WO1997028819A1 - Vaccine against hantavirus - Google Patents
Vaccine against hantavirus Download PDFInfo
- Publication number
- WO1997028819A1 WO1997028819A1 PCT/SE1997/000180 SE9700180W WO9728819A1 WO 1997028819 A1 WO1997028819 A1 WO 1997028819A1 SE 9700180 W SE9700180 W SE 9700180W WO 9728819 A1 WO9728819 A1 WO 9728819A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- puu
- bank
- amino
- protein
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims abstract description 11
- 241000150452 Orthohantavirus Species 0.000 title abstract description 14
- 241000700605 Viruses Species 0.000 claims abstract description 95
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 40
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 40
- 239000012634 fragment Substances 0.000 claims abstract description 34
- 210000003719 b-lymphocyte Anatomy 0.000 claims abstract description 18
- 230000003053 immunization Effects 0.000 claims abstract description 15
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims abstract description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 5
- 239000002671 adjuvant Substances 0.000 claims description 8
- 241000150264 Puumala orthohantavirus Species 0.000 abstract description 8
- 241000466360 Myodes glareolus Species 0.000 description 61
- 241001465754 Metazoa Species 0.000 description 38
- 239000000427 antigen Substances 0.000 description 28
- 102000036639 antigens Human genes 0.000 description 27
- 108091007433 antigens Proteins 0.000 description 27
- 230000009257 reactivity Effects 0.000 description 21
- 238000002965 ELISA Methods 0.000 description 14
- 238000002649 immunization Methods 0.000 description 12
- 230000036039 immunity Effects 0.000 description 11
- 208000015181 infectious disease Diseases 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 230000009385 viral infection Effects 0.000 description 11
- 108090000288 Glycoproteins Proteins 0.000 description 10
- 102000003886 Glycoproteins Human genes 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 10
- 210000004072 lung Anatomy 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 230000005875 antibody response Effects 0.000 description 9
- 230000000890 antigenic effect Effects 0.000 description 9
- 101710141454 Nucleoprotein Proteins 0.000 description 8
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 7
- 208000032982 Hemorrhagic Fever with Renal Syndrome Diseases 0.000 description 7
- 210000004027 cell Anatomy 0.000 description 7
- 238000013507 mapping Methods 0.000 description 7
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 230000003472 neutralizing effect Effects 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- 230000001681 protective effect Effects 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 238000003556 assay Methods 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 238000000034 method Methods 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 4
- 206010019143 Hantavirus pulmonary infection Diseases 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 230000000875 corresponding effect Effects 0.000 description 4
- 201000005648 hantavirus pulmonary syndrome Diseases 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 241000701447 unidentified baculovirus Species 0.000 description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 241000699800 Cricetinae Species 0.000 description 3
- 108010024636 Glutathione Proteins 0.000 description 3
- 206010061192 Haemorrhagic fever Diseases 0.000 description 3
- 101800004196 Peptide P4 Proteins 0.000 description 3
- 101900323950 Puumala virus Nucleoprotein Proteins 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000002596 correlated effect Effects 0.000 description 3
- 230000000763 evoking effect Effects 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 210000004201 immune sera Anatomy 0.000 description 3
- 229940042743 immune sera Drugs 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 3
- 230000004807 localization Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 239000013598 vector Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 2
- 241001529533 Apodemus agrarius Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 101710121417 Envelope glycoprotein Proteins 0.000 description 2
- 101710091045 Envelope protein Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- BACYUWVYYTXETD-UHFFFAOYSA-N N-Lauroylsarcosine Chemical compound CCCCCCCCCCCC(=O)N(C)CC(O)=O BACYUWVYYTXETD-UHFFFAOYSA-N 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 241000699692 Peromyscus maniculatus Species 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 101710188315 Protein X Proteins 0.000 description 2
