites
T. gondii sequences are searched for homologies to the known plant genes gsa,
glutamyl-tRNA reductase, isocitrate lyase, malate synthase, alternative oxidase, EPSP
synthase, and chorismate lyase using the BLASTN (DNA→ DNA) and TBLASTN
(Protein — > Conceptual Translation of DNA Sequence) programs The conserved plant
gene sequences for the shikimate pathway are those described by Kahn et al. ( 1977) and Maloy et al. ("1 80, 1982) Conserved plant gene sequences for comparison of
homologies are outlined by Klee et al. (1987) Similar libraries and sequence data for
Plasmodia also are compared for homologies in the same manner
7) Complementation To isolate T. gondii genes or to demonstrate that a gene encodes a functional enzyme product, plasmids from the cDNA library detailed above, or modified constructs, are used to complement E. coli mutant strains GE1376
or GE1377 (hemL) and RP523 (hemB) from the Yale E. coli genetic stock center and
SASX41B (hemA) from D. Soil. This strategy has been successful for cloning gsa genes from plants and algae (Avissar and Beale, 1990; Elliott et al, 1990; Grimm, 1990; Sangwan and O'Brian, 1993). The hemA gene encodes glutamate-tRNA
reductase, an enzyme important in the C5-pathway for heme synthesis. The hemB gene
encodes ALA dehydratase, an enzyme common to both heme biosynthesis pathways
that should be common to all organisms and is included as a positive control. Mutant bacteria are made competent to take up DNA with CaCl2 treatment and are transformed with plasmids from the cDNA library. Briefly, chilled bacteria
(O.D. 550nm ~0.4-0.5) are centrifuged to a pellet and resuspended in ice-cold 0. IM CaCl2 and incubated for 30 minutes on ice. Following further centrifugation, the
cells are resuspended in 0.1 M CaCl2, 15% glycerol and frozen at -80°C in
transformation-ready aliquots. 0.2ml ice-thawed competent bacteria are incubated on
ice for 30 minutes with approximately 50ng plasmid DNA. Cells are placed at 43°C for 2.5 minutes and cooled on ice for 2 minutes. Following the addition of 0.8ml Luria Broth, cells are incubated at 37°C for 1 hour and 0.1ml is plated onto M9 minimal
media plates. The M9 (Ausubel et al, 1987) medium contains 0.2% glycerol as the
carbon source, 1 mM MgSO4, O. lmM CaCl , 1 mM IPTG, 0.2 mg/ml Ampicillin, and
40 μg/ml threonine, leucine, and thiamine. Nonselective medium contains 25 μg/ml δ-
aminolevulinic acid (hemL and hemA) or 4 μg/ml hemin (hemB). Alternatively, bacteria can take up DNA by electroporation. Chilled bacteria are prepared by a repetition of
centrifugation and resuspension. The cells are washed in an equal volume of cold
water, a VΪ volume of cold water, a 1/50 volume of cold 10% glycerol, and finally in a
1/500 volume of cold 10% glycerol and frozen in 0.04 ml aliquots at -80°C. Cells are
thawed at room temperature and chilled on ice. Cells are mixed with the DNA for 0.5-1 minutes and then pulsed at 25μF and 2.5 KV. The cells are rapidly mixed with SOC medium and grown at 37°C for 1 hour. Cells are plated in the same way as for
CaCl transformation.
Successful complementation of the E. coli mutants with a T. gondii gene is
determined by plating the transformed bacteria onto minimal medium which lacks the supplement required for optimal growth of theE. coli mutant. Growth on the selective
medium is compared to growth on nonselective medium, which contains 25 :g/ml δ-
aminolevulinic acid (hemL or hemA) or 4 μg/ml hemin (hemB). Clones that complement each E. coli mutant are tested for their ability to complement each of the
other mutants. Clones of putative T. gondii gsa and glutamate-tR A reductase should
complement only hemL and hemA mutants, respectively. Clones that suppress more than one hem mutation are candidates for alternative oxidase gene clones. A cDN A clone containing the entire soybean gsa gene was able to transform the
E. coli hemL mutant from auxotrophic to prototrophic for δ-aminolevulinic acid
(ALA). Thus the system for obtaining T. gondii genes that complement E. coli mutants is available.
For the glyoxylate cycle the mutants used for complementation are as follows:
DV21 AOl (aceA which lacks isocitrate lyase) and DV21 A05 (aceB which lacks malate synthase).
For the shikimate pathway the mutants for complementation are available and used as follows. E. cob, AroA and yeast AR
The same procedures are used for Plasmodium falciparum and Plasmodium knowlesii, Cryptosporidium and Eimeria complementation When transit sequences lead to production of a protein which does not fold in such a manner that the protein
can be expressed in E. cob or yeast constructs that lack these sequences are prepared to use for complementation that lack these sequences
Example 10: Analysis of Alternative Oxidases in T. gondii
T. gondii bradyzoites use unique alternative oxidases Alternative oxidases are necessary and sufficient for bradyzoite survival Methods to characterize plant alternative oxidases are as described (Hill, 1976, Kumar and Soil, 1992; Lambers, 1994; Li et al, 1996, Mclntosh, 1994)
For in vitro studies, cell lines that lack functional mitochondria are used These
cell lines are used to allow the study of inhibitors effective against the conventional or alternative respiratory pathways within the parasite, but independent from their effects on the host cell mitochondria SHAM, an inhibitor of the alternative respiratory
pathway is used at concentrations between 0 25 and 2 μg/ml in vitro, and 200
mg/kg/day orally or parenterally in vivo alone or in conjunction with other inhibitory compounds Other approaches include complementation of alternative oxidase-
deficient E. cob mutants to isolate and sequence the alternative oxidase gene,
immunostaining using antibodies for potentially homologous enzymes, enzymatic assay
and the creation of mutant-knockouts for the alternative oxidase gene and studying stage specific antigens in such knockouts
1) Cell lines Two cell lines, a human fibroblast cell line (143B/206)
lacking mitochondrial DNA, and the parental strain (143B) which possess functional
mitochondria are used These cell lines have been demonstrated to support the growth of T. gondii (To avo and Boothroyd, 1995)
2) Inhibitor studies Inhibitor studies are carried out as described herein
SHAM concentrations are 0 25 to 2 mg/ml in vitro and 200 mg/kg/day in vivo
3) Immunostaining for tachyzoite and bradyzoites Immunostaining is performed on cultures of fibroblasts in Labtech slides infected with tachyzoites (RH strain) as described herein Slides are stained 1, 2, 4, 6 and 8 days post infection with
anti-BAG and antiSAGl
4) RT-PCR is as performed using the protocol of Hill (Chaudhuri et al ,
1996) with degenerate primers based on consensus sequences The product is cloned,
sequenced and homology with known alternative oxidases documents its presence
5) Complementation and alternative oxidase gene cloning Complementation is used to demonstrate function and is an alternative approach to isolate the gene Proper function of the complementation system is demonstrated by
using complementation with a plant alternative oxidase gene Mutants suitable for use
are hemL, hemA, hemB The alternative oxidase gene, AOX, is cloned from a T gondii cDNA expression library by complementation of the E. cob hemL mutant HemL
mutants of E. cob cannot synthesize heme and are therefore deficient in respiration
This cloning strategy has been successful in isolating AOX genes from Arabidopsis
(Kumar and Soil, 1992) The procedure employed for recovering transformants is
identical to that used for cloning the T. gondii gsa gene The distinction between the gsa and AOX genes is that the AOX gene should restore function not only to hemL
mutants but also to other hem mutants of E. cob In addition, respiratory growth of E.
cob on the alternative oxidase should be antimycin-insensitive and SHAM-sensitive Clones recovered are tested for complementation of hemL, hemB and hemA mutants Growth is tested for inhibitor sensitivity Sequences of cDNA clones that provide
functional alternative oxidase activity by these tests are compared with known AOX gene sequences (Mclntosh, 1994)
The Escherichia cob strain XL 1 -Blue was prepared for infection with the 7. gondii phage library according to Stratagene manufacturer's protocol The RH
tachyzoite library, in the λ-ZAP vector system was titred, and 106 pfu are added to the
XL 1 -Blue preparation Approximately 6 X 105 plaques are plated on agar onto
150 mm2 petri dishes containing NZY medium, and grown at 42°C for 3 5 or 8 hours,
depending upon which screening method is employed If antibodies are used for screening, IPTG-soaked nitrocellulose filters are placed on the plates after the short incubation period, and the growth of the plaques is allowed to proceed for an equivalent period of time Filters are blocked in BLOTTO overnight Screening is
carried out under the same conditions which had been optimized during Western
blotting with that primary antibody, and the appropriate secondary antibody If DNA probes are used for screening, the plaques are grown for 8 hours post-infection, and
placed at 45°C for 2 hours to overnight. Nitrocellulose filters are placed on the plates,
and all subsequent steps for lysis and fixing of the DNA are as specified in the
Stratagene protocol. Filters are placed into a pre-hybridization solution containing
Denhardts, SSC, SDS, and denatured salmon sperm DNA, as directed in Ausubel et al.
(1987). Blots are hybridized to 32P-labeled probe overnight. Low stringency washes, containing 5X SSC and 0.1% SDS are performed twice at room temperature, and high stringency washes with 0.2X SSC and 0.1% SDS are performed at a temperature
dependent upon the degree of homology between the probe and the T gondii DNA.
6) Assays for the presence of genes: Evidence for the presence of the genes which encode the novel enzymes is obtained by demonstrating enzyme activity and/or Western blot analysis of Apicomplexan whole cell lysates and/or polymerase
chain reaction and/or probing the genomic DNA of the parasite with the homologous DNA. Identification of the genes is accomplished by screening an Apicomplexan cDNA library with the antibody to homologous enzymes from plants or other
microorganisms or probes which recognize the genes which encode them and/or complementation of mutant bacteria lacking the enzyme with Apicomplexan DNA.
7) Mutant-Knockouts : The alternative mitochondrial oxidase pathway is the preferred oxidative pathway for bradyzoites and is likely to be important for their
survival. The genetic system used to examine the function of the gene via targeted
gene knock-outs and allelic replacements essentially as described (Donald & Roos,
1993, 1994, 1995). The alternative oxidase is not absolutely required for growth when
cytochrome oxidase can be active and mutants are recoverable. The AOX-null strains
may be hypersensitive to GSAT inhibitors, both in vitro and in vivo. The ability of the
AOX-null strains to switch stages, both in vitro and in vivo is determined. The AOX- null strains are examined for stage specific antigens. Virulence and ability to form cysts are assessed in vivo in C3H HeJ mice as described herein.
Knockouts with a bradyzoite antigen reporter gene are produced and these
constructs and organisms with the genes knocked out are cultured under conditions that would ordinarily yield a bradyzoite phenotype. These are used to determine whether expression of the "knocked out" gene is critical for bradyzoite antigen expression and the bradyzoite phenotype.
8) Similar "knockouts" of EPSP synthase or chorismate synthase are produced.
9) Similar procedures are used for other Apicomplexan parasites. For example, a similar genetic system is available for P. falciparum.
Example 11: Production, Testing, and Use of Vaccines against Apicomplexa "Knock out" organisms (e.g., lacking GSAT, or alternative oxidase or EPSP-
synthase or chorismate synthase or UDP-glucose starch glycosyl transferase) are
produced as described herein. The knock-out vaccine strain in some cases is cultivated in tissue culture because components which are deficient are provided by a single product or a plurality of products. DNA constructs and proteins are produced and
tested as described herein (see Materials and Methods) using unique genes and
sequences and assay systems and methods which are known to those of skill in the art
and disclosed herein. Briefly, they are used to immunize C3H mice, and tissues of
immunized and control mice are subsequently examined for persistence of parasites.
These immunized mice and controls are challenged perorally with 100 cysts of Me49
strain or intraperitoneally with 500 RH strain tachyzoites. Effect of immunizations on
survival, and tissue parasite burden are determined (McLeod et al, 1988). Parasite burden refers to quantitation of numbers of parasites using PCR for the Bl T. gondii
gene, quantitating numbers of cysts in brain tissue, quantitating numbers of parasites by inoculating serial dilutions of tissues into uninfected mice when the RH strain of T. gondii is utilized and assessing survival of recipient mice as 1 parasite of the RH strain of T. gondii is lethal. Ability to prevent congenital transmission and to treat
congenital infections is also a measure of vaccine efficacy. Vaccines are useful to prevent infections of livestock animals and humans. Standard methods of vaccine development are used when substantial prevention of infection is achieved in murine
models.
Example 12: Nucleotide and Deduced Amino Acid Sequence of T. eondii Chorismate Synthase cDNA
Animals and most protista (e.g. Leishmania) rely exclusively on exogenous folates. Previous studies which demonstrate the efficacy of anti-folates for the
treatment of toxoplasmosis have implied that T. gondii has the enzymes necessary to synthesize folates. For this purpose, T. gondii uses PABA. The biochemical events
that lead to PABA production in T. gondii or any other Apicomplexan have not been
previously characterized. In algae, plants, certain bacteria and fungi, the shikimate
pathway facilitates the conversion of shikimate to chorismate, a three step reaction
catalyzed by three enzymes, shikimate kinase, 3-phospho-5-enolpyruvyl shikimate synthase (EPSP synthase) and chorismate synthase Chorismate is then used as a
substrate for the synthesis of PABA In plants, EPSP-synthase and chorismate synthase
are encoded in the nucleus In plants, algae and bacteria, chorismate is not only an essential substrate for the synthesis of folate, but it is required for the synthesis of ubiquinone and certain aromatic amino acids The shikimate pathway may occur both inside and outside of the plastid For example, EPSP synthase exists in two forms in
Euglena, one associated with the plastid of those grown in the light and the other found in the cytosol of those grown in the dark Apicomplexan parasites utilize the shikimate pathway for folate synthesis An
inhibitor of the EPSP synthase, an essential enzyme in this pathway, restricts the growth
of T. gondu, P. falciparum and C. parvum in vitro This inhibitor, NPMG, synergizes with pyrimethamine and sulfadiazine to prevent T gondii multiplication NPMG also synergizes with pyrimethamine to protect mice against challenge with the virulent RH
strain of 7'. gondii The sequence of a T. gondii gene that encodes a putative
chorismate synthase, that has considerable homology with chorismate synthases from other organisms, provides information useful in developing novel antimicrobial agents
A partial cDNA sequence of approximately 250 bases was identified from the
"Toxoplasma EST Project at Washington University " This sequence, when translated, had approximately 30% homology with chorismate synthase from a number of
organisms Both strands of the corresponding clone were sequenced and found to be
2312 bases in length (FIG 9) Analysis revealed a large open reading frame of 1608
base pairs which would encode a 536 amino acid protein Homology was determined
by the use of CLUSTAL X, a computer program that provides a new window base user interface to the CLUSTAL W multiple alignment program (Thompson, 1994) The deduced amino acid sequence has considerable identity (44.5 to 51 4%) with
chorismate synthases of diverse species (FIG. 10) The putative T. gondu protein
differs from other known chorismate synthases in length Chorismate synthases from other organisms range in length from 357-432 amino acids. The larger size of the T. gondii protein is due to an internal region that has no counterpart in other known
chorismate synthases and is novel. The function of this region remains to be
determined The T. gondii chorismate synthase sequence was used in a search with the BLAST program An EST from a Plasmodium falciparum cDNA library was located
that has considerable homology with the T. gondii sequence Chorismate synthase is
also present in Mycobacterium tuberculosis
The nucleotide sequence of the cDNA which encodes a putative T. gondu chorismate synthase and the amino acid sequence deduced from it is shown in FIG. 9. The deduced amino acid sequence of putative T. gondii chorismate synthase has
substantial homologies with chorismate synthases from diverse organisms including Solanum lycospersicum (tomato), Synechocystis species, Hemophilus influenza,
Saccharomyces cerevisiae, and Neurospora crassa. (FIG. 10)
The Apicomplexan data base in Genbank was searched for homologies to the
T. gondu chorismate synthase gene. A homologous P. falciparum EST (FIG. 11) was
identified. It was sequenced This provided additional evidence that at least a component of the shikimate pathway also was present in P. falciparum
Sequencing Method
Characterization of Insert and Design of Sequencing Strategy.