- 241000150288 Sin Nombre orthohantavirus Species 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 239000000562 conjugate Substances 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 230000008348 humoral response Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000021633 leukocyte mediated immunity Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 108700004121 sarkosyl Proteins 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 108010021561 4-Nitrophenylphosphatase Proteins 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000035751 Epidemic nephropathy Diseases 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241001428964 Four Corners hantavirus Species 0.000 description 1
- 101900102847 Hantaan virus Nucleoprotein Proteins 0.000 description 1
- 208000008913 Hantavirus Infections Diseases 0.000 description 1
- 208000021727 Hantavirus hemorrhagic fever with renal syndrome Diseases 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 101900206046 Puumala virus Envelope glycoprotein Proteins 0.000 description 1
- 101900006857 Puumala virus Nucleocapsid protein Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 241000700161 Rattus rattus Species 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 241000150289 Tula orthohantavirus Species 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 108010087302 Viral Structural Proteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- QPMSXSBEVQLBIL-CZRHPSIPSA-N ac1mix0p Chemical compound C1=CC=C2N(C[C@H](C)CN(C)C)C3=CC(OC)=CC=C3SC2=C1.O([C@H]1[C@]2(OC)C=CC34C[C@@H]2[C@](C)(O)CCC)C2=C5[C@]41CCN(C)[C@@H]3CC5=CC=C2O QPMSXSBEVQLBIL-CZRHPSIPSA-N 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940019748 antifibrinolytic proteinase inhibitors Drugs 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- KAKKHKRHCKCAGH-UHFFFAOYSA-L disodium;(4-nitrophenyl) phosphate;hexahydrate Chemical compound O.O.O.O.O.O.[Na+].[Na+].[O-][N+](=O)C1=CC=C(OP([O-])([O-])=O)C=C1 KAKKHKRHCKCAGH-UHFFFAOYSA-L 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- 208000029629 hantavirus infectious disease Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000002008 hemorrhagic effect Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 210000003936 merozoite Anatomy 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 201000010756 nephropathia epidemica Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 210000000605 viral structure Anatomy 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/12011—Bunyaviridae
- C12N2760/12111—Hantavirus, e.g. Hantaan virus
- C12N2760/12122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- the present invention relates to vaccines against hantaviruses, especially Puumala virus.
- Hantaviruses members of the family Bunyaviridae, are enveloped negative- stranded RNA viruses with tripartite genomes (Schmaljohn et al., 1985).
- the Hantavirus genus is comprised of at least eight serologically and genetically distinct groups of viruses: Hantaan (HTN), Seoul (SEO), Puumala (PUU), Prospect Hill (PH), Dobrava, Thailand, Thottapalayam and Sin Nombre/Four Corners viruses (Xiao et al., 1994).
- nudeotide sequence and immunological data on five potentially new serotype viruses, Tula (TUL), El Moro Canyon, Khabarovsk, Bayou, and Black Creek Canal have been reported.
- Small mammals mainly rodents, are the natural reservoirs of hantaviruses and transmission to humans occurs via aerosolized animal excreta.
- HTN, SEO and PUU viruses carried by the striped field mouse (Apodemus agrarius), rats (Rattus norvegicus and R. rattus) and the bank vole (Clethrionomys glareolus), respectively, cause clinically similar human diseases, referred to as hemorrhagic fever with renal syndrome (HFRS).
- HFRS hemorrhagic fever with renal syndrome
- the diseases are characterized by fever, renal failure and, in severe cases, hemorrhagic manifestations (Yanagihara and Gajdusek, 1988).
- the clinical manifestations of HFRS are generally most severe for infections caused by HTN virus, less severe for SEO virus, and milder for PUU virus.
- HPS hantavirus pulmonary syndrome
- the genomes of hantaviruses encode four structural proteins: the L-segment encodes a virus associated RNA dependent RNA polymerase, the M-segment two glycosylated envelope proteins (G1 and G2), and the S-segment a nucleocapsid protein (N) (Antic et al., 1991).
- the envelope glycoproteins are presumed to be the major elements involved in induction of immunity to hantaviruses, since monoclonal antibodies (Mabs) to G1 and G2, but not to the nucleocapsid protein (N), have been found to neutralize viral infectivity in vitro (Dantas et al., 1986; Arikawa et al., 1989; Lundkvist and Niklasson 1992).