Clone TgESTzyl lc05 rl was obtained from the Toxoplasma project at
Washington University and supplied in the Bluescript SK vector as a phage stock
Phagemid DNA was excised by simultaneously infecting XLl-Blue cells with the phage stock and VCS-M13 helper phage Purified phagemids were used to infect XL 1 -blue cells Infected XLl-Blue cells were grown in LB media and plasmid DNA purified using Qiagen maxi-prep kits The cDNA insert was excised using EcoR I and Xho I restriction enzymes and found to be approximately 2 4KB Initial sequencing of the 5 prime end of the insert's plus strand and its translation, revealed 30% homology with
previously described chorismate synthases from other organisms However, sequencing
of the 5 prime end of the minus strand yielded a sequence that when translated had little
apparent homology with any known protein A series of restriction digestion experiments were performed to establish a restriction map of the insert Restriction
fragments were electrophoresed through a 1% agarose gel and fragments visualized by
ethidium bromide staining and ultra-violet illumination Due to the lack of available
restriction enzyme sites within the insert, sequencing with the conventional technique of using sub-cloned overlapping restriction fragments as templates would prove to be
laborious and time consuming To circumvent this potential problem and facilitate
rapid sequencing, a strategy was designed that used both conventional sub-cloned
overlapping restriction fragments with standard vector annealing primers and the full
length clone with custom designed primers Thus, sequencing was first carried out by using sub-cloned restriction fragments and the information obtained used to custom design unique sequencing primers These primers allowed efficient sequencing of the
internal regions and the external 3 prime end of each strand The customized primers
were
CUSTOMIZED PRIMERS:
CS1 5' TGT CCA AGA TGT TCA GCC T 3'
CS2 5' AGG CTG ATC ATC TTG GAC A 3' CS2 5' TCG GGT CTG GTT GAT TTT 3'
CS4 5' GAG AGA GCG TCG TGT TCA T 3'
CS5 5' ATG AAC ACG ACG CTC TCT C 3'
CS6 5' CAT GTC GAG AAG TTG TTC 3'
CS7 5' GAA CAA CTT CTC GAC ATG 3' CS8 5' ACT TGT GCA TAC GGG GTA C 3'
CS9 5' GTA CCC CGT ATG CAC AAGT 3'
CS10 5'TGAATGCAACTGAACTGC3'
CS11 5' GCA GTT CAG TTG CAT TCA 3'
CS12 5' AGCCGTTGGGTGTATAATC3' CS13 5'CTACGGCACCAGCTTCAC3'
CS14 5' CGT CCT TCC TCA ACA CAG TG3'
CS 15 5 ' GTG AAG CTG GTG CCG TAG 3 ' CS16 5' CGC CTC TGA TTT GGA AGT G 3'
CS17 5' TCT GCC GCA TTC CAC TAG 3'
CS18 5' GAA GCC AAG CAG TTC AGT T 3'
Sub-cloning
Sub-clones were made from restriction fragments isolated by agarose gel
electrophoresis and purified using the Qiaex gel extraction kit Qiagen, Chatsworth CA Double digestions of the plasmid with Hinc II and Pst I resulted in 4 fragments of 500, 800, 300 and 4000 base pairs The 800 bp fragment, corresponding to the base pairs 800-1600 was ligated into the bluescript KS vector The 1600-2400 base pair portion of the insert was obtained in a similar manner using Pst 1 and Xho I restriction enzymes and ligated into the bluescript KS vector Ligations were performed for 12 hours at 18
degrees centigrade on a PTC 100, programmable thermal cycler, MJ Research Inc
Watertown, Massachusetts. Plasmids containing the restriction fragments were used to transform DH5α competent cells. Plasmid DNA was purified using Qiagen maxi-prep
kits.
Primer Sequence Design
Primers were designed based on the sequencing information obtained from
restriction enzyme fragments To facilitate sequencing of a region on the same strand
and 5 prime to an already sequenced portion of insert, primers were designed from an
area approximately 200-300 nucleotides 5 prime into the last obtained sequence For
sequencing of the complementary strand, primers were designed to be the complement
and reverse of the same region Primers were designed to be 18-25 nucleotides in length and have a Tm of 55-60 degrees centigrade G plus C content was 45-55
percent Primers were designed to have minimal self annealing and to have a low
propensity for primer to primer annealing Primers with the ability to form stable
secondary structures were not designed These criteria for the design of primers were based on theoretical considerations and results of other experiments which found that primers which had Tms of much less than 55 degrees centigrade failed to work or
performed poorly, producing ambiguous sequences of low quality
Sequencing and Assembly of Sequence Information
All sequencing was performed using a Perkin Elmer automated sequencer The three purified plasmids containing the entire cDNA or a restriction fragment were used
as templates for sequencing reactions with the standard Ml 3 and reverse primers The sequences obtained were used to design primers which allowed sequencing of the
internal regions of the inserts This process was repeated until both strands of the entire clone were sequenced. Chromatograms were critically edited and controlled for
quality using Sequencher software. Edited chromatograms of excellent quality were assembled with the same software package and a consensus sequence obtained The consensus sequence was analyzed for open reading frames using Macvector software package Kodak International Biotechnology, Inc , New Haven, CT
Example 13: Transit Sequence of T. gondii Chorismate Synthase
Homology with other peptides was sought using the Genbank database and the
unique sequence in the T. gondu chorismate synthase (amino acids 284 to 435,
Figure 11) There was thirty percent identity and forty-five percent homology, with a number of conserved motifs, between this unique sequence of T gondii chorismate synthase and the amyloplast/chloroplast transit (translocation) sequence of the Waxy
protein (UDP-glucose starch glycosyl transferase) of Zea mays (sweet corn) The same methods whereby the Zea mays transit sequence was analyzed (Klosgen and Well, 1991), i.e , construction of the transit sequence with a reporter protein, immunolocalization of the protein, creation of the construct with deletions or mutations of the transit sequence and subcellular immunolocalization using immunoelectronmicroscopy are useful for proving that this is a transit sequence in the
T gondii chorismate synthase A useful reporter protein for a chimeric construct is β
glucoronidase of E. cob, expressed under the control of the 355 promoter of
cauliflower mosaic vims The β glucoronidase alone is expressed, in parallel The
transit peptide chimeric construct is found in the plastid The control β glucoronidase
is found in the cytoplasm Antibodies to the chorismate synthase protein are also used
to detect the presence of the product of the gene (with the transit sequence) in the
plastid and the product of a construct in which the transit sequence is not present in the cytoplasm only Further mutations and deletions are made which identify the minimal
transit sequence using the same techniques as described above for the entire peptide
Antisense, ribozyme or intracellular antibodies directed against the transit sequence
nucleic acid or translated protein are useful as medicines. The amino acid or nucleic acid which encodes the transit sequence are the bases for diagnostic reagents and
vaccine development. This transit sequence is useful for the construction of ribozyme,
antisense nucleic acids, intracellular antibodies which target a key parasite protein, and creation of constructs with accompanying molecules which are lethal to the parasites (Roush, 1997; Mahal et al, 1997). This transit sequence also is useful because it
provides a general extension of the concept of transit and targeting sequences in
Apicomplexan parasites that enable targeting of other parasite organelles in addition to plastids. The transit sequence of Zea mays and T. gondii are shown in Figure 11
Example 14. Nucleotide and Deduced Amino Acid Sequences of P. falciparum
Chorismate Synthase EST. Sequencing of P. falciparum chorismate synthase EST followed the same
pattern as described above for sequencing the T. gondii chorismate synthase gene with the following exceptions: There was difficulty in obtaining sequence from the 3 ' region
of the cDNA due to an unstable polyA tail. This made it necessary to do all sequencing approaching from the 5' end using gene walking techniques and subcloning of
restriction fragments. The AT richness of P. falciparum genes increased the
complexity of design of the customized primers. The customized primers utilized were:
PFCS 1 AGC TAT TGG GTG GATC PFCS2 TCC ATGTCC TGGTCT AGG
PFCS3 ATA AAA ACA CAT TGA CTA TTC CTT C
PFCS4 GGG GAT TTT TAT TTT CCA ATT CTT TG
PFCS5 TTG AAT CGT TGA ATGATA AGA C
PFCS6 TTT TAG ATC AGC AAT CAA ACC
PFCS7 AAC TTT TTA TCT CCATAC TTT G PFCS8 GAA GGA ATA GTC AAT GTG TTT TTA T
PCFS9 GTA TTT TAC CAA GAT TAC CAC CC
PFCS10 CCC CCA ACA CTA TGT CG
PFCS11 CAGTGGGCAAAA TAA AGA
PFCS12 CCAGTGGGC AAA ATAA PFCS13 GGA AGA GAA ACA GCC AC
PFCS14 TGC TGC TGG GGC GTG
The gene and deduced amino acid sequences are in Figure 12 Example 15: Southern Blotting Demonstrates Presence of Chorismate Synthase (and bv Inference all of the Shikimate Pathway)
in Apicomplexan Parasites
Southern blotting using the T. gondii chorismate synthase gene as a 3 P labeled probe demonstrated homology at moderate stringency (e g 0 2 x SSC, 0 1% SDS at
42°C) [more stringent conditions define greatest relatedness of genes] with Eimeria
bovis and Cryptosporidium parvum DNA
This T. gondii cDNA also comprises a probe for screening cDNA libraries of all
other Apicomplexa to identify their chorismate synthase genes. The same principles are
applicable to all the other enzymes in Table 1.
Example 16: Gene Expression. Recombinant Protein. Production of Antibody and Solving the T. gondii and P. falciparum Crystal Structures of chorismate synthase to establish their active site and secondary
structure.
These are done using standard techniques. The gene construct is placed within a competent E. coli. Recombinant enzyme is identified by homologous antibody reactivity and purified using affinity chromatography. Protein is injected into rabbits
and antibody specific to the protein is obtained and utilized to purify larger amounts of
native protein for a crystal structure. The crystal structure provides information about enzyme active site and facilitates rational drug design (Craig and Eakin, 1997).
Example 17: Other Uses (e.g. in diagnostic reagents and vaccines) of the
Chorismate Synthase Gene as a Representative Example of Uses of
Each of the Genes and Enzymes in These Pathways That are not Present or Rarely Present in Animals. These uses include T gondii genes and proteins used as diagnostic reagents and
as a vaccine to protect against congenital infection. Recombinant protein (all or part of the enzyme) is produced and is used to elicit monoclonal antibodies in mice and
polyclonal antibodies in rabbits. These antibodies and recombinant protein (e.g., to T-gondii chorismate synthase) are used in ELISA (e.g. antibody to human IgG or IgM,
or IgA or IgE attached to ELISA plate + serum to be tested + antibody conjugated to
enzyme + enzyme substrate) The recombinant proteins, pooled human sera from known uninfected individuals (5 individual sera pooled) and infected individuals (5
individuals with acute infection sera pooled, 5 individuals with chronic infection sera
pooled) are the controls This test is useful with serum or serum on filter paper
Another example of a diagnostic reagent are primers to amplify the target transit sequence or another portion of the chorismate synthase sequence unique to T. gondu
PCR with these primers is used with whole blood to detect presence of the parasite
Such assays have proven to be useful using the T. gondii ' Blgene (Kirisits, Mui, Mack, McLeod, 1996)
Another example of a diagnostic reagent is useful in outpatient settings such as an obstetrician's office or in underdeveloped areas of the world where malaria is
prevalent FABs of monoclonal antibodies (which agglutinate human red cells when ligated) (Kemp, 1988) are conjugated to antibodies to the target sequence or selected
enzyme Antigen conjugated anti-red cell Fab also is used to detect antibody to the component. A positive test occurs when the enzyme or antibody is circulating in the
patient blood and is defined by agglutination of red cells (in peripheral blood from the patient) mixed with the conjugated antibodies. Controls are the same as those specified
for the ELISA Examples of vaccines are protein, peptides, DNA encoding peptides or proteins
These are administered alone or in conjunction with adjuvants, such as ISCOMS These vaccine preparations are tested first in mice then primates then in clinical trials
Endpoints are induction of protective immune responses, protection measured as enhanced survival, reduced parasite burden, and absent or substantial reduction in
incidence of congenital infection (McLeod et al., 1988).
Example 18: T. gondii Chorismate Synthase Genomic Sequence Genomic clones are isolated from commercially available genomic libraries
(AIDS repository) using the identified cDNA clones as probes in the screening process.
The genomic library, as λ phage, is isolated onto NZY agar plates using XLl-Blue E.
coli as the host, resulting in plaques following a 37°C incubation. The cDNA sequence is radiolabeled with 32P and hybridized to nylon membranes to which DNA from the
plaques has been covalently bound. Plasmids from candidates are excised and their
restriction enzyme-digested inserts sequenced. Experimental details are as described in
Ausubel e/ α/. (1987).
Example 19: P. falciparum Chorismate Synthase Genomic Sequence.
This will be done with a gene specific subgenomic library as described in
Example 18.
Other examples of enzymes and the genes which encode them and which are characterized as outlined above include: glutamyl-tRNA synthetase; glutamyl-tRNA
reductase; prephenate dehydrogenase aromatic acid aminotransferase (aromatic
transaminase); cyclohexadienyl dehydrogenase tryptophan synthase alpha subunit; tryptophan synthase beta subunit; indole-3 -glycerol phosphate synthase
(anthranilateisomerase), (indoleglycerol phosphate synthase); anthranilate
posphoribosyltranferase; anthranilate synthase component I; phosphoribosyl
anthranilate isomerase anthranilate synthase component II, prephenate dehydratase
(phenol 2-monooxygenase) catechol 1,2-deoxygenase (phenol hydroxylase), cyclohexadienyl dehydratase, 4-hydroxybenzoate octaprenyltransferase, 3-oxtaprenyl-
4-hydroxybenzoate carboxylyase dehydroquinate synthase (5-dehydroquinate
hydrolase), chorismate synthase (5-enolpyruvylshikimate 3-phosphate phosph-lyase), dehydroquinate dehydratase, shikimate dehydrogenase, 3-deoxy-d-arabino- heptuloonate 7 phosphate synthase, chorismate mutase (7-phospho-2-dehydro-3- deoxy-arabino-heptulate aldolase), 3-deoxy-d-arabino-heptuloonate 7 phosphate
synthase, shikimate 3-phosphotransferase (shikimate kinase), UDP glucose starch glycosyl transferase, Q enzymes, acetohydroxy acid synthase, chorismate synthase malate synthase, isocitrate lyase, 3 -enolpyruvylshikimate phosphate synthase (3- phospho shikimate- 1 carboxyvinyltransferase)
Example 20: T. gondii Chorismate Synthase Activity is Demonstrated
An assay for chorismate synthase in T. gondu is performed and demonstrated
such activity
Example 21: T. gondii Dehydroquinase Activity is Demonstrated
An assay for dehydroquinase in 71 gondu was performed and demonstrated such activity
Example 22: GSAT activity is demonstrated in T. gondii tachyzoite lysates An enzymatic assay (Sangwan and O'Brian, 1993) demonstrates GSAT
activity in T. gondii lysates The buffer contains 0.1 M MOPS (3-[N-
mo holino]propanesulfonic acid), pH 6 8, 0 3M glycerol, 15 mM MgCl2, 1 mM
dithiothreitol, 20 μM pyridoxal phosphate, 1 mM PMSF (phenylmethylsulfonyl
fluoride) The MOPS, glycerol and MgCl2 are combined and then pH'd This is
important because the glycerol alters the pH, so it must be added first This is filter
sterilized and has a long shelf life When the buffer is needed, DTT, pyridoxal
phosphate and PMSF are added immediately prior to use The protein extract stock should be -10 mg/ml if possible The principle of the assay is conversion of substrate
which produces a change in color due to the reactant
Example 23: Isocitrate lvase activity is demonstrated in T. gondii tachyzoite lysates An enzymatic assay demonstrates isocitrate lyase activity in T. gondu isolates
prepared by disruption of the parasite membranes using french press or a lysis buffer Demonstration that the lysis buffer does not alter enzyme activity is carried out by performing the assay with known substrate and enzyme in the lysis buffer and
documenting presence of enzyme activity
Example 24: Alternative oxidase activity is demonstrated in T. gondii preparations. T. gondu tachyzoites and bradyzoites are assayed for alternative oxidase
activity and such activity is found to be present in greater amounts in bradyzoites
Example 25: Novel Substrate Competitors and Transition State Analogues of
Enzymes Inhibit Apicomplexan Enzymes
Some inhibitors are competitive substrates or transition state analogues and
they are utilized in the enzyme assay, in vitro with tachyzoite and bradyzoite
preparations and with native enzyme, tissues culture assays and in in vivo models as described above These provide a model paradigm for designing inhibitors of any of
the enzymes specified above Briefly, inhibitors are produced as follows Competitive substrates are produced by designing and synthesizing compounds similar to known
compounds but modified very slightly For example, inhibitors related to glyphosate are known The structures of glyphosate, sulfosate and the precursor for EPSP have similarities (please see below) Inhibitors are designed by modifying substrates in such
a manner that the modification interferes with the enzyme active site This can be
performed using molecular modeling software Similarly, halogenated substrates for other enzymes have functioned effectively as nontoxic inhibitors The principles are applicable to the design of inhibitors for any of the unique enzymes with well characterized substrates and active sites
The approaches to rational design of inhibitors include those standard in the art (Craig and Eakin, 1997, Ott et al, 1996) These methods use information about
substrate preference and three-dimensional structure of the target enzyme (e g , chorismate synthase or EPSP synthase)
In one approach, the structure of the target is modeled using the three- dimensional coordinates for amino acids in a related enzyme An example of this is
that the crystal structure of GSAT from a plant has been solved and its active site is
known
In another part of this approach, expression of high levels of recombinant
enzyme is produced using cDNA (e.g , the chorismate synthase of 71 gondii or P.
falciparum) and quantities of protein adequate for structural analysis, via either NMR
or X-ray crystallography are obtained.
Drug resistant mutants are produced in vitro following mutation with nitrosoguanidine and culture with the inhibitor. The surviving organisms have acquired resistance to the inhibitor. This process is carried out either with* the Apicomplexan
parasite or with bacteria or yeast complemented with the gene encoding the enzyme or
part of the gene (e.g., without the transit sequence). PCR amplifies the relevant cDNA and this cDNA encoding the resistant enzyme is cloned and sequenced. The sequence is compared with that of the enzyme that is not resistant. With the information about
the inhibitor target and three-dimensional structure, the point mutations which oause resistance are analyzed with computer graphic display. This information provides the mechanism for altered binding of the drug, and the inhibitory compound is then modified to produce second generation medicines designed to treat resistant pathogens
prior to their development in nature. An example of the use of toxic analogues to kill parasites used by others provides a means whereby there is production of analogues toxic to parasites. Specifically, the purine analogue prodrugs, 6 sulfanylpurinol, 6 thioguanine, 6
thioxanthine and allopurinol interact with hypoxanthine phosphoribosyltransferase which is responsible for salvage of purines used to produce AMP and GMP. Such
toxic analogues are effective against the plant-like enzymes in the pathways (see Table 1) in Apicomplexans.
Transit state analogues bind with extraordinarily high efficiency to the enzyme active site and are predicted from the three-dimensional structure and kinetic information Analogues that mimic the structural properties and electrostatic surface
potentials for the transition state are designed and synthesized Empirical testing using recombinant enzyme demonstrates that these transition state analogues are good leads with high affinity for the active site of the target enzyme
Multisubstrate analogues are useful because they markedly enhance the
binding affinity to the enzyme Similarly, if enzymes in a cascade are linked in such a manner that the substrate for one reaction provides the substrate for the next reaction, multisubstrate analogues are more useful
Selective inhibitor design and lead refinement: Co-crystallization of
inhibitors with target enzymes of host and pathogen enable three-dimensional analysis of molecular constructs and atomic interactions between inhibitors and enzymes and
redesign of inhibitors (leads) to enhance their affinity for the pathogen enzyme
Iterative crystallography, lead redesign and inhibitor testing in vitro and in vivo enable
design and development of potent selective inhibitors of the target of the pathogen enzyme Recombinant methods for screening large numbers of analogues for those
that bind selectively to the enzymes of specific parasites provide justification for
inclusion of the analogues which bind best in the design of transition-state or
multisubstrate analogues
Additional examples (included to illustrate principles employed) but already patented
by others include Inhibitor of EPSP synthase have been designed based on the
similarities of the inhibitor to the substrate. Based on molecular modeling algorithms
additional inhibitors are designed. Phosphoenolpyruvate = CH O l ii C-O-P O°
Co2 3 Oe
O O
II glyphosate = HO-C-CH2 N-CH2-P-OH
I \
H OH
Inhibitors that effect components of these pathways are halogenated substrates or analogues which are effective competitors.
Inhibitors of Ubiquinone: Modifications (substitutions) of benzhydroxamic acids
produce CoQ (ubiquinone) analogues such as esters of 2, 3 and 3,4 dihydroxybenzoic
acid and structurally related compounds.
Inhibitor of Isoleucine/valine biosynthetic pathway: These are noncompetitive
inhibitors as is shown by the lack of relatedness of the inhibitors (e.g., imidazolinones, sulfonylureas) to the target enzymes.
Inhibitors of GSAT
The following acids (5 amino- 1,3 cyclohendienyl carboxylic acid, 4 amino 5
hexynoic acid ( acetylenic, GABA), 4 amino 5 hexonoic acid ( vinyl GABA) 2 amino 3
butanoic acid (vinyl glycine), 2 amino 4 methoxy-trans-3 butenoic acid, 4 amino 5 fluoropentanoic acid alter catalysis dependent formation of a stable covalent adduct
Example 26: Modifications of Inhibitory Compounds to Improve Oral
Absorption Tissue Distribution (especially to brain and eve).
Tissue distribution is characterized using radiolabeled inhibitor administered to mice with its disposition to tissues measured by quantitation of radiolabel in tissues Compounds are modified to improve oral absoφtion and tissue distribution by standard
methods
Example 27. Efficacy of Antimicrobial Compounds Alone. Together and In Conjoint Infections in Murine Models
Inhibitors of plant-like pathways are effective against the Apicomplexan
infection alone, together with the bacterial and/or fungal infections and also treat the
bacterial and fungal infections alone
Presence of inhibitory activity of new antimicrobial compounds is tested using Apicomplexans, bacteria and fungi in enzymatic assays, in vitro, and in vivo assays as described above and known to those of skill in the art Infections are established in murine models and the influence of an inhibitor or
combination of inhibitors on outcomes are determined as follows Infections Infections with Toxoplasma gondu, Pneumocystis carinii, Mycobacterium
tuberculosis, Mycobacterium avium intracellular and Cryptosporidium parvum are established alone and together using an immunosuppressed rodent model Endpoints
in these infections are
Survival Ability of an inhibitor to protect the infected animal is measured as
prolonged survival relative to the survival of untreated animals.
Parasitemia: Is a measure using isolation of R A and RT-PCR. A competitive inhibitor is used for quantitation.
Tissue Parasite Burden: Is determined by quantitating brain and eye cyst numbers.
Inflammatory Response: This is noted in histopathologic preparations.
Representative combinations of inhibitors are NPMG and sulfadiazine, SHAM
and atovaquone, NPMG and pyrimethamine, NPMG and SHAM.
Example 28. Establishing Efficacy, Safety, Pharmakokinetics. and Therapeutic/Toxic Index: The testing in murine models includes standard Thompson tests. Testing of
antimicrobial agents for efficacy and safety in primate models for malaria is performed. Dosages are selected based on safety information available from data bases of
information concerning herbicides and the literature. Measurements of serum and
tissue levels of antimicrobial compounds are performed using assays which detect
inhibitor concentrations and concentrations of their metabolites. Representative assays are high performance liquid chromatography, and assaying tissues for percentage of
radiolabeled compounds administered, using liquid scintillation, and other assays also
are used.
Example 29. Determining whether there is Carcinogenicitv and Teratogenicity:
Standard assays to evaluate carcinogenicity and teratogenicity include
administration of medicines as described above to rodents and observation of offspring for teratogenic effects and carcinogenicity (i e development of malignancies) Observation includes general physical examination, autopsy and histopathologic studies
which detect any teratogenic or carcinogenic effects of medicines
Example 30. Constructs to Measure Parasitemia:
Portions of genes are deleted and the shorter gene is used as an internal
standard in RT PCR assays to measure amount of parasites present (Kirisits, Mui, McLeod, 1996)
Example 31. Vaccine Constructs and Proteins and their Administration:
These are prepared, as described They include DNA constructs (Ulmer, Donnelly and Liu, 1996) with the appropriate gene or portions of the gene alone or
together, with adjuvants. Representative adjuvants include ISCOMS,
nonionicsurfactant, vesicles, cytokine genes in the constructs and other commonly used adjuvants Native and recombinant proteins also are used in studies of vaccines
Protection is measured using immunologic in vitro assays, and assessing enhanced
survival, reduction of parasitemia tissue and parasite burden and prevention of congenital infection [McLeod et al , 1988]
Example 32: Stage-Specific Expression of Proteins
This is evaluated by enzyme assays, northern or western analysis, ELISA,
semi-quantitation of R A using RT-PCR with a competitor as internal standard in
gene-knockout organisms using culture conditions (e.g. alkaline pH, increased
temperature, nitric oxide exposure) which ordinarily elicit a bradyzoite phenotype, or engineering a reporter construct and characterizing presence of the reporter in stage specific expression of antigens. Ability to change between life cycle stages or to
persist in a particular life cycle stage is affected by presence or absence of particular plant-like genes and by treatment of inhibitors with plant-like processes. Suitable examples of plant-like enzymes which make parasites less able to switch from or persist in a specific life cycle stage include: alternative oxidase, enzymes critical for
amylopectin synthesis such as starch synthases, UDP glucose-glucosyl starch transferase and branching (Q) enzymes.
Example 33. Preparation of Diagnostic Test Reagents and Diagnostic Tests: These assays are as described (Boyer and McLeod, 1996). Sensitivity and
specificity are established as is standard in the field. Tests and reagents include ELISAs in which antibodies to the proteins or peptides and recombinant proteins of this invention such as chorismate synthase (Aroc) are used and PCR methodology in
which primers to amplify DNA which encodes the enzymes, or parts of this DNA, are
used. A test useful in an outpatient setting is based on conjugation of a monoclonal antibody to human red blood cells with antibody to plant-like peptides or proteins based on an assay described by Kemp et al. (Kemp et al, 1988). The red cells are
cross linked via the monoclonal antibody moiety, resulting in agglutination of the red blood cells in the blood sample if the antigen or antibody to the parasite component is present in the blood sample. ELISA and PCR can be utilized with samples collected
on filter paper as is standard in Newborn Screening Programs and also facilitates
outpatient and field use
Example 34. Development and use of Antisense Oligonucleotides in Design and Use of Medicines to Protect Against Apicomplexans: Antisense oligonucleotides directed against the nucleic acids which encode the
enzymes of the essential parasite metabolic process described herein are effective
medicines to treat these infections Antisense oligonucleotides also are directed against transit sequences in the genes Antisense oligonucleotides are short synthetic stretches of DNA and RNA designed to block the action of the specific genes described above, for example, chorismate synthase of 71 gondii or P. falciparum, by
binding to their RNA transcript They turn off the genes by binding to stretches of their messenger RNA so that there is breakdown of the mRNA and no translation into protein When possible, antisense do not contain cytosine nucleotides Antisense reagents have been found to be active against neoplasms, inflammatory disease of the bowel (Crohn's Disease) and HIV in early trials Antisense will not contain cytosine nucleotides followed by guanines as this generates extreme immune responses (Roush,
1997) Antisense oligonucleotides with sequence for thymidine kinase also is used for
regulatable gene therapy
Example 35. Ribozymes and Other Toxic Compounds as Antimicrobial Agents: Ribozymes are RNA enzymes (Mack, McLeod, 1996) and they and toxic
compounds such as ricins (Mahal et al. 1997) are conjugated to antisense
oligonucleotides, or intracellular antibodies, and these constructs destroy the enzyme
or other molecules.
Example 36. Intracellular Antibodies to Target Essential Enzymes Proteins and Organelles:
Intracellular antibodies are the Fab portions of monoclonal antibodies directed
against the enzymes of this invention or portions of them (e.g., anti-transit sequence antibodies) which can be delivered either as proteins or as DNA constructs, as described under vaccines.
Example 37. Development of New Antimicrobial Compounds Based on Lead Compounds:
The herbicide inhibitors comprise lead compounds and are modified as is standard. Examples are where side chain modifications or substitutions of groups are
made to make more active inhibitors (Table 1). Their mode of action and stmcture as well as the enzyme and substrate stmctures are useful in designing related compounds which better abrogate the function of the enzymes. Examples of such substrate or active site targeting are listed in Table 1.
Native or recombinant protein used in enzymatic assays and in vitro assays
described above are used to test activity of the designed newly synthesized compounds. Subsequently, they are tested in animals.
Example 38. Trials to Demonstrate Efficacy of Novel Antimicrobial Agents for Human Disease:
Trials to demonstrate efficacy for human disease are performed when in vitro
and murine and pπmate studies indicate highly likely efficacy and safety They are standard Phase 1 (Safety), Phase II (small efficacy) and Phase III (larger efficacy with outcomes data) trials For medicines effective against T. gondii tachyzoites, resolution
of intracerebral Toxoplasma brain lesions in individuals with HIV infection with no other therapeutic options available due to major intolerance to available medicines is the initial strategy for Phase II trials Endpoints for trials of medications effective against 71 gondii bradyzoites include absence of development of toxoplasmic encephalitis in individuals with HIV HIV infected patients who also are seropositive for 71 gondii infection are evaluated Evaluation is following a one-month treatment
with the novel anti 71 gondii medicines Observation is during a subsequent 2 year
period when the patients peripheral blood CD4 counts are low Effective medicines
demonstrate efficacy measured as absence of 71 gondii encephalitis in all patients Otherwise, 50% of such individuals develop toxoplasmic encephalitis When
medications efficacious against bradyzoites and recmdescent toxoplasmic encephalitis
in patients with AIDS are discovered and found to be safe, similar trials of efficacy and
safety for individuals with recurrent toxoplasmic chorioretinitis are performed All such trials are performed with informed consent, consistent with Institutional NIH, and
Helsinki guidelines applicable to treatment trials involving humans
- I l l -
Example 39. Vaccine Trials for Humans
After vaccine efficacy in rodent models to prevent congenital and latent
Toxoplasma infection are established, for component vaccines only, trials to establish safety and efficacy in prevention of congenital and latent infection are performed. They follow standard procedures for phase I, II and III trials as outlined above and as
is standard for vaccine development.