- Mabs monoclonal antibodies
- N nucleocapsid protein
- the importance of the humoral response for protection against HTN virus infection has been demonstrated by passive transfer of immune sera or Mabs and subsequent challenge with virus (Schmaljohn et al., 1990; Arikawa et al., 1992).
- HTN virus glycoproteins expressed by baculovirus and vaccinia virus vectors, have been shown to protect hamsters from infection. For complete protection, recombinants expressing both G1 and G2 were needed (Schmaljohn et al., 1990). Passive transfer of spleen cells from mice immunized with recombinant G1/G2 partially protected suckling mice from infection (Yoshimatsu et al., 1993).
- HTN virus recombinant N has been shown to protect hamsters and suckling mice from HTN virus infection (Schmaljohn et al., 1990; Yoshimatsu et al., 1993).
- a Mab specific for HTN N has been shown to protect mice from infection (Yoshimatsu et al., 1993).
- virus vaccines which comprise, as an immunizing component, at least one member of the group consisting of a) a recombinant protein having the amino-acid sequence of Fig.1 , b) fragments of said protein which comprise B-cell and/or T-cell epitopes and, c) amino-acid sequences which are at least 80% homologous to the sequences of a) or b) and which comprise B-cell and/or T-cell epitopes.
- the antigenic proteins or peptides are optionally coupled to adjuvants.
- the adjuvants should be selected from pharmaceutically acceptable adjuvants accepted for use in human vaccines by the health authorities, e.g. FDA.
- Vapalahti et al., 1992 was propagated in Vero E6 cells (CRL 1586, ATCC) cultivated in Eagle ' s MEM supplemented with 2% fetal calf serum (FCS), 2 mM L-glutamine and antibiotics.
- FCS fetal calf serum
- PUU virus strain Kazan was passaged in colonized bank voles as previously described (Grajovskaya et al., 1983).
- the peptide P4 a 30 amino acid (aa) carboxy-terminal amide corresponding to residues 241-270 (EKECPFIKPEVKPGTPAQEIEMLKRNKIYF) of PUU virus N, was ordered from and synthesized by Scandinavian Peptide Synthesis (Koping, Sweden).
- bac-PUU-N a recombinant baculovirus
- the antigen consisted of an extract of Spodoptera frugiperda (Sf9) cells containing approximately 35% of bac-PUU-N, solubilised with urea and passed through Sephadex columns into an aqueous buffer with proteinase inhibitors.
- D (TTTGTCGACGGATCCAAGGATTGGTCTGAGAGAA) and E: (TTTGAATTCGTCGACTCAGCAACATAGATACATGTTGG), Construct rN 2b coding for aa 135-214 with primers F: (TTTGTCGACGGATCCAAAGCTTTATACATGTCTC and
- GST-fusion proteins were performed as recommended by the manufacturer (Pharmacia, Sweden). Briefly, overnight cultures of transformed BL21 bacteria (Studier et al, 1990) were diluted 1/100 and grown for 2 h at 37°C, induced with 0.5 mM IPTG for 3h after which the cells were pelleted. GST-fusion proteins were purified by binding to Glutathione Sepharose 4B beads (Pharmacia) in the presence of 2% N-lauroylsarcosine (Sigma, St. Louis, MO) as described by Frangioni et al. (1993). The protein was eluted from the beads by 25mM reduced glutathione (Boehringer Mannheim, Mannheim, Germany) and dialysed. Immunoblotting
- the PEPSCAN method (Geysen et al., 1987), designed for identification of linear B-cell epitopes, was used to locate antibody-reactive peptides comprised within the sequence of N of PUU virus prototype strain Sotkamo. In total, 141 peptides (14-mer overlapping peptides covering the complete N by a shift of 3 amino acids; Vapalahti et al., 1995a) were examined. Antibody reactivities with PEPSCAN peptides were measured by ELISA as previously described (Geysen et al., 1987), using polyclonal bank vole sera (diluted 1 :200).