Endpoints for vaccine effect and efficacy are development of antibody and cell- mediated immunity to 71 gondii (effect) and most importantly, prevention of 71 gondii
congenital infections. After establishing in phase I trials that the vaccine is entirely
safe, nonpregnant women of childbearing age will be vaccinated with recombinant
vaccine. Assay for efficacy is via a serologic screening program to detect newborn congenital toxoplasmosis (described in Boyer and McLeod, 1996) with usual testing to document whether seropositive infants are infected (described in Boyer and McLeod,
1996). Example 40. Vaccine Efficacy and Safety for Livestock Animals
The efficacy of candidate vaccines is tested in sheep as previously described (Buxton et al, 1993). Vaccines are live attenuated, genetic constmcts or recombinant
protein. The most efficious routes and frequency of inoculation is assessed in a serious of experiments as described below. Intra-muscular, sub-cutaneous and oral are the
preferred routes, although intravenous, intraperitoneal and intradermal routes may also
be used. Scottish blackface or/and swaledale ewes, four to six years old are tested for
IgG antibodies to Toxoplasma gondii using an ELISA assay. Only sero-negative
animals are used for the study Three groups of 10- 15 ewes are used for each experiment Groups 1 are vaccinated, while group 2 and 3 are not Three months later
all ewes are synchronized for estrous and mated At 90 days gestation the ewes in
groups 1 and 2 are given 2000 sporulated oocyst of 71 gondii
The outcome of pregnancy is monitored in all groups Aborted lambs or those dying soon after birth are examined histologically and by PCR for the B 1 gene or sub- inoculation into mice or tissue culture, for the presence of 71 gondii All placentas are
examined histologically and as above for parasites. Lambs are weighed at birth Pre- colostral semm is taken from each lamb Congenital transmission is assessed by performing ELISA assays on the semm for IgG or IgM Protection is measured as a decrease in congenital transmission, a decrease in the incidence or severity of
congenital disease, or a decrease in abortion
MATERIALS AND METHODS
A. Methods to Assay Candidate Inhibitors
1 Inhibitors of Toxoplasma gondii
a) Cell lines Fibroblasts Human foreskin fibroblasts (HFF) are
grown in tissue culture flasks in Iscoves' Modified Dulbecoes Medium (IMDM),
containing 10% fetal bovine semm, L-glutamine and penicillin/streptomycin at 37°C in
100%) humidity and a 5% CO2 environment. Confluent cells are removed by trypsinization and washed in IMDM They are used in a growth phase for toxicity assays or when 100% confluent for parasite inhibition assays
b) Tachyzoites Tachyzoites of the RH and pTg strains of 71 gondu
are passaged and used for in vitro studies (McLeod et al, 1992) The R5 mixed tachyzoite/bradyzoite mutant was derived from mutagenesis with nitrosoguanidine in
the present of 5 hydroxynapthoquinone These organisms are used for in vitro
experiments at a concentration of 2 x 103, 2 x 104, or 2 x 105 organisms per ml, dependent upon the planned duration of the experiment (i.e., larger inoculations for shorter duration experiments)
c) Bradyzoites: Bradyzoites are obtained as described by Denton et al (1996b) Specifically, C57BL10/ScSn mice are infected intraperitoneally
with 20 cysts of the Me49 strain of T. gondii Their brains are removed 30 days later and homogenized in PBS by repeated passage through a 21 gauge needle Aliquots
containing the equivalents of 3-4 brains are diluted in PBS and 6.5 mis of 90% percoll
added to the mixture which is allowed to settle for 30 mins. 2mls of 90% Percoll is
then added as a bottom layer and the mixture centrifuged for 30 mins at 2500xg. The cysts are recovered from the bottom layer and a small portion of the layer above. After
the removal of Percoll by centrifugation, the contaminating red blood cells are removed
by lysis with water followed by the addition of 1 ml of lOxPBS per 9 ml brain
suspension in water. Bradyzoites are released from the purified cysts by digestion in a 1% pepsin solution for 5 minutes at 37°C. This method routinely permits recovery of greater than 90% of the cysts present which yields approximately 100 bradyzoites per
cyst. Bradyzoites are used at concentrations of 2x103, 2xl04 and 2xl05 per ml in parasite growth inhibition assays. pH shock is also used to retain organisms in bradyzoite stage when such pH does not interfere with inhibitor activity. d) Inhibitors: Inhibitor compounds are tested over a range of
concentrations for toxicity against mammalian cells by assessing their ability to prevent cell growth as measured by tritiated thymidine uptake and inspection of the monolayer
using microscopic evaluation. A range of concentrations that are non-toxic in this
assay are tested for their ability to prevent the growth of 71 gondii and also other
Apicomplexans within these cells. i.) Heme Synthesis: The inhibitor of the heme synthesis pathway, gabaculine (Grimm, 1990; Elliot et al, 1990; Howe et al,
1995; Mets and Thiel, 1989; Sangwan and O'Brian 1993; Matters and
Beale, 1995) is used at a concentration of 20 mM [which has been demonstrated to be effective against tachyzoites of the RH and R5
strains]. Other inhibitors of this pathway include 4 amino- 5 -hexynoic
acid and 4-aminofluoropentanoic acid which provide additional corroborative evidence that this pathway is present
ii) Glyoxylate Cycle The inhibitor of isocitrate lyase is 3 nitropropionic acid (ranging from 0 005 to 5 mg/ml in vitro)
iii) Alternative Oxidase 71 gondii bradyzoites use unique
alternative oxidases Alternative oxidase is necessary and sufficient for
bradyzoite survival Methods to characterize plant alternative oxidases are described (Hill, 1976, Kumar and Soil, 1992, Lambers, 1994, Li et al, 1996, Mclntosh, 1994).
For the in vitro studies, cell lines that lack functional mitochondria are
used These cell lines are used to allow the study of inhibitors effective against the conventional or alternative respiratory pathways within the parasite, but independent of
their effects on the host cell mitochondria Two cell lines, a human fibroblast cell line
(143B/206) lacking mitochondrial DNA, and the parental strain (143B) which poses functional mitochondria are used These cell lines have been demonstrated to support the growth of 71 gondii (Tomavo S and Boothroyd JC, 1995) SHAM, an inhibitor of
the alternative respiratory pathway is used at concentrations between 0.25 and 2 μg/ml
in vitro iv) Shikimate Pathway For EPSP synthase, the inhibitor is
N-(phosphonomethyl) glycine (concentrations of 3.125mM in folate deficient media) e) Culture assay systems for assessing inhibitor effect
i) Toxicity assays: Aliquots of cells (HFF) are grown in 96-well tissue culture plates until 10% confluent. Cells are incubated with various
concentrations of drug for 1, 2, 4 and 8 days. Cultures are pulsed with tritiated
thymidine (2.5 μCi/well) for the last 18 hours of the culture after which the cells are
harvested using an automated cell harvester and thymidine uptake measured by liquid scintillation.
ii) In vitro parasite growth inhibition assays: Confluent monolayers
of HFF cells, grown in 96-well plates are infected with T. gondii tachyzoites of the RH strain and serial dilutions of anti-microbial compound are applied 1 hour later 71 gondii growth is assessed in these cultures by their ability to incoφorate tritiated uracil (2.5 μCi/well) added during the last 18 hours of culture After harvesting cells
with an automatic cell harvester, uracil incorporation is measured by liquid scintillation Alternatively, confluent HFF cells are grown in the chambers of Labtech slides and parasite growth is assessed microscopically following fixation in aminoacridine and
staining in 10% Giemsa (McLeod et al , 1992).
f) Product rescue assays to evaluate specificity of the inhibitor: To attempt to demonstrate specificity of the site of action of the inhibitor, growth
inhibition assays are performed in the presence of varying concentrations of product,
e.g., in the case where gabaculine is the inhibitor, ALA is added simultaneously to determine whether product rescue occurs. This type of study is only inteφretable when rescue is demonstrated because it is possible that exogenous "product" is not
transported into the 71 gondii within host cells. For EPSP synthase, product rescue
assay is performed with PABA. g) Assays for synergy in vitro. This is an assay in which < 50% inhibitory
concentrations of two antimicrobial agents are added alone and together to determine whether there is an additive, synergistic or inhibitory interaction. All other aspects of
this assay are as described herein.
2. Inhibitors of Cryptosporidia parvum
C. parvum oocysts at 50,000/welI were incubated with each dmg (PRM=paromomycin which is the positive control, NPMG, gabaculine, SHAM, 8-
hydroxyquinoline) at 37°C (8% carbon dioxide) on confluent MDBKF5D2 cell monolayers in 96 well microtiter plates. The level of infection of each well was
determined and analyzed by an immunofluorescence assay at 48 hours using as an antibody C. parvum sporozoite rabbit anti-semm (0.1%), and using fluorescein-
conjugated goat anti-rabbit antibody (1%). Data are expressed as mean parasite count/field when 16 fields counted at lOx magnification "s.d. of the mean. (FIG. 6)
3. Inhibitors of Plasmodium falciparum
This assay is performed in folate deficient RPMI 1640 over a 66 hour
incubation in plasma as described by Milhous et al. (1985). Both the W2 clone DHFR resistant phenotype and the D6 clone are used (Odula et al, 1988) (Table 3). 4. Inhibitors of Eimeria tenella
Susceptibility of Eimeria tenella in vitro is analyzed by a method similar to that described by McLeod et al, 1992 or for Cryptosporidium as disclosed hereia
5. In vivo studies, measurement of parasitemia of Toxoplasma gondii
A method to measure the amount of parasitemia in mouse peripheral blood has been developed. Briefly, the target for PCR amplification is the 35 fold repetitive B 1
gene of T. gondii and the amplification was performed using primers previously reported. In order to semiquantitate the PCR product and to avoid false negative results, a competitive internal standard is generated using a linker primer and the
original B 1 primers. Competitive PCR was performed by spiking individual reactions
(containing equal amounts of genomic DNA) with a dilution of the internal standard Since this internal control contains the same primer template sequences, it competes with the B 1 gene of 71 gondii for primer binding and amplification The sensitivity of the PCR reaction in each sample can be monitored Following competitive PCR, the
PCR products are distinguished by size and the amount of products generated by the target and internal standard can be compared on a gel The amount of competitor DNA
yielding equal amounts of products gives the initial amount of target gene.
6. Interpretation of Data/Statistical Analysis of Data:
In vitro studies are performed with triplicate samples for each treatment group
and a mean ± sd determined as shown in the FIGs. All in vivo studies utilize at least 6
mice per group. Statistical analysis performed by Students' t-test or the Mann- Whitney
U-test. A p value of < 0.05, is considered statistically significant.
B. Western Blots Demonstrate Plant-Like Enzymes
Western analysis for GSAT, isocitrate lyase, malate synthase, alternative
oxidase and EPSP is used to demonstrate the presence of plant-like enzymes in many
Apicomplexan parasites, e.g., Plasmodia, Toxoplasma, Cryptosporidia, Malaria and
Eimeria
Tachyzoites and bradyzoites (McLeod et al 1984, 1988, Denton et al, 1996a,
b), or their mitochondria and plastids are isolated as previously described Equivalent
numbers of tachyzoites and bradyzoites are separately solubilized in 2x sample buffer
and boiled for 5 minutes Samples are electrophoresed through a 10 percent SDS- polyacrylimide gel Proteins are transferred to a nitrocellulose membrane at 4°C, 32V with 25mM Tris and 192mM glycine, 20% v/v methanol, pH 8 3 Blots are blocked in
PBS (pH 7.2) containing 5% powered milk and 0 1% Tween 20 for 2 hours at 20°C
After washing in PBS (pH 7 2), 0 1% Tween 20, blots are stained with polyclonal or monoclonal antibodies specific for alternative oxidases in PBS (pH 7 2) containing 0 1% Tween 20 for 1 hour at 20°C Following washing in PBS (pH 7.2) containing
0 1% Tween 20, blots are incubated with an appropriate secondary antibody conjugated
to HRP at a dilution to be determined by methods known in the art After further washes, binding is visualized by chemoilluminescence (Amersham)
Antibodies to various enzymes, e.g., soybean GSAT, barley GSAT,
synechococcus GSAT, plant and/or trypanosome alternative oxidase, cotton isocitrate lyase, cotton malate synthase, soybean malate synthase, petunia EPSP synthase were
used to determine whether homologous enzymes are present in 71 gondii tachyzoites,
bradyzoites, mitochondrial and plastid enriched preparations Antibodies used include
monoclonal antibodies to Trypanosoma bruceu and Voo Doo Lily (Chaudhuπ et al. 1996) alternative oxidase and polyclonal antibody to Trypanosoma bruceu alternative
oxidase The hybridizations with antibodies to plant and related protozoan alternative
oxidases demonstrated the relatedness of 71 gondu metabolic pathways to those of
plants and other non-Apicomplexan protozoans The products GSAT and alternative
oxidase were demonstrated by Western analysis Both polyclonal and monoclonal antibodies were reacted with alternative oxidase to confirm this observation
C. Probing Other Parasite Genes. The genes isolated from 71 gondii as
described herein are used to probe genomic DNA of other Apicomplexan parasites including Plasmodia, Crypiospor odium, and Eimeria.
D. Genomic Sequence. Genomic clones are identified and sequenced in the same manner as described above for cDNA except a genomic library is used Analysis of unique promoter regions also provide novel targets
E. Enzymatic Activity Demonstrates Presence of Plant-Like Enzymes in Metabolic pathways
The presence of the enzymes putatively identified by inhibitor studies is
confirmed by standard biochemical assays Enzyme activities of GSAT, isocitrate lyase, malate synthase, alternative oxidase, and EPSP synthase, chorismate synthase, chorismate lyase, UDP-glucose starch glycosyl transferase and other enzymes listed
herein are identified using published methods Representative methods are those of
Jahn er α/., 1991; Weinstein and Beale, 1995, Kahn et al, 1977, Bass e/ al, 1990, Mousdale and Coggins (1985) In addition, enzyme activity is used to determine in
which of the tachyzoite and bradyzoite life cycle stages each pathway is operative
Tachyzoites and bradyzoites are purified as described herein The parasites are lysed in
50mM HEPES (pH7.4) containing 20% glycerol, 0.25% Triton X-100 and proteinase inhibitors (5mM PMSF, 5FM E64, 1FM pepstatin, 0.2mM 1,10-phenanthroline). This
method has proven successful for measurement of phosphofructokinase, pyruvate
kinase, lactate dehydrogenase, NAD- and NADH-linked isocitrate dehydrogenases and succinic dehydrogenase activity in tachyzoites and bradyzoites of 71 gondii (Denton
et al, 1996a,b).
1 ) GSAT: GSAT activity is measured by the method of Jahn et al. , ( 1991 ), which uses GSA as substrate. GSA is synthesized according to methods of Gough et al. (1989). Heat-inactivated (60°C, 10') lysates are employed as non-enzymatic
controls. ALA is quantified following chromatographic separation (Weinstein and
Beale, 1985). This approach allows the definitive detection of GSAT activity in cmde extracts.
2) ALA Synthase: To determine whether parasites contain ALA synthase,
an activity also present in mammalian host cell mitochondria, cell fractions from
purified parasites are assayed. (Weinstein and Beale, 1985) ALA produced from added glycine and succinyl CoA is quantified as for GSAT.
3) Isocitrate Lvase: The biochemical assay for isocitrate lyase activity used is the method of Kahn et al. (1977).
4) Alternative Oxidase: activity is measured in parasite lysates or purified mitochondria or plastids by oxygen uptake using an oxygen electrode described by Bass et al. (1990). Confirmation of the oxidation being due to alternative oxidase(s) is
achieved by successful inhibition of oxygen uptake in the presence of 0 5mM SHAM, but not in the presence of KCN
5) Shikimate Pathway The biochemical assay for EPSP synthase,
chorismate synthase, chorismate lyase, activity in cellular lysates is conducted as
described by Mousdale and Coggins (1985) and Nichols and Green (1992)
6) Branched Amino Acids The biochemical assay for hydroxy acid synthase is as described
7) Amylopectin Synthesis The biochemical assays for starch synthase, Q
enzymes, and UDP-glucose starch glycosyl transferase are as described 8) Lipid Synthesis Assays for lipid synthases are as described
Some of the additional representative enzyme assays are precisely as described by Mousdale and Coggins(1985) and are as follows
5-Enolpyruvylshikιmate 3 -phosphate synthase is assayed in forward and reverse directions as described previously (Mousdale and Coggins 1984) Shikimate NADP oxidoreductase (shikimate dehydrogenase), shikimate kinase,
3 -Dehydroquinase (DHQase) are assayed Assay mixtures contained in a total volume of 1 ml 100 mM potassium phosphate (pH 7 0) and 0 8 mM
ammonium 3 -dehydroquinate 3 -Dehydroquinate synthase is assayed by
coupling for forward reaction to the 3 -dehydroquinase reaction, assay mixtures
contained in a total volume of 1 ml 10 mM potassium phosphate (pH 7 0), 50 μM NAD+ 0 1 mM CoCl2, 0 5 nkat partially-punfied Escherichia cob DHQase
and (to initiate assay) 0.4 mM DAHP. The DAHP is prepared from E. coli
strain AB2847A and DHQase from E. coli strain ATCC 14948.
Assay of DAHP synthase is by a modification of the method of Sprinson et al.. Assay mixtures contained in a total volume of 0.5 ml: 50 mM 1,3-bis [tris(hydroxymethyl)-methylamino] propane-HCl (pH 7.4), 1 mM erythrose 4- phosphate, 2 mM phosphoenolpymvate and 1 mM CoCl2. The reaction is
initiated by the addition of a 50 to 100 μl sample containing DAHP synthase
and terminated after 10 min at 37°C by 100 μl 25% (w/v) trichloroacetic acid.
The mixture was chilled for 1 h and centrifuged to remove precipitated protein.
A 200 μl aliquot of the supernatant was mixed with 100 μl 0.2 M NalO4 in 9 M
H3PO4 and incubated at 37°C for 10 min; 0.5 ml, 0.8 M NaASO2 and 0.5 M
Na2SO4 in 0.1 M H2SO4 in 0.1 m H2SO4 was then added and the mixture left at
37°C for 15 min; 3 ml 0.6% (w/v) sodium thiobarbiturate and 0.5 M Na2SO4 in
5 mM NaOH was added and the mixture placed in a boiling-water bath for 10
min. After cooling to room temperature the solution was centrifuged (8500 xg,
2 min) and the optical density at 549 n read immediately. Appropriate controls assayed in triplicate lack substrates, sample or both."
Another representative assay is an assay for chorismate lyase which is as described by Nichols and Green, 1992:
Chorismate lyase assays are carried out in a volume of 0.5 ml containing 50 mM
Tris-HCI (pH 7.5), 5 mM EDTA, 10 mM 2-mercaptoethanol, 60 μM
chorismate, and 0.2 to 4 U of chorismate lyase. After incubation at 37°C for
30 min, 4-hydroxybenzoate is detected and quantitated by high-pressure liquid chromatography (HPLC). Fifty microliters of each reaction mixture is applied to an HPLC system (Waters 625) equipped with a Nova-Pak Ciϋ column
equilibrated in 5% acetic acid and monitored at 240 nM. The height of the
4-hydroxybenzoate peak is compared with those of standard curves generated by treating known amounts of 4-hydroxybenzoate in a similar manner. One unit
of chorismate lyase activity is defined as the amount of enzyme required to
produce 1 nmol of 4-hydroxybenzoate in 30 min at 37°C.
Assays for 4-aminobenzoate and 4-amino-4-deoxychorismate are performed as described previously."
E. Construction and Analysis of Gene "Knock-Outs"
In order to determine whether a gene, e.g., chorismate synthase or alternative
oxidase is essential for growth or survival of the organism, gene knockout organisms are generated by the method of Roos et al, 1996. Specifically, the strategy for creating mutants is with homologous recombination and to generate a targeted gene knock-out a sequential positive/negative selection procedure is used (Roos et al, 1996). In this
procedure positive and negative selectable markers are both introduced adjacent to, but not within the cloned and suitably mutated locus. This constmct is transfected as a
circular plasmid. Positive selection is applied to yield a single-site homologous
recombinant that is distinguished from non-homologous recombinants by molecular screening. In the resulting 'pseudodiploid,' mutant and wild-type alleles flank
selectable marker and other vector sequences. In the next step, parasites are removed
from positive selection, which permits recombination between the duplicated loci This
event appears to occur at a frequency of 2 x 10"6 per cell generation These
recombinants are isolated with negative selection Next, they are screened to distinguish those that have recombined in a manner that deletes the mutant locus and yields a wild-type revertant from those that deleted the wild-type gene to leave a perfect allelic replacement
This 'hit-and-run' approach has the disadvantage of being time-consuming Nonetheless, it offers several distinct advantages over other gene knock-out strategies
First, because gene replacement occurs by two sequential single-cross-overs instead of
one double cross-over which is a very rare event, it is more likely to be successful
Second, because selectable marker(s) are located outside of the targeted gene itself, expenments are not limited to gene knock-outs A variety of more subtle point mutations are introduced as allelic replacements Third, this strategy provides a means
of distinguishing essential genes from those which cannot be deleted for purely
technical reasons Specifically, if the hit-and-mn mutagenesis procedure yields only wild-type revertants instead of the theoretical 1 1 ratio of wild-type mutant, this provides positive evidence that the locus in question is essential
An example is a knockout created for the chorismate synthase gene It also can
be made more general to include knockout of other genes for attenuated vaccines such
as EPSP synthase and alternative oxidase The parasite with the gene of interest to be
knocked out is grown ("manufactured") in vitro in presence of product, but when used in vivo the needed product is not present The parasite functions as an attenuated
vaccine as described below under vaccines A specific example follows. Specifically, the strategy of product inhibition discussed above is also useful for growing gene
knockout parasites (which lack a key gene for their survival) in vitro by providing the
essential product and thus bypassing the need for the gene during in vitro propagation
of the parasite. Such gene knockouts cultivated in vitro in this manner are useful attenuated organisms that are used as attenuated vaccines.
The chorismate synthase cDNA clones are used as hybridization probes for
recovering genomic clones from a 71 gondii genomic cosmid library. Coding regions
are mapped onto the genomic clones using the cDNA clones as a guide. Appropriate sections are sequenced to verify the gene location. Ultimately, full genomic sequences are obtained. Enough of the genomic clones are sequenced to develop a strategy for generating a putative null allele. Segments that can be deleted at the 5' end of the coding region to generate an allele that is unlikely to generate a functional gene product
are identified. A putative neutral allele is generated that can be distinguished from the wild type allele on the basis of an introduced restriction site polymorphism, but that
does not differ in encoded protein sequence. These putative chorismate synthase-null and chorismate synthase-neutral alleles are cloned into the pminiHXGPRT transfection vector plasmid.
The resulting chorismate synthase -null and chorismate synthase-neutral
plasmids are transfected into HXGPRT-negative strains of T. gondii (strains
RH(EP)ΗXGPRT [a ME49 derivative]. Numerous independent clones are selected for
survival on mycophenolic acid to select for insertion of the plasmid. These strains are
screened by Southern analysis designed to detect the presence of both the normal and
modified copies of the chorismate synthase gene and for tandem location of the two
copies (with the vector HXGPRT gene between). This is the stmcture expected for insertion of the plasmid by homologous recombination at the AroC genomic locus (the "hit" needed for the hit-and-mn gene knock-out strategy). The feasibility of recovering
these strains is critically dependent upon the ratio of homologous to non-homologous integration following transfection, which will depend upon the length of homologous, genomic DNA in the clone (Donald and Roos, 1994; Roos et al, 1996) Eight kb of homology is sufficient to obtain >50% homologous integration (Roos et al, 1996)
HXGPRT clones with verified pseudodiploid stmcture of the chorismate synthase alleles are selected for loss of HXGPRT using 6-thioxanthine (the "run" part of the protocol). Numerous clones are selected. If the loss of HXGPRT is based upon random homologous exchange between the two chorismate synthase pseudodiploid
alleles, theoretically half of the events should lead to excision of the modified chorismate synthase allele along with the HXGPRT, leaving the original wild type allele
in the chromosome. The other half should excise the wild type allele, leaving the modified allele in the chromosome. During selection and grow-out of these clones, the
medium is supplemented with chorismate at the concentration determined to best rescue cells from inhibitor toxicity. The puφose of the supplementation is to enhance the chances of recovering chorismate synthase-null strains The genomic stmcture of
the selected clones is examined by Southern analysis to confirm loss of the vector
HXGPRT and of one copy of the chorismate synthase and to identify the remaining
allele of chorismate synthase. The ratio of mutant to wild type is tabulated. The chorismate synthase-neutral allele is intended as a positive control to confirm that either allele (wild type or mutant) can be lost in this procedure. If chorismate synthase-
neutral strains can be recovered but chorismate synthase-null strains cannot, the conclusion is that the chorismate synthase gene is essential for growth. If it proves possible to recover chorismate synthase-null strains, they are subjected to further
phenotypic analysis, first, using immunoblotting of electrophoretically separated cell
extracts to confirm absence of chorismate synthase protein, then, determining if these strains show hypersensitivity to inhibitors of the alternative oxidase or to any of the other potential inhibitors. Sensitivity to chorismate synthase inhibitors is analyzed to
determine the relative specificity of inhibition. If chorismate synthase is the sole target
of the inhibitors, then the null mutants should be insensitive to further inhibition. Sensitivity analysis is conducted in vitro as described herein. Whether strains show
alterations in expression of the alternative oxidase or in any stage-specific antigens is of interest. These analyses are conducted by immunoblotting of electrophoretically separated cell extracts. In vivo analysis using a mouse model is conducted to determine if these strains are infective and what stages of parasites can be detected following
infection. Genetically altered 71 gondii organisms are used to infect C3H/HeJ mice by
the intraperitoneal route. Mortality is monitored and brains examined for cysts at 30
days post infection.
Knockouts with bradyzoite reporter genes are useful to determine whether these
enzymes influence stage switch.
Stage switch also is characterized by quantitating relative amounts of parasite mRNA present in each stage of parasite using Northern blotting, isolation of mRNA and RT-PCR using a competitive inhibitor, and enzyme assay.
G. Reagents used for construction of "Knock-Outs"
Library
Me49 genomic libraries are used.
Plasmids
/?miniHXGPRT. Contains 71 gondii HXGPRT gene under control of DHFR-TS 5' and
3' flanking sequences. Functions as either a positive or negative selection marker (using 6-thioxanthine or mycophenolic acid, respectively) in suitable host strains.
Parasite Strains (obtained from AIDS Repository. Bethesda. Md
RH(EP). Wild-type host strain RH (highly pathogenic in mice).
RH(EP)ΗXGPRT. HXGPRT knock-out mutant of RH strain. Suitable for positive selection of HXGPRT-containing vectors.
P(LK). Wild-type host strain P, (clonal isolate of strain ME49; produces brain cysts in mice).
P(LK)HXGPRT-. HXGPRT-deficient mutant of P strain. Suitable for positive selection of HXGPRT-containing vectors.
H. Antibodies
Antibodies have been raised against homologous plant enzymes by standard
techniques for both polyclonal and monoclonal antibodies (Current Protocols in Immunology, 1996)
1) Heme Synthesis
Antibody to soybean, barley and synechococcus GSAT are polyclonal antibodies with preimmune sera the control for the barley and synechococcus antibodies
2) Glyoxylate Cycle T. gondii contains a glyoxylate cycle that allows growth using lipids as a carbon source, thus the lipid mobilization pathway of T. gondii is similar to the pathway of
plants (Tolbert, 1980) A similar approach using polyclonal antibodies to isocitrate lyase and to malate synthase and preimmune control sera are used.
3) Alternative Energy Generation Monoclonal and polyclonal antibodies to alternative oxidases in plants
(Mclntosh et al, 1994) and Trypanosomes (Hill, 1976) are used.
4) Shikimate Pathway
To demonstrate that T. gondii has the same unique enzymes that permit interconversion of shikimate to chorismate as plants do, the antibody to shikimate
pathway plant EPSP synthase is used
5) Synthesis of Branched Chain Amino Acids
Antibodies to acetohydroxy acid synthase are used.
6) Amylose and Amylopectin Synthesis and Degradation
Antibodies to starch synthesis, branching (Q) enzymes and UDP glucose starch
glycosyl transferase are used.
1. Complementation of Enzyme Deficient E. coli Demonstrates Functional
Product
The E. coli AroC mutant which lacks chorismate synthase (AroC) was obtained from the E. coli genetic stock center. AroC bacteria is made competent to take up DNA by transformation with CaCl2 treatment. Alternatively, the cells are electroporated to take up DNA. The presence of the plasmid is demonstrated in this
system by growth on media which contains ampicillin, as the plasmid contains an ampicillin resistance gene. Complementation is confirmed by demonstrating growth on media lacking the product catalyzed by (i.e., chorismate). Thus, this transformation/ complementation is used with the 71 gondii cDNA library system or a constmct which
contains some or all of the chorismate synthase gene to transform the AroC mutant. Functional enzyme is then demonstrated.
J. Immunizations Of Mice For Polyclonal Antibody Production:
As an alternative approach if complementation studies are unsuccessful and the
monoclonal antibodies to a plant protein are not cross reactive, purified plant protein is used to immunize mice to raise polyclonal antibodies to each enzyme. Where
necessary, antibodies to the pertinent enzymes are generated in mice, ND4 outbred
mice are immunized with 20 μg of enzyme emulsified in Titermax complete adjuvant
injected intramuscularly into their gluteal muscle. Two weeks later mice are immunized with a further 20 μg of enzyme emulsified in Titermax. After a further 2 weeks mice receive a further boost of enzyme alone in PBS by the intraperitoneal route. Mice are bled and the semm tested for specificity by the standard Western blotting technique.
K. Immunofluorescence
Antibodies used to identify enzymes in the Apicomplexan metabolic pathways disclosed here are used for immunofluorescence studies. Examples are demonstration of alternative oxidase in 71 gondii by immunofluorescence assay (IFA). 71 gondii alternative oxidase is immunolocalized to mitochondria. L. ELISAs
ELISAs are used for documenting the presence and quantitating the amounts of
alternative oxidase.
M. Reporter Constructs To Demonstrate Organelle Targeting Are Made And
Characterized As Described Using β Glucoronidase Or Other Chimeric
Constructs
Importance of the targeting sequence for localization of the enzyme to an
organelle is demonstrated with immunoelectronmicroscopy. Organelle targeting sequences in proteins expressed in bacteria which lack the organelle cause misfolding of
proteins and thereby impair protein function.
A useful reporter protein for a chimeric constmct is β glucoronidase, expressed in E. coli under control of the 355 promoter of cauliflower mosaic vims. The
glucoronidase alone without the transit sequence is expressed in parallel. The transit peptide constmct is found in the plastid. The control glucoronidase is found in the
cytoplasm. Antibodies to the chorismate synthase protein are also used to detect the
presence of the product of the gene (with the transit sequence) in the plastid and the product of a constmct (in which the transit sequence is not present) in the cytoplasm only. Further mutations and deletions are made which identify the minimal transit sequence using the same techniques as described above for the entire peptide.
Antisense, ribozyme or intracellular antibodies directed against the transit sequence
nucleic acid or translated protein are useful as medicines. The amino acid or nucleic acid which encodes the transit sequences are the bases for development of diagnostic reagents and vaccines.
N. Modifications of Inhibitory Compounds to Improve Oral Absorption Tissue Distribution (especially to brain and eve). Tissue distribution is characterized using radiolabeled inhibitor administered to
mice with its disposition to tissues measured. Compounds are modified to improve oral absoφtion and tissue distribution.
O. Methods to Demonstrate Protection Against Conjoint Infections
Infections are established and influence of an inhibitor or combination of inhibitors on outcomes are as outlined below.
Infections: Infections with Toxoplasma gondii, Pneumocystis carinii, Mycobacterium
tuberculosis, Mycobacterium avium intracellular and Cryptosporidium parvum are
established alone and together using an immunosuppressed rodent model Endpoints
in these infections are
Survival Ability of an inhibitor to protect, measured as prolonged survival
Parasitemia This is measured using isolation of mRNA and RT-PCR with a competitive inhibitor for quantitation
Tissue Parasite Burden This is determined by quantitating brain and eye cyst numbers Inflammatory Response This is noted in histopathologic preparations Representative combinations of inhibitors are NPMG and sulfadiazine, SHAM and atovaquone, NPMG and pyrimethamine, NPMG and SHAM
P. Testing of Antimicrobial Compounds
Presence of inhibitory activity of new antimicrobial compounds is tested in
enzymatic assays, in vitro, and in vivo assays as described above and in the literature
Q. Efficacy, Safety, Pharmakokinetics, and Therapeutic Toxic Index
The testing in murine models includes standard Thompson tests Testing of antimicrobial agents for efficacy and safety in primate models for malaria is performed Dosages are selected based on safety information available from data bases of
information concerning herbicides and the literature Measurements of semm and
tissue levels of antimicrobial compounds are performed using assays which detect inhibitor concentrations and concentrations of their metabolites Representative assays
are high performance liquid chromatography, and assaying tissues for percentage of
radiolabeled compounds administered using liquid scintillation and other assays also
are used
R. Carcinogenicity and Teratogenicity
Standard assays to evaluate carcinogenicity include administration of medicines
as described above to rodents and observation of offspring for teratogenic effects and carcinogenicity Observation includes general physical examination, autopsy and
histopathologic studies which detect any teratogenic or carcinogenic effects of
medicines S. Constructs to Measure Parasitemia
Portions of genes are deleted and the shorter gene is used as an internal standard in RT PCR assays to measure amount of parasites present (Kirisits, Mui,
Mack, McLeod, 1996)
T. Vaccine Constructs and Proteins and their Administration
These are prepared, and sensitivity and specificity are established as is standard in the literature and as described above. Tests and reagents include DNA constmcts
(Tine et al, 1996) with the appropriate gene or portions of the gene alone or together, with adjuvants Representative adjuvants include ISCOMS, nonionicsurfactant vesicles, cytokine genes in the constmcts and other commonly used adjuvants. Native and recombinant proteins also are used in studies of vaccines Protection is measured
using immunologic in vitro assays, and by assessing survival and reduction of
parasitemia and tissue parasite burden and prevention of congenital infection (McLeod et al, 1988).