- Bound antibodies were detected with alkaline phosphatase (ALP)-conjugated goat anti-mouse IgG and p-nitrophenyl phosphate substrate according to the manufacturer's instructions (Sigma).
- ALP alkaline phosphatase
- Antibody reactivities of wild-trapped and experimentally infected bank voles to PUU rN were examined by ELISA.
- BSA bovine serum albumine
- Detergent-treated native PUU virus antigen prepared as previously described (Lundkvist and Niklasson, 1992), or control antigen (diluent only), followed by serial two-fold dilutions of sera (starting at 1 :200), were added to the plates.
- ALP-labelled donkey anti-mouse IgG Jackson, West Grove, PA
- p-nitrophenyl phosphate substrate Sigma
- Serum antibody responses against PUU virus were measured 1 day before challenge by immunofluorescence assay (IFA; Lundkvist et al., 1991) and focus reduction neutralization test (FRNT; Niklasson et al., 1991).
- IFA immunofluorescence assay
- FRNT focus reduction neutralization test
- Bank voles were challenged s.c. 2 weeks after the last injection (8 weeks post primary immunization) with 10 4 ID 50 of PUU virus (strain Kazan). Animals were sacrificed at 21 days post challenge, and lungs were examined for presence of PUU virus specific antigen by Hantavirus antigen-ELISA as previously described (Lundkvist et al., 1995b). Expression of truncated recombinant PUU virus N.
- the GST-fusion proteins rN 1a (aa 1-79), rN 1b (aa 1-118) rN 2b (aa 135-214), rN 2c (aa 135-327), and rN 3 (aa 229-327) were cloned and expressed to high levels in E.coli.
- These GST-proteins and an earlier described construct rN 2/3 (aa 1-267), used for immunization of bank voles and in ELISA, were purified with glutathione sepharose beads in the presence of N-lauroylsarcosine with moderate to high yields.
- the localization of B-cell epitopes in the N protein of PUU virus was investigated by a panel of bank vole Mabs, which recognize seven distinct antigenic sites on N, and with polyclonal sera from wild-trapped or experimentally infected bank voles.
- the six Mabs 5E1 , 5B5, 3G5, 1C12, 2E12, and 4E5 recognized all fragments covering the amino-terminal region of the protein, thus identifying six epitopes within the amino-terminal region (aa 1-79, Table 1).
- Mab 3H9 reacted exclusively with two fragments, rN 2/3 (aa 1-267) and rN 3 (aa 229-327), which correlated well with the previously reported mapping of its epitope (N-a) to aa 251-260 (Lundkvist et al., 1995a).
- pooled sera from bank voles and mice immunized with P4-KLH conjugate showed high reactivity with native PUU virus N with end-point titers of 800 and 6400, respectively.
- Bank voles immunized with P4 alone i.e..
- the assay was proven to detect only antibodies directed to the two PUU virus envelope glycoproteins when the antigen-specificity was evaluated by PUU virus N-, G1- and G2-specific Mabs. No cross-reaction, due to unspecific binding to the solid-phase of N antigen, was shown with the N-specific Mab, which demonstrated disassociation of the detergent- disrupted and indirectly coated viral components.
- the detection limit of the assay was estimated to be less than 15 ng/ml of bank vole IgG by end-point titration of pooled G1- and G2-specific Mabs.
- the PUU virus nucleocapsid protein was shown to contain several B-cell epitopes recognized by the bank vole, the natural reservoir of this hantavirus. Six of seven previously defined epitopes, recognized by Mabs generated from a virus-infected bank vole, were mapped within the first 20% of the protein (aa 1-79), thereby indicating the amino-terminal region of PUU N as a major antigenic region.
- bank voles immunized with P4 alone i.e. without KLH-conjugation
- the envelope glycoproteins are presumed to be the major elements involved in induction of immunity to hantaviruses. This assumption is based on passive protection experiments and by the neutralizing activity detected in vitro for Mabs directed to G1 and G2, but not to N (Schmaljohn et al., 1990; Lundkvist and Niklasson 1992). The significance of the N-specific antibody response in vivo is, however, not yet completely understood.