U. Preparation of Diagnostic Test Reagents and Diagnostic Tests:
These assays are as described (McLeod and Boyer, 1996) They include
ELISAs in which antibodies to the proteins or peptides and recombinant proteins are
used and PCR methodology in which primers to amplify DNA which encodes the enzymes or parts of this DNA are used A test useful in an outpatient setting is based on conjugation of a monoclonal antibody to human red blood cells with antibody to
peptides or proteins The red cells are cross linked if the antibody to the parasite
component interacts with the parasite component and agglutinates the red cells in the blood sample ELISA and PCR can be utilized with samples collected on filter paper as is standard in Newborn Screening Programs and also facilitates outpatient and field
use V. Antisense
Antisense oligonucleotides are short synthetic stretches of DNA and RNA
designed to block the action of the specific genes described above, for example,
chorismate synthase of 71 gondii or P. falciparum, by binding to their RNA transcript
They turn off the genes by binding to stretches of their messenger RNA so that there is breakdown of the mRNA and no translation into protein Antisense reagents have
been found to be active against neoplasms, inflammatory disease of the bowel (Crohn's
Disease) and HIV in early trials Antisense oligonucleotides directed against the nucleic acids which encode the essential parasite metabolic process described herein
are effective medicines to treat these infections Antisense oligonucleotides also are
directed against transit sequences in the genes Antisense will not contain cytosine
nucleotides followed by guanines as this generates extreme immune responses (Roush,
1997) Antisense oligonucleotides with sequence for thymidine kinase also is used for regulatable gene therapy
W. Ribozymes and Other Toxic Compounds
Ribozymes are RNA enzymes (Mack, McLeod, 1996) and they and toxic compounds such as ricins (Mahal et al, 1997) are conjugated to antisense oligonucleotides (see V, DNA), or intracellular antibodies (see X, for proteins), and these constmcts destroy the enzyme
X. Intracellular Antibodies
Intracellular antibodies are the Fab portions of monoclonal antibodies directed against the enzymes or portions of them (e.g., anti-transit sequence antibodies) which
can be delivered either as proteins or as DNA constmcts, as described under vaccines
Y. Development of New Antimicrobial Compounds Based on Lead Compounds
The herbicide inhibitors comprise lead compounds and are modified as is standard For example, side chain modifications or substitutions of groups are made to make more active inhibitors Their mode of action and stmcture as well as the enzyme
and substrate stmctures are useful in designing related compounds which better
abrogate the function of the enzymes Examples of such substrate or active site targeting are described above
Native or recombinant protein is used in enzymatic assays and in vitro assays described above are used to test activity of the designed newly synthesized compounds Subsequently, they will be tested in animals
Z. Trials to Demonstrate Efficacy for Human Disease
Trials to demonstrate efficacy for human disease are performed when in vitro
and murine and primate studies indicate highly likely efficacy and safety They are standard Phase I (Safety), Phase II (small efficacy) and Phase III (larger efficacy with
outcomes data) trials For medicines effective against 71 gondii tachyzoites, resolution
of intracerebral Toxoplasma brain abscess in HIV-infected individuals with no other
therapeutic options available due to major intolerance to available medicines is the
initial strategy for Phase II trials For medications effective against T. gondii bradyzoites, absence of development of toxoplasmic encephalitis in individuals with
HIV infection and individuals who are seropositive for T. gondu infection followed
after a one-month treatment for a 2 year period when their CD4 counts are low
Effective medicines demonstrate efficacy, as 50% of such individuals otherwise
develop toxoplasmic encephalitis. When medications efficacious against bradyzoites and recmdescent toxoplasmic encephalitis in patients with AIDS are discovered and
found to be safe, similar trials of efficacy and safety for individuals with recurrent
toxoplasmic chorioretinitis are performed.
DEFINITIONS
3-deoxy-d-arabino-heptuloonate 7 phosphate synthase: An enzyme which
functions in chorismate synthesis
3-enolpyruvyshikimate phosphate synthase (3-phosphoshikimate-l-
carboxyvinyltransferase): An enzyme which functions in chorismate synthesis
3-NPA: An inhibitor of isocitrate lyase in the glyoxylate pathway and also of succinate
dehydrogenase
3-oxtaprenyl-4-hydroxybenzoate carboxylyase: An enzyme which functions in ubiquinone synthesis
4-hydroxybenzoate octaprenyltransferase: An enzyme which functions in ubiquinone synthesis
8-OH-quinoline: An inhibitor of the alternative oxidase
Abscissic Acid Metabolism in Plants: A 15-carbon sequiteφenoid synthesized
partly in plastids by the mevalonic acid pathway Abscissic acid protects plants against stress and is a marker of the plant's maturation and activation of transcription, and causes dormancy Inhibits protein synthesis and leads to specific activation and
deactivation of genes
Acetohydroxy acid synthase: Enzyme which catalyzes production of acetohydroxy acids (the branched chain amino acids valine, leucine and isoleucine in plants)
Alternative oxidase: An enzyme important in the alternative pathway of respiration
There are examples of alternative oxidases in plants and trypanosomes. (Pollakis et al, 1995, Rhoads & Mclntosh, 1992, Clarkson et al, 1989)
Alternative respiration or energy generation: A different pathway for energy generation utilizing the alternative oxidase and election flow in the electron transport chain which is not dependent on conventional cytochromes or heme
Altered gene includes knockouts
Amide: The R portion of the amino group has an amino group connected to a carbonyl carbon Glutamine and asparagine are amides Important for nitrogen transport and storage
Amylopectin: A branched starch of plants Also found in T gondii bradyzoites
Amyloplast: Storage granule for starch in plants Derived from chloroplasts
Amylose: An unbranched starch of plants
Anabolism: Formation of large molecules such as starch, cellulose, proteins, fats and
nucleic acids from small molecules Requires input of energy
Anthranilate phosporibolsyltransferase: An enzyme which functions in tryptophan synthesis
Anthranilate synthase component I: An enzyme which functions in tryptophan synthesis
Anthranilate synthase component II: An enzyme which functions in tryptophan synthesis
Antimicrobial agent: A chemical, for example a protein or antisense nucleic acid
which effectively inhibits or kills a pathogenic microbe There are examples (Schwab et al, 1994, Strath et al, 1993; Beckers et al, 1995, Blais et al. 1993, Fichera et al,
1995, Pfefferkorn & Borotz, 1994, Pfefferkorn et al, 1992, Pukivittaykamee et al,
1994).
Apicomplex: The common feature of Apicomplexan parasites including a conoid and rhoptry organelles and micronemes at the apical end of the parasite
Apicomplexan parasite: A microorganism that belongs to the Apicomplexan group of
parasites These parasites share a number of moφhologic features, including a conoid and rhoptry which are organelles in the cytoplasm at the apical end of the organism and plastids which are multilamellar stmctures Representative examples of Apicomplexan
parasites include Toxoplasma gondu, Plasmodium, Cryptosporidia and Eimeria
Aromatic acid aminotransferase (aromatic transaminase): An enzyme which functions in tyrosine synthesis
Aspartate, glutamate and glutamine synthesis: Involve glutamine synthase and
glutamate synthetase and are plastid associated in plants Glutamine synthase in plants is inhibited by the herbicide glufosinate (2 amino-4-[hydroxymethylphosphinyl) butanoic acid. Glutamine synthase also is present in animals
ATP-phosphofructokinase: (ATP-PFK) May exert control over glycolytic pathway
because a step when hexoses phosphate cannot also be used to form sucrose or starch
Nearly all animals lack PPi-PFK with plant-like substrate specificity (i e PPi, not
ATP)
Auxins Growth regulators in plants, which are tryptophan derivatives Herbicides
modeled on auxins are stmctural mimics of these compounds rather than inhibitors of auxin function
Biochemical pathways: Biochemical pathways include metabolic pathways Any
chemical reaction in life Herein "biochemical pathways" and "metabolic pathways" are
used interchangeably
Bradyzoite: The slowly replicating life cycle stage of the Apicomplexan parasite
Toxoplasma gondii This stage is responsible for latent and recmdescent infection due
to this parasite The morphologic features which characterize this parasite stage are
electron dense rhoptries and amylopectin granules Bradyzoites contain a plastid organelle as do other life cycle stages of this parasite This parasite stage also has specific antigens which other life cycle stages do not have, including bradyzoite surface
antigen 4 and bradyzoite antigen 5 (lactate dehydrogenase), which is an intracellular and cyst matrix antigen Bradyzoites exist together in a stmcture called a cyst which
has a cyst wall and matrix Cysts contain a few to thousands of bradyzoites The cyst containing bradyzoites is a major means of transmission of the organism Toxoplasma
gondii when it is ingested in meat which is not cooked to well done It is also a form of the organism responsible for recmdescent eye and brain disease in infants and children who are congenitally infected with the parasite and also in patients whose immune
system is not normal
Branched chain amino acid synthesis (valine, leucine and isoleucine) involving acetohydroxy acid synthase, is the first of the series of reactions, is another metabolic pathway present in plants but not in animals
Branched chain amino acids: Amino acids (valine, leucine and isoleucine), the
synthesis of which can be inhibited by sulfonylurea and imidazolinone herbicides
There are examples in plants (Kuriki el al, 1996; Morell et al, 1997; Kortostee et al,
1996; Gmla et al, 1995; Khoshnoodi et al, 1996).
Branching or Q enzyme: Forms branches in amylopectins between C6 of the main chain and Cl of the branch chain.
Cataboiism: Degradation or breakdown of large molecules to small molecules, often releasing energy.
Calmodulin: is a calcium binding protein (Robson et al, 1993)
Catechol 1,2-deoxygenase (phenol hydroxylase): An enzyme which functions in phenylalanine synthesis.
Chloroplast: A DNA-containing multilamellar organelle of plants and algae
associated with metabolic pathways important for photosynthesis and other energy production. Chloroplasts utilize proteins encoded in their own DNA and also proteins encoded by nuclear DNA.
Chorismate: The product of the action of the enzyme EPSP synthase on shikimate.
Chorismate lyase: An enzyme responsible for the conversion of chorismate to
3 ,4-dihydroxybenzoate.
Chorismate mutase (7-phospho-2-dehydro-3-deoxy-arabino-heptulate-aIdolase):
An enzyme which functions in chorismate synthesis.
Chorismate synthase: An enzyme responsible for the conversion of 3-phospho 5- enolpyruvyl shikimate to chorismate.
Chorismate: The product of the action of the enzyme EPSP synthase on shikimate.
Competitive inhibitors: Stmctures sufficiently similar to the substrate that they
compete for the active site of the enzyme Addition of more natural substrate overcomes effect of the inhibitor.
Components: includes nucleic acids, proteins, peptides, enzymes, peptide targeting sequences, transit peptides, carbohydrates, starch, lipids, hormones, for example those
listed in Table 1 and other constituents of metabolic pathways or products derived from these components
Conventional energy generation: Usual pathways of generation of energy in
mitochondria utilizing cytochromes for the transfer of electrons
Conversion of Fats to Sugars in Plants: Occurs by oxidation and the glyoxylate
cycle
Cryptosporidiosis: The disease due to the Apicomplexan parasite Cryptosporidium
parvum It causes self-limited diarrhea or no symptoms in immunologically normal
individuals In individuals who have immunocompromising illnesses, such as the acquired immune deficiency syndrome, Cryptosporidiosis causes life-threatening, persistent, copious, watery diarrhea.
Cryptosporidium parvum: Cryptosporidium parvum is an Apicomplexan parasite
which causes cryptosporidiosis
Cyanide-insensitive, non-he e "alternative" oxidase is a metabolic activity that is found in most eukaryotic plants and algae and is absent from multicellular animals The
alternative oxidase is a single polypeptide enzyme that lacks heme and can serve as the terminal electron acceptor to support respiratory growth of E. cob in the absence of
heme The coupling efficiency of this oxidase is lower than that of the cyanide-sensitive cytochrome oxidase. That is, not as many protons are pumped across the
mitochondrial inner membrane in parallel with electron transfer through the alternative
oxidase as they are through the cytochrome oxidase The alternative oxidase appears to be used by plants and algae only under certain conditions The alternative oxidase also is used during different life-cycle stages or under different environmental
conditions Thus, inhibitors of the alternative oxidase may act cooperatively or synergistically with GSAT inhibitors.
Cyclohexadienyl dehydratase: An enzyme which functions in phenylalanine synthesis
Cyclohexadienyl dehydrogenase: An enzyme which functions in tyrosine synthesis
Cytochrome oxidase: An enzyme utilized in the conventional pathway of energy generation
Dehydroquinate dehydratase: An enzyme which functions in chorismate synthesis
Deoxyribonucleases: Enzymes which are hydrolases which hydrolyze DNA
(phosphate esters)
Eimeria bovis: Causes bovine eimeriosis
Eimeria maxima and Eimeria tenella: Cause eimeriosis in chickens.
Eimeria: A group of Apicomplexan parasites which cause gastrointestinal disease in agriculturally important animals including poultry and cattle These economically important parasites include Eimeria tenella, E. maxima and E. bovis
Endosymbiont: An organism which is taken up by another organism and then lives
within it
Enzyme: A protein which catalyzes (makes more rapid) the conversion of a substrate
into a product Enzymes are catalysts which speed reaction rates generally by factors between 108 and 1020 They may require ion or protein cofactors Control is by
products and environmental changes There are more than 5000 enzymes in living systems Enzymes are named with common or trivial names, and the suffix-ase which characterizes the substrate acted upon (e g , cytochrome oxidase removes an electron
from a cytochrome) Sequential series of steps in a metabolic pathway Enzymes that
govern the steps in a metabolic pathway are sometimes arranged so that a kind of assembly-line production process occurs
EPSP synthase: An enzyme important in the conversion of shikimate to chorismate
EST: Expressed sequence tag, a short, single pass cDNA sequence generated from
randomly selected library clones Eukaryote: Microorganism or phylogenetically higher organism, the cells of which have a nucleus with a limiting membrane
Fatty Acid Synthesis in Plants: Occurs only in chloroplasts of leaves and proplastids of seeds and roots Mainly palmitic acid and oleic acid AcetylCo A carboxylases
differ in plants and animals Linoleic acid synthase and linoleneic acid synthase are lipid synthases present in plants and not animals
Glycolysis -> pyruvate →-acetyl CoA
Example
8 acetyl CoA +7 ATP + 14 NADPH + \+W→ palmityl CoA + 7 CoA + 7 ADP2' +
7H2PO4 + 14 NADP" + 7H2O
Fragment: Refers to a sequence of nucleic acids or aminoacids, where a fragment is sufficient to function as a component of or product derived from an Apicomplexan as defined herein
Gabaculine: An inhibitor of the enzyme GSAT in the heme synthesis pathway Gene: Nucleotide sequence which encodes an amino acid sequence or another nucleotide sequence Giberellin Metabolism in Plants: Plant hormones which promote plant growth,
overcome dormancy, stimulate Gl to S transition and shorten S phase of cell cycle, increase hydrolysis of starch and sucrose into glucose and fructose They are
derivatives of ent-gibberellane skeleton synthesized from a 2acetyl CoA to mevalonic acid to isopentemyl pyrophosphate to 4 isopentenyl pyrophosphate to geranylgeranyl
pyrophosphate to copalylpyrophosphate to kaurene to kaurenol to keaurenal to kaurenoic acid to GAι2 aldehyde to other giberellins These functions are not clearly
established but it is hypothesized that hydrolysis of starch to sugar occurs by inducing
formation of amylase enzymes Isoprenoid compounds, diteφenes synthesized from
acetate units of acetyl coenzyme A by mevalonic acid pathway stimulate growth Inhibitors of giberellin synthesis include phosphon D, Amo 1618 (blocks conversion of
geranyl pyrophosphate to CO palylpyrophosphate), phosphon D, which also inhibits
conversion of (oxidation) formation of Kaurene, CCC or cycocel, ancymidol, and
pactobutrazol (blocks oxidation of karene and kaurenoic acid) Young leaves are
major sites for giberellin synthesis These plant hormones which induce hydrolysis of polysaccharide into hexoses are used in glycolysis When hexoses are abundant,
glycolysis is more rapid
Glutamyl-tRNA reductase: An enzyme which functions in heme synthesis
Glutamyl-tRNA synthetase: An enzyme which functions in heme synthesis
Glycolysis in Plants: Several reactions of glycolysis also occur in plastids Glycolysis = lysis of sugar, degradation of hexosis to pymvic acid in plants In animals,
degradation of glycogen (animal starch) to pymvate. Plants form no glycogen Glyoxylate pathway: The pathway important for lipid degradation which takes acetyl CoA and converts it to CoA-SH through the conversion of isocitrate to C4 acids
including succinate This pathway utilizes isocitrate lyase and also converts glyoxylate
to malate, a reaction catalyzed by the enzyme malate synthase The glyoxysome or Glyoxylate pathway which is cytoplasmic in certain algae involves isocitrate lyase and malate synthase to metabolize lipids and provide C4 acids A metabolic distinction between autotrophic eukaryotes and heterotrophs is the presence of a glyoxylate cycle
This cycle employs two enzymes, isocitrate lyase and malate synthase, to bypass the
two decarboxylation steps of the TCA cycle and enables the utilization of carbon stored
in fatty acids for growth In plants, the enzymes of the glyoxylate cycle are compartmentalized within a unique single-membrane-bound organelle, the glyoxysome
In certain algae, the cycle is entirely cytoplasmic In plants, these enzymes are most
abundant during germination and senescence In animals, the glyoxylate cycle enzymes have been described as being present only during starvation
Glyoxysome: An organelle which in some instances contains enzymes important in the glyoxylate cycle
GSAT: Glutamate-1 semialdehyde aminotransferase is the enzyme important in heme
synthesis for the conversion of glutamate semialdehyde to ALA (δ-aminolevulinic acid)
Heme synthesis pathway: A metabolic pathway important for generation of heme, poφhyrins and other iron sulfated proteins used in mitochondria in the conventional pathway of energy generation This pathway occurs in plant chloroplasts and uses the nuclear encoded enzyme GSAT A metabolic distinction between plants and animals
occurs in the heme biosynthesis pathway Non-photosynthetic eukaryotes, including
animals, yeast, fungi and protists, produce δ-aminolevulinic acid (ALA), the common
precursor of heme biosynthesis, by condensation of glycine and succinate In contrast,
photosynthetic organisms, including plants, algae and cyanobacteria, E. cob and some other bacteria synthesize ALA from glutamate (a 5-carbon pathway) Euglena utilize
both condensation of glycine and succinate and the 5 carbon pathway to produce δ-
aminolevulinic acid T. gondii also has the ALA synthase which results in formation of
heme by condensation of glycine and succinate, as does P. falciparum (Surolia and
Padmanaban, 1992) Expression of this enzyme is developmentally regulated For example, in plants, GSAT is most abundant in the leaves There are examples in plants (Matters & Beale, 1995, Elich et al, 1988)
Herbicide: A compound which kills plants or algae
Hydrolases: Enzymes which break chemical bonds (e g , amides, esters, glycosides) by
adding the elements of water
Imidazolinones: Inhibitor of acetohydroxy acid synthase (an enzyme involved in the synthesis of branched chain amino acids, a pathway not in or rarely present in animals,
Indole-3-glycerol phosphate synthase (anthranilateisomerase), (indoleglycerol
phosphate synthase): An enzyme which functions in tryptophan synthesis
Inhibitor: A compound which abrogates the effect of another compound A compound which inhibits the replication or survival of a microorganism or the
function of an enzyme or key component of a metabolic pathway or otherwise
abrogates the function of another key molecule in a microorganism or other organisms
or plant
Isocitrate lyase: An enzyme which functions in glyoxylate cycle
Isomerases: Enzymes which rearrange atoms of a molecule to form a stmctural
isomer
Isoprenoid Metabolism in Plants: Teφenes are isoprenoids that lack oxygen and are
pure hydrocarbons, 5 carbon units with some of the general properties of lipids
Giberellins and abscidic acid are others of this vast complex of compounds not found
in animals
Isoprene units (head) are CH2 - CH3C = CH - CH2 (tail) and are synthesized entirely from acetate of acetyl CoA and restricted to plants Synthesized by mevalonic acid
pathway because mevalonate is an important intermediate
Kinases: A subclass of transferases which transfer phosphate groups, especially from
ATP
Latency: The dormant form of the parasitic infection One example is with
Toxoplasma gondii in which the infection is not active and the parasite is primarily
within cysts in the bradyzoite phase of the life cycle Another example is the hypnozoite phase of Plasmodium falciparum
Ligases or Synthetases: Enzymes which join two molecules coupled with hydrolysis
of ATP or other nucleoside triphosphate
Lipases: Enzymes which are hydrolases which hydrolyze fats (esters) Lipid and terpene synthesis associated with plant plastids Also see fatty acid synthesis and teφenes
Lysases: Enzymes which form double bonds by elimination of a chemical group
Malaria'. Disease due to pathogenic Plasmodia Examples are Plasmodium falciparum, Plasmodium virax, Plasmodium ovale, Plasmodium malaria, in humans
and Plasmodium knowlesn in monkeys
Malate synthase: An enzyme which functions in glyoxylate cycle
Metabolic pathways: Both anabolism and cataboiism consist of metabolic pathways in which an initial Compound A is converted to another B, then B is converted to C, C
to D and so on until a final product is formed In respiration, glucose is the initial
compound, and CO2 and H2O are the final products There are approximately 50 distinct reactions in respiration but other metabolic pathways have fewer reactions
Herein the phrases "metabolic pathways" and "biochemical pathways" are used
interchangeably.
Metabolism: Chemical reactions that make life possible. Thousands of such reactions
occur constantly in each cell.
Microbes: Organisms which are visible only with use of a microscope. Some cause disease (are pathogenic).
Microbicidal: An agent (e.g., an antibiotic or antimicrobial compound) which kills
microbes.
Mitochondria: An organelle responsible for the generation of energy.
Multilamellar: An adjective which refers to the multiple membranes within an
organelle.
Noncompetitive inhibitors: Combine with enzymes at sites other than active site.
"Not involve": Are not a starting point, a component, or a product of the metabolic pathways described in relation to this invention.
NPMG: An inhibitor of EPSP synthase in the shikimate pathway.
Nucleic Acid: Deoxyribonucleic acid and ribonucleic acid molecules are constmcted of a sugar phosphate backbone and nitrogen bases; important in the encoding, transcription and synthesis of proteins.
Oocyst: A life cycle stage of a parasite, e.g., Toxoplasma gondii that contains sporozoites. T. gondii sporozoites and oocysts form only in the cat intestine. This form of the parasite is able to persist in nature in warm, moist soil for up to a year and
is highly infectious. Spomlation occurs several days after excretion of oocysts by
members of the cat family (e.g., domestic cats or wild cats such as lions or tigers)
Spomlation must occur before the oocyst becomes infectious
Organelle: A stmcture within a cell Examples are plastids, mitochondria, rhoptries,
dense granules and micronemes
Oxidoreductases (oxidases, reductases, dehydrogenases): Remove and add electrons or electrons and hydrogen Oxidases transfer electrons or hydrogen to O2 only
Paraminobenzoic acid (PABA): A product of the shikimate pathway in plants
Parasite: An organism which lives in or on a host for a period of time during at least one life-cycle stage
Phagemid: Plasmid packaged within a filamentous phage particle
Phosphoribosyl anthranilate isomerase: An enzyme which functions in tryptophan
synthesis
Plant-like: Present in algae and higher plants, but not or only rarely, or in unusual
circumstances in animals
Plasmodium falciparum: One species of Plasmodium which causes substantial human
disease.
Plasmodium knowlesii: A species of Plasmodium which causes malaria in monkeys
Plastid: A multilamellar organelle of plants, algae and Apicomplexan parasites which contains its own DNA separate from nuclear DNA Plastids have been described in
studies of Apicomplexan parasites which used electron micrographs (Siddall, 1992,
Williamson et al, 1994, Wilson et al, 1991, Wilson et al, 1994, Wilson et al, 1996,
Hackstein et al. , 1995, McFadden et al , 1996)
Polymerases: Enzymes which link subunits (monomers) into a polymer such as RNA or DNA
PPi phosphofructokinase Type I : An enzyme present in plants that functions in glycolysis and in a number of organisms regulates glycolysis In plants and protozoans
PPi, not ATP (as in animals) is utilized to synthesize Fru-1-6P2 from Fm 6P Activity is not stimulated in protozoa by Fru-2-6-P2 (Peng & Mansour, 1992, Denton et al ,
1996a,b)
Prephenate dehydratase (phenol 2-monoxygenase): An enzyme which functions in
phenylalanine synthesis
Prephenate dehydrogenase: An enzyme which functions in tyrosine synthesis
Product: The end result of the action of an enzyme on a substrate
Prosthetic group: Smaller organic nonprotein portion of an enzyme essential for
catalytic activity Flavin is an example
Proteinases: Enzymes which are hydrolases which hydrolyze proteins (peptide bonds)
PS H: Important alternative means for producing energy within chloroplasts and apparently also described as being present in Apicomplexans
Pyrimethamine: An inhibitor of the conversion of folate to folinic acid and thus an inhibitor of nucleic acids production effective against Toxoplasma gondu.
Recrudescence: Reactivation of the parasite Toxoplasma gondii from its latent phase
Respiration: Major catabolic process that releases energy in all cells It involves breakdown of sugars to CO2 and H2O
Ribonucleases: Enzymes which are hydrolases which hydrolyze RNA (phosphate
esters)
Salicylic Acid Metabolism in Plants: Salicylic acid is a plant hormone which promotes activity of cyanide resistant respiration
SHAM: An inhibitor of the alternative oxidase
Shikimate dehydrogenase: An enzyme which functions in chorismate synthesis
Shikimate kinase: (shikimate 3-phosphotransferase) An enzyme which functions in chorismate synthesis
Shikimate pathway A pathway that involves the conversion of shikimate to
chorismate and subsequently the production of folate, aromatic amino acids, and ubiquinone This pathway contains enzymes which lead to production of folic acid, ubiquinone, and aromatic amino acids Folate, ubiquinone, and aromatic amino acids
are products derived from this pathway in plants There is sequential use of products of these pathways as reactants in subsequent enzymatically catalyzed reactions For
example, ubiquinone is an essential coenzyme for both conventional and alternative
respiration There are examples in plants, bacteria and fungi (Bornemann e/ α/., 1995,
Marzabadi et al, 1996, Ozenberger et al, 1989, Shah et al.of 1997, Gilchrist &
Kosuge, 1980, Walsh et al , 1990, Weische & Leistemer, 1985, Green et al , 1992, Young et al, 1971)
Shikimate: The substrate for EPSP synthase.
Sporozoite: Another phase of the life cycle of Toxoplasma gondii which forms within the oocyst which is produced only within the cat's intestine. A highly infectious form
of the parasite.
Stage specific: A characteristic of the parasite which is expressed or present only in a single life cycle stage or in some but not all life cycle stages.
Starch Degradation in Plants: 3 enzymes: α amylase (attack 1, 4 bonds of
amylopectin (to maltose) and amylase (to dextrin). Many activated by Ca++ Located
in chloroplasts. β amylase hydrolyzes starch to maltose; starch phosphorylase
degrades starch beginning at nonreducing end. (Starch + H2PO4 *= glucose + - Phosphate) Only partially degrades amylopectin debranching enzymes hydroxy 1.6
branch linkage in amylopectin. Hexoses cannot move out of chloroplasts or
amyloplasts thus must be converted to triose phosphate (3-PG aldehyde and dehydroxyacetone P), sucrose + UDP *— fructose + UDP-glucose, *= sucrose
synthase
Starch Formation in Plants: Animals store starch as glycogen and plants store starch
as amylose and amylopectin. Starch synthesis is dependent on starch synthase and
branching Q enzymes. Mutations in genes encoding these enzymes lead to diminished production of starch. In addition, amylopectin synthesis predominates in plant mutants
without UDP-glucose-starch glycosyl transferase whereas wild type plants with this enzyme make predominantly amylose and a smaller amount of amylopectin. In the
mutant UDP-glucose-starch glycosyl transferase appears to be transcriptionally
regulated Amino acid motifs that target proteins to plant plastid organelles have been
identified in UDP-glucose starch glycosyl transferase, as have other motifs that
determine transit into plastids and mitochondria and these have been used to target the transported proteins in plants Reactions include ADPG + small amylose (in glucose) *>→larger amylose (N+l glucose units)+ADP,*= starch synthase K+ Branching or Q
enzymes form branches in amylopectins between C6 of the main chain and Cl of the
branch chain There are examples in plants (Abel et al, 1996, Van der Leif et al, 1991, Van der Steege et al, 1992)
Starch synthase: catalyzes reaction ADPG + small amylose (n-glucose units) ->
larger amylose n+l glucose units + ADP and is activated by K+ Thus, sugars not starch accumulate in plants deficient in K+
Starch: Major storage carbohydrate of plants, used for energy regeneration Two
types composed of D glucose connected by 1, 4 bonds which cause starch chains to
coil into helices. The two types are amylose and amylopectin Amylopectin is highly branched with the branches occurring between C-6 of a glucose in the main chain and C-l of the first glucose in the branch chain (-1,6 bonds) Amyloses are smaller and
have fewer branches Amylopectin becomes puφle or blue when stained with iodine-
potassium-iodine solution Amylopectin exhibits a puφle red color Control of starch formation is by K+ and a light activated sucrose phosphate synthase enzyme, invertase
enzymes and the allosteric effect of fructose 2, 6 phiphosphate adenosine
diphosphoglucose (ADPG) donates glucoses to form starch Starch in amyloplasts is a
principal respiratory substrate for storage organs
Substrate reactant: Enzyme substrates have virtually identical functional groups that are capable of reacting Specificity results from enzyme substrate combinations similar to a lock and key arrangement
Substrate: The protein on which an enzyme acts that leads to the generation of a
product
Sucrose Formation Reactions in Plants: UTP+glucose 1 phosphate ^UDPG+PPi
PPi+H20 +2 Pi
UDPG+fructose 6 phosphate^sucrose-6-phosphate+UDP
Sucrose-6-PHOSPHATE+H20-sucrose+Pi UDP+ATP-*UTP+ADP
•. glucose- 1 -phosphate+fmctose 6 phosphate+2 H20+ATP^sucrose 3Pi+ADP
Sulfadiazine: An antimicrobial agent effective against Toxoplasma gondii which
competes with para-aminobenzoic acid important in folate synthesis
Sulfonylureas: Inhibitors of acetohydroxy acid synthase (an enzyme involved in the
synthesis of branched chain amino acids, a pathway not or rarely present in animals),
Synergy: The effect of a plurality of inhibitors or antimicrobial agents which is greater than the additive effect would be combining effects of either used alone Synergy occurs particularly when the action of an enzyme (which is inhibited) on a substrate
leads to a product which is then the substrate for another enzyme which also is
inhibited, that is, when the enzymes are in series or follow one another in a pathway
This effect occurs because the production of the first enzymatic reaction provides less substrate for the second reaction and thus amplifies the effect of the second inhibitor or
antimicrobial agent In contrast, an additive effect is when the effect of the compounds
used together is simply the sum of the effects of each inhibitory compound used alone
This most often occurs when the pathways are in parallel, for example, when the effect on the first enzyme does not modify the effect of the second enzyme
Tachyzoite: The rapidly replicating form of the parasite Toxoplasma gondii
Theileria: An Apicomplexan parasite infecting cattle
Toxoplasma gondii: A 3-5 micron, obligate, intracellular, protozoan parasite which is an Apicomplexan
Toxoplasmosis: Disease due to Toxoplasma gondii
Transit (translocation) peptide sequence: Amino acid sequence which results in transit into or out of an organelle These have been described in plants (Volkner &
Schatz, 1997, Theg & Scott, 1993) Herein we also call it a "metabolic pathway," although it is part of a component of a metabolic pathway or may function
independently of a metabolic pathway
Triazine: An inhibitor of PS II complex
Tryptophan synthase alpha subunit: An enzyme which functions in tryptophan
synthesis
Tryptophan synthase beta subunit: An enzyme which functions in tryptophan
synthesis
Type I PPi phosphofructokinase is another enzyme present in plants and there is
different substrate utilization by phosphofructokinases of animals
UDP glucose starch glycosyl transferase: An enzyme involved in production of amylose in plants. The absence of this enzyme leads to starch formation as amylopectin rather than amylose.