- a Mab specific for HTN virus N has been shown to protect from virus infection and N-specific polyclonal sera to significantly increase the time before death in a mouse model (Yoshimatsu et al., 1993).
- N-specific Mabs have been shown to partially protect bank voles from PUU virus infection (Lundkvist et al., unpublished). Therefore, it is likely that the explanation to the reported absence of neutralizing activity for all hantavirus N-specific Mabs, as determined by NT or FRNT, is due to the use of in vitro systems, which do not necessarily reflect the situation in vivo. Accordingly, the humoral response to N may, in addition to the glycoprotein-specific antibody response, be of importance for the immunity e.g. via antibody dependent cell-mediated cytotoxity and complement- mediated cytolysis.
- Table 1 Summary of Mab reactivity in immunoblotting with truncated rN proteins.
- rN 2c (135-327) 200 200 12800 ⁇ 200
- Non-immune control 2 ⁇ 100 ⁇ 40 ⁇ 200
- Non-immune control 8/8 8/8 (6400 - >25600)
- Nephropathia epidemica detection of antigen in bank voles and serologic diagnosis of human infection. J. Infect. Dis. 141, 131-134.
- Tula virus a newly detected hantavirus carried by European common voles. J. Virol. 68, 7833-7838.
- Schmaljohn C. S., Hasty, S. E., Dalrymple, J. M., LeDuc J. W., Lee H. W., von Bonsdorff, C.-H., Brummer-Korvenkontio, M., Vaheri, A., Tsai, T. F., Regnery, H. L., Goldgaber, D., and Lee, P. W. (1985). Antigenic and genetic properties of viruses linked to hemorrhagic fever with renal syndrome. Science 227, 1041-1044. Schmaljohn, C. S., Chu, Y-K., Schmaljohn, A. L., and Dalrymple, J. M. (1990). Antigenic subunits of Hantaan virus expressed by baculovirus and vaccinia virus recombinants. J. Virol. 64, 3162-3170.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Virus vaccine against Hantaviruses, especially Puumala virus, which comprises, an immunizing component, at least one member of the group consisting of: a) a recombinant protein having the amino-acid sequence of the figure; b) fragments of said protein which comprise B-cell and/or T-cell epitopes; and c) amino-acid sequences which are at least 80 % homologous to the sequences of a) or b) and which comprise B-cell and/or T-cell epitopes, are disclosed.
Description
VACCINE AGAINST HANTAVIRUS
The present invention relates to vaccines against hantaviruses, especially Puumala virus.
BACKGROUND OF THE INVENTION
Hantaviruses, members of the family Bunyaviridae, are enveloped negative- stranded RNA viruses with tripartite genomes (Schmaljohn et al., 1985). The Hantavirus genus is comprised of at least eight serologically and genetically distinct groups of viruses: Hantaan (HTN), Seoul (SEO), Puumala (PUU), Prospect Hill (PH), Dobrava, Thailand, Thottapalayam and Sin Nombre/Four Corners viruses (Xiao et al., 1994). In addition, nudeotide sequence and immunological data on five potentially new serotype viruses, Tula (TUL), El Moro Canyon, Khabarovsk, Bayou, and Black Creek Canal have been reported. Small mammals, mainly rodents, are the natural reservoirs of hantaviruses and transmission to humans occurs via aerosolized animal excreta.