USPA: Gene which encodes a universal stress protein. This has been described in E. Co// (Nystrom & Neidhardt, 1992).
DOCUMENTS CITED
Abel, Gernot J W , Springer, Franziska, Willmitzer, Lothar, Kossmann, Jens, (1996) The Plant Journal 10(6) p 981-991
Ausubel, F M , Brent, R , Kingston, R E , Moore, D D , Seidman, J G , Smith, J A , and Struhl, K (1987) Wiley Interscience, New York
Askan, F K and McDonnell, W M (1996) The New England Journal of Medicine, 334(5) 316-318
Avissar YJ, Beale SI (1990) J Bacteriol, 712(3) 1656-1659
Bass HS, Njogu RM and Hill GC (1990) Exp Parasitol 70 486-489 Beckers, C J M , Roos, D S , Donald, R G K , Luft, B J , Schwab, J C , Cao, Y , and Joiner, K A (1995) J Clin Invest 95 367-376
Blais, J , Gameau, V , and Chamberland, S (1993) Antimicrob Agents Chemother 37 1701-1703
Bohne, W, Parmely SS, Yang S and Gross (1996) Ed U Gross, Current Topics in Micro & Immu. 219 81-94
Bohne, W , Heesemann, J , & Gross, U (1993) Infection and Immunity 61, 1 141-1145
Bornemann, Stephen, Ramjee, Manoj K , Balasubramanian, Shankar, Abell, Chris, Coggins, John R , Lowe, David J , Thomeley, Roger N , (1995) The Journal of Biological Chemistry 270 39 22811-22815 Boyer K and McLeod R (In Press, 1996) Toxoplasmosis Principles and Practice of Pediatric Infectious Diseases , 1st Edition, in S Long, L Pickering L, C Proeber Churchill and Livingstone, First Ed (In Press)
Brown CR, Estes RG, Beckmann E, Hunter CA, Remington JS, David C, Forman J and McLeod R (1995) Immunology, 85 419-28 Buxton, D , Thomson, K M , Maley, S , Wright, S & Bos, H J (1993) Veterinary Record 133, 310-312
Cate, J H , Gooding, A R , Podell, E , Zhou, K , Golden, B L , Kundrot, C E , Cech, T R , Doudna, J A (1996), Science, 273 1678-1685
Charbonnier, Jean-Baptiste et al. (1997), Science, 275 1140-1142
Chaudhuri, M. et al. (1996) Molec. Biochem. Parasitol 83: 125-129.
Clarkson, Jr., Allen B., Bienen, E. Jay, Pollakis, Georgios, Grady, Robert W., (1989) Comp. Biochem. Physiol. 94B (2):245.
Craig III SP and AE Eakin, Parasitol Today, 13:6:238-241, 1997. Current Protocols in Immunology ( 1996)
Denton H, Brown MA, Roberts CW, Alexander J, McDonald V, Thong K-W & Coombs, GH (1996a) Molecular and Biochemical Parasitology 76:23-29.
Denton H, Roberts CW, Alexander J, Thong K-W & Coombs GH (1996b) Molecular and Biochemical Parasitology FEMS Microbiological Letters. 137: 103-108. Donald RGK, Carter D, Ullman B, Roos DS. (1996) J. of Biol. Chem. 271.
Donald RGK, and DS Roos (1993) Proc. Natl. Acad. Sci. 90: 11703-1 1707.
Donald RGK, and DS Roos (1994) Mol and Biol Parasitol 63:243-253.
Donald RGK and DS Roos (1995) Proc. Natl. Acad. Sci. 92:5749-5753.
Dubremetz JF and Soete M (1996) Ed U. Gross, Current Topics in Micro. & Immu. 219:76-80.
Elich, Tedd D., Lagarias, J. Clark (1988) Plant Physiol. 88, p. 747-751.
Elliott T, Avissar YJ, Rhie G and Beale SI (1990) J. Bacteriol. 172:7071-7084.
Fichera, M M., Bhopale, M.K., and Roos, D S. (1995) Antimicrob. Agents Chemother. 39:1530-1537. Fry, M. and Beesley, J.E. (1991) Parasitology, 102: 17-26.
Gilchrist D.G, Kosuge T (1980) Chapter 13. The Biochemistry of Plants, Vol. 5, Academic Press, Inc.
Gough SP, Kannangara CG, Bock K (1989) Carlsberg Res. Commun. 54:99-108.
Green, Jacaiyn M., Merkel, William K., Nichols, Brian P. (1992) Journal of Bacteriology 174 (16):5317-5323.
Grimm B (1990) Proc. Natl. Acad. Sci. 87:4169-4173.
Grula, John W., Hudspeth, Richard L., Hobbs, Susan L., Anderson, David M. (1995) Plant Molecular Biology 28:837-846.
Hackstein JHP, Mackenstedt U, Melhorn H, Schubert H and Leunissen JAM (1995) Parasitol Res. 81 :207-216. Hill GC (1976) Biochimica Biophysica Acta 456: 149-193.
Holfels E, McAuley J, Mack D, Milhous W, and McLeod R (1994) Antimicrob. Ag. and Chemother. 38(6): 1392-1396.
Howe G, Mets L, Merchant S (1995) Mol. Gen. Genet. 246: 156-165.
Jahn D, Chen M-W, Soil D (1991) J. Biol. Chem. 266: 139-150. Kahn FR, Saleemuddin M, Siddiqi M and McFadden BA (1977) Arch. Biochem. Biophys. 183: 13-23.
Kasper LH, Crabb J., Pfefferkorn, E.R. (1983) J. Immunol. 130:2407-2412.
Kemp, B E., Rylatt, D.B., Bundesen, P.G., Doherty, R.R., McPhee, D A., Stapleton, D., Cottis, L.E., Wilson, K., John, M.A., Khan, J.M. et al. (1988) Science 241(4871): 1352-1354.
Khoshnoodi, Jamshid, Blennow, Andreas, EK, Bo, Rask, Lars, Larsson, Hakan (1996) Eur. J. Biochem., 242: 148-155.
Kirisits, M.J., Mui, E., and McLeod, R., Fourth International Biennial Toxoplasma Conference, Drymen, Scotland, 1996. Klee HJ, Muskopf YM, Gassa CS (1987) Molec. Gen. Genet. 210:437-442.
Klόsgen RB and Well J-H (1991) Mol. Gen. Genet 225:297-304.
Kohler S, Delwiche CF, Denny PW, Tilney LG, Webster P, Wilson PJM, Palmer JD, Roos DS. (1997) Science 275:1485-1489.
Kortstee, Anne J., Vermeesch, Angela M.S., deVries, Beja J., Jacobson, Evert, Visser, Richard G.F. (1996) The Plant Journal 10(1), 83-90.
Kumar, A.M. and Soil, D. (1992) Proc. Natl. Acad. Sci. USA 89:10842-10846.
Kuriki, Takashi, Guan, Hanping, Sivak, Mirta, Preiss, Jack (1996) Journal of Protein Chemistry, 15 (3):305-313.
Lambers H (1990) In Plant Physiology, Biochemistry & Molecular Biology Dennis D T , and Tuφin, D H (eds) John wiley & Sons, New York, pp 124-143
Li Q, Ritzel RG, McLean, LT, Mclntosh L, Ko T, Bertrand H and Nargang FE (1996) Genetics 142 129-140 Mack D and R McLeod (1984) Anti icrob Ag Chemother 26 26-30
Mack D, R McLeod and B Stark, Eur J Protistol, 32 96-103, 1996
Mahal LK, Yarema KJ, Bertozzi, CR (1997) Science 276 1 125-8
Maloy SR, Bohlander and Nunn WD (1980) J Bacteriol 143 720-725
Maloy SR and Munn WP (1982) J Bacteriol 149 173-180 Marzabadi, Mohammad R , Gmys, Kenneth J , Pansegrau, Paul D , Walker, Mark C , Yuen, Henry K , Sikorski, James A (1996) Biochemistry 35 4199-4210
Matters GL and Beale, SI (1995) Plant Mol Biol 27 607-617
McAuley J, et al , Clin Inf Dis, 18 38-72, 1994
McFadden GI, Keith, ME, Munholland JM, Lang Unnasch N (1996) Nature 381 482 Mclntosh L (1994) Plant Physiol 329 781-786
McLeod R, Cohen H, and R Estes (1984) JID 149 234-244
McLeod R, JK Frenkel, RG Estes, DG Mack, P Eisenhauer and G Gibori (1988) J Immunol 140 1632-1637
McLeod R, D Mack and C Brown (1991) Exper Parasitol 72 109-121 McLeod R, D Mack, R Foss, K Boyer, S Withers, S Levin and J Hubbel ( 1992) jAntimicrob Ag Chemother. 36 1040-1048
Mets, L and A Thiel, in P B ger & G Sandmann, eds, (1989) Target Sites of Herbicide Action Biochemistry and Genetic Control of the Photosystem-II Herbicide Target Site CRC Press, Boca Raton, FL, pp 1-24 Milhous W et al (1985) Antimicrobial & Chemo Therapies 27 525-530
Mineo JR, R McLeod, D Mack, J Smith, I A Kahn, KH Ely and L Kasper (1993) J Immunol 50 3951-3964
Morell, Matthew K , Blennow, Andreas, Kosar-Hashemi, Behjat, Samuel, Michael S (1997) Plant Physiol 113 201-208
Mousdale, D And Coggins, J (1985) L Planta 163 241-249
Nichols, Bnan P , Green, Jacalyn M (1992) Journal of Bacteriology 174 (16) 5309 Nystro , Thomas, Neidhardt, Frederick (1993) J Bactenol 175 3949-3956
Odou a et al. (1988) Exp Parasit 66 86-95
Ott, Karl-Heinz, Kwagh, Jae-Gyu, Stockton, Gerald W , Sidorov, Vladimir, Kakefuda, Genichi (1996) J Mol Biol 263, 359-368
Ozenberger, Bradley A , Brickman, Timothy J , Mclntosh Mark A (1989) Journal of Bacteriology 171(2) 775-783
Pace, Norman R (1992) Science, Vol 256, p 1402
Peng, Zao-Yuan, Mansour, Tag E (1992) Molecular and Biochemical Parasitology 54 223
Pfefferkorn, E R and Borotz, S E (1994) Antimicrob Agents Chemother 38 31-37 Pfefferkon, E R , Nothnagel, R F , and Borotz, S E (1992) Antimicrob Agents Chemother 36 1091-1096
Pollakis, Georgios, Grady, Robert W , Dieck, Harold A , and Clarkson, Jr , Allen B (1995) Biochemical Pharmacology, 50 (8) 1207
Pukrittaykamee, S , Viravan, C , Charoenlaφ, P , Yeamput, C , Wilson, R J M , and White, N J (1994) Antimicrob Agents Chemother, 38 511-514
Rhoads, David M , Mclntosh, Lee (1992) The Plant Cell 4 1 131-1 132
Roberts, C W , Cruickshank, S M , Alexander, J (1995) Infection and Immunity 63 2549-2555
Roberts, C and McLeod, R (1996) Toxoplasma gondii In Infectious Diseases in Medicine and Surgery J Bartlett, S Gorbach, N Blacklow (Eds ), Philadelphia, WB Saunders Co , In Press
Robson, K J H , Gamble, Y , and Acharya, K R (1993) Philos Trans R Soc Lond series B 340 39-53
Roos, D S , (1996) Ed U Gross, Current opics in Micro. & Immu V 219, Springer
Roush W. (1997) Science 276:1192-3.
Sangwan, I. and O'Brian, M.R. (1993) Plant Physiol. 102:829-834.
Schwab, J.C., Cao, Y., Slowik, M.R., and Joiner, K.A. (1994) Antimicrob. Agents Chemother. 38: 1620-1627. Shah, A., Font, J. L. Miller, M. J. Ream, J. E., Walker, M. C, Sikorski, J. A. (1997) Bioorganic and Medicinal Chemistry 5:323-334.
Sibley, L.D. and Krahenbuhl, L.J. (1988) Eur. J. Cell Biol. 47:81-87.
Siddall, M.E. (1992) Parasitol Today 8:90-91.
Soete M. Camus D. and Dubremetz J.F. (1994) Exp. Parasitol. 78:361-370. Strath, M., Scott-Finnigan, T., Gardner, M., Williamson, D.H., and Wilson, R.J.M. (1993) Trans. R. Soc. Trop. Med. Hyg. 87:21 1-216.
Surolia, N. and Padmanaban, G. (1992) Biochem. Biophys. Res. Comm. 187:744-750.
Theg S. and Scott S.V. (1993) Trends in Cell Biol. Vol 3: Elsevier Science Publishers Ltd. (Section of Plant Biology, Univ. of CA, Davis, Ca). Thompson, J.D. Higgins, D.G. and Gibson, T J. (1994) Nucleic Acids Research, 22:4673-4680.
Tine, John A. et al. (1996) Infection and Immunity, 3833-3844.
Tolbert, N.E. (1980) The Biochemistry of Plants, Vol. 1 : Academic Press, Inc.
Tomovo, S. and Boothroyd J.C. (1995) Int. J. of Parasitol 25:1293-1299. Ulmer, Jeffrey B., Donnelly, John J., Liu, Margaret A. (1996) DNA Vaccines Promising: A New Approach to Inducing Protective Immunity. According to experiments with several animal species, antigen-encoding DNA can elicit protective immune responses, ASM News, Vol. 62, No. 9 pp. 476-479.
Van der Leif, Feilke R., Visser, Richard G.F., Ponstein, Anne S., Jacobsen, Evert, Feenstra, Will J. (1991) Mol. Gen. Genet. 228:240-248.
Van der Steege, Gerrit, Nieboer, Maarten, Swaving, Jelto, Tempelaar, M.J. (1992) Plant Molecular Biol. 20: 19-30.
Volker H, Schatz G. (1997) Cell Biology 7: 103-106.
Walsh, Christopher T., Liu, Jun, Rusnak, Frank, Sakaitani, Masahiro (1990) Chem. Rev. 90: 1105-1129.
Weinstein D. and Beale S.I. (1985) Arch. Biochem. Biophys. 237:454-464.
Weische, Alfons, Leistner, Eckhard (1985) Biosynthesis, Tetrahedron Letters 26 (12): 1487-1490.
Weiss L.M., LaPlace D., Tanowitz H.B. and Witner M. (1992) J. Inf. Dis. 166:213- 215.
Williamson, D.H., Gardner, M.J., Preiser, P., Moore, D.J., Rangarchari, K., and Wilson, R.J.M. (1994) Mol. Gen. Genet. 243:249-252. Wilson R.J.M., Gardner M.J., Feagin J.E., Williamson D.H.(1991) Parasitol. Today 7:134-136.
Wilson, R.J.M., Williamson, D.H., and Preiser, P. (1994) Infectious Agents and Disease 3:29-37.
Wilson RJ, Denny PW, Preiser PR, Rangachari K, Roberts K, Roy A, Whyte A, Strath M, Moore DJ, Moore PW, Williamson DH. (1996) J. Mol. Biol. 261 :2: 155-72.
Young, IG., Langman, L., Luke, R.K., Gibson, F. (1971) Journal of Bacteriology, p.
51-57.