HTN, SEO and PUU viruses, carried by the striped field mouse (Apodemus agrarius), rats (Rattus norvegicus and R. rattus) and the bank vole (Clethrionomys glareolus), respectively, cause clinically similar human diseases, referred to as hemorrhagic fever with renal syndrome (HFRS). The diseases are characterized by fever, renal failure and, in severe cases, hemorrhagic manifestations (Yanagihara and Gajdusek, 1988). The clinical manifestations of HFRS are generally most severe for infections caused by HTN virus, less severe for SEO virus, and milder for PUU virus. The mortality of HFRS varies between 0.2%-10% and approximately 150 000 cases occur annually world wide (for review see Lundkvist and Niklasson, 1994). In 1993, a new hantavirus-caused human disease, called hantavirus pulmonary syndrome (HPS), was discovered in the United States (Nichol et al., 1993). HPS, characterized by acute respiratory distress, has a mortality of approximately 50%. The etiologic agent of HPS, designated Sin Nombre/Four Corner viruses, are carried primarily by the deer mouse (Peromyscus maniculatus) (Nichol et al., 1993).
The genomes of hantaviruses encode four structural proteins: the L-segment encodes a virus associated RNA dependent RNA polymerase, the M-segment two glycosylated envelope proteins (G1 and G2), and the S-segment a nucleocapsid protein (N) (Antic et al., 1991). The envelope glycoproteins are presumed to be the major elements involved in induction of immunity to hantaviruses, since monoclonal antibodies (Mabs) to G1 and G2, but not to the nucleocapsid protein (N), have been found to neutralize viral infectivity in vitro (Dantas et al., 1986; Arikawa et al., 1989; Lundkvist and Niklasson 1992). The importance of the humoral response for protection against HTN virus infection has been demonstrated by passive transfer of immune sera or Mabs and subsequent challenge with virus (Schmaljohn et al., 1990; Arikawa et al., 1992). A cell-mediated immune response to HTN virus has also been implicated in protection (Asada et al., 1988, 1989; Yoshimatsu et al., 1993). The actual importance and protein specificity of the cellular response has, however, not been resolved. Recombinant HTN virus glycoproteins, expressed by baculovirus and vaccinia virus vectors, have been shown to protect hamsters from infection. For complete protection, recombinants expressing both G1 and G2 were needed (Schmaljohn et al., 1990). Passive transfer of spleen cells from mice immunized with recombinant G1/G2 partially protected suckling mice from infection (Yoshimatsu et al., 1993). Interestingly, HTN virus recombinant N (rN) has been shown to protect hamsters and suckling mice from HTN virus infection (Schmaljohn et al., 1990; Yoshimatsu et al., 1993). Moreover, a Mab specific for HTN N has been shown to protect mice from infection (Yoshimatsu et al., 1993).
We have recently identified B-cell epitopes on the PUU virus N recognized by the polyclonal antibody response in humans (Lundkvist et al., 1995a; Vapalahti et al., 1995a). With a panel of PUU virus bank vole Mabs, reactive with 8 distinct epitopes on N, only one epitope could be defined when overlapping 10-mer amino acid peptides were used (Lundkvist et al., 1995a). DESCRIPTION OF THE INVENTION
We have now surprisingly found that immunity against Puumala virus infection can be elicited by the administration of a recombinant protein having the amino-acid sequence of the Puumala virus nucleocapsid protein (N) disclosed in Fig.1 (Vapalahti et al. 1992), and some truncated fragments thereof (disclosed in Figs. 2-6).
Thus, the present invention is directed to virus vaccines, which comprise, as an immunizing component, at least one member of the group consisting of a) a recombinant protein having the amino-acid sequence of Fig.1 , b) fragments of said protein which comprise B-cell and/or T-cell epitopes and, c) amino-acid sequences which are at least 80% homologous to the sequences of a) or b) and which comprise B-cell and/or T-cell epitopes.
It is believed that some amino-acid substitutions, deletions, and extensions may occur in the above defined protein a) and fragments b), while such homologous amino-acid sequences defined in c) will still provoke the same type of protective immunity. The closer the homologous sequence is to the parent sequence the more likely the properties are the same. Thus, homologies of 95%, 90% and 85% are preferred.
In the virus vaccines of the invention the antigenic proteins or peptides are optionally coupled to adjuvants. The adjuvants should be selected from pharmaceutically acceptable adjuvants accepted for use in human vaccines by the health authorities, e.g. FDA.
Fragments of the protein a) which can impart at least partial immunity have been disclosed in Fig.2, Fig.3, Fig.4, Fig.5, and Fig.6. To further define the localization of B-cell epitopes recognized by the natural reservoir of PUU virus, the bank vole, we chose to use such longer synthetic peptides and truncated rN proteins. To investigate the role of PUU virus N in protective immunity, we analyzed the immunogenicity of truncated rN proteins and developed an animal model. Our results show that several B-cell epitopes are located in the amino-terminal part of N, and that N produced in insect cells and as GST-fusion proteins in E.coli elicit strong antibody responses and protect animals from infection with PUU virus. MATERIALS AND METHODS Virus strains PUU virus prototype strain Sotkamo (Brummer-Korvenkontio et al., 1980;
Vapalahti et al., 1992) was propagated in Vero E6 cells (CRL 1586, ATCC) cultivated in Eagle's MEM supplemented with 2% fetal calf serum (FCS), 2 mM L-glutamine
and antibiotics. PUU virus strain Kazan was passaged in colonized bank voles as previously described (Gavrilovskaya et al., 1983).
Antibodies
Generation and characterization of PUU virus N-, G1 and G2-specific bank vole Mabs have been described elsewhere (Lundkvist et al., 1991 ; Lundkvist and
Niklasson., 1992). Briefly, colonized bank voles were infected with PUU virus obtained from lung tissues of bank voles trapped in northern Sweden. [Bank vole x mouse] heterohybridomas were established and PUU virus-specific clones were selected after screening against native virus. Large scale Mab production was performed by culturing hybridomas in roller bottles followed by purification on protein-G Sepharose as previously described (Lundkvist et al., 1991). Polyclonal antisera to Keyhole limpet hemocyanin (KLH)-conjugated peptides (Berzins et al., 1986) were raised in bank voles and in Balb/c mice by three biweekly, subcutaneous (s.c), immunizations of 100 μg peptide-conjugate emulsified in Freund's complete adjuvant, Freund's incomplete adjuvant, and phosphate-buffered saline (PBS), respectively.
Peptide P4
The peptide P4, a 30 amino acid (aa) carboxy-terminal amide corresponding to residues 241-270 (EKECPFIKPEVKPGTPAQEIEMLKRNKIYF) of PUU virus N, was ordered from and synthesized by Scandinavian Peptide Synthesis (Koping, Sweden).
Recombinant PUU virus N proteins
The production of PUU N in insect cells with a recombinant baculovirus (bac- PUU-N) has been described in detail elsewhere (Vapalahti et al, 1995b). Briefly, the antigen consisted of an extract of Spodoptera frugiperda (Sf9) cells containing approximately 35% of bac-PUU-N, solubilised with urea and passed through Sephadex columns into an aqueous buffer with proteinase inhibitors. The areas coding for truncated N proteins, expressed as GST-fusion proteins in E.coli, were individually amplified by PCR using the PUU virus Sotkamo strain S cDNA (Vapalahti et al, 1992) as a template, cut with restriction enzymes and cloned to the BamHI and Eco Rl sites of pGEX2T vector (Pharmacia, Uppsala, Sweden) as follows: Construct rN 1a coding for aa 1-79 with primers having the following nudeotide sequenses:
A: (TTTGAATTCTCTAGATCTGGA IQAGTGACTTGACAGA) and B: (TTTGAATTCTTGGATCCAGTCGGTTAAGTAGGTTTAGTA), Construct rN 1b coding for aa 1-1 18 with primers A and C: (TTTGAATTCGTCGACICAATCTGCTGTTTGGCCACTTG), Construct rN 3 coding for aa 229-327 and six extra aa from the polylinker area with primers
D: (TTTGTCGACGGATCCAAGGATTGGTCTGAGAGAA) and E: (TTTGAATTCGTCGACTCAGCAACATAGATACATGTTGG), Construct rN 2b coding for aa 135-214 with primers F: (TTTGTCGACGGATCCAAAGCTTTATACATGTCTC and
G: (TTTGAATTCGTCGACICΔGTTAGCAACCTGGATCTGAG), Construct rN 2c coding for aa 135-327 and six extra aa from the vector with primers F and E. Extra stop codons and the natural initiation codon of PUU N are underlined, restriction sites used for cloning are shown in bold. The cloning and expression of constructs rN 2/3 (aa 1-267, GST-PUU-N2/3, Vapalahti et al, 1995a) and rN Tot
(total coding area, GST-TUL-N, Plyusnin et al, 1994) and rN Eco (aa 1-61 , GST-TUL- N-delta) have been described previously. The plasmid pGEX2T without an insert coding only for the GST was used as a control (GST-c).
The expression of the GST-fusion proteins was performed as recommended by the manufacturer (Pharmacia, Sweden). Briefly, overnight cultures of transformed BL21 bacteria (Studier et al, 1990) were diluted 1/100 and grown for 2 h at 37°C, induced with 0.5 mM IPTG for 3h after which the cells were pelleted. GST-fusion proteins were purified by binding to Glutathione Sepharose 4B beads (Pharmacia) in the presence of 2% N-lauroylsarcosine (Sigma, St. Louis, MO) as described by Frangioni et al. (1993). The protein was eluted from the beads by 25mM reduced glutathione (Boehringer Mannheim, Mannheim, Germany) and dialysed. Immunoblotting
Bacterial cell suspensions were suspended in Laemmli's sample buffer, proteins separated in SDS-PAGE and transferred to Immobilon filters (Millipore, Bedford, MA). After blocking, filters were subsequently incubated with Mabs (1 μg/ml) overnight at 4°C, followed by rabbit anti-mouse peroxidase-conjugate (Dakopatts,
Denmark), diluted 1 :400, for 1h at 20°C. Blots were visualized by addition of 1-1- diaminobenzidine substrate. Epitope mapping (PEPSCAN )
The PEPSCAN method (Geysen et al., 1987), designed for identification of linear B-cell epitopes, was used to locate antibody-reactive peptides comprised within the sequence of N of PUU virus prototype strain Sotkamo. In total, 141 peptides (14-mer overlapping peptides covering the complete N by a shift of 3 amino acids; Vapalahti et al., 1995a) were examined. Antibody reactivities with PEPSCAN peptides were measured by ELISA as previously described (Geysen et al., 1987), using polyclonal bank vole sera (diluted 1 :200). Bound antibodies were detected with alkaline phosphatase (ALP)-conjugated goat anti-mouse IgG and p-nitrophenyl phosphate substrate according to the manufacturer's instructions (Sigma). PUU virus rN ELISA
Antibody reactivities of wild-trapped and experimentally infected bank voles to PUU rN were examined by ELISA. PUU rN fragments, 5 μg/ml in coating buffer (0.05 M carbonate buffer, pH 9.6) of purified proteins or 1 :200 dilutions of non-purified proteins, or non-purified bac-PUU-N (diluted 1:1000), were adsorbed to microtiter plates overnight at 4°C. Unsaturated protein-binding sites were blocked by addition of 3% bovine serum albumine (BSA) in PBS for 1h. Serial dilutions of sera in ELISA buffer (PBS with 0.5% BSA and 0.05% Tween-20) were pre-incubated with 1 % GST- c for 1 h before addition to plates. Adsorbed sera were incubated for 1 h followed by ALP-conjugated goat anti-mouse IgG and p-nitrophenyl phosphatase substrate according to the manufacturer's instructions (Sigma). All incubations (100 μl/well) were performed at 37°C and plates were washed five times in washing buffer (0.9% NaCl and 0.05% Tween 20) between each step. End-point titers were expressed as the reciprocal of the maximum dilution of sera giving a ratio of >3 times that obtained with control antigen.
To investigate antibody reactivity to the carboxy-terminal of PUU virus N (aa 328- 433), bank vole immune sera were pre-absorbed to rN 2/3 and rN 3 (together corresponding to aa 1 - 327) before testing for reactivity to bac-PUU-N (covering total N). Sera (diluted 1 :200) were incubated with a cocktail of rN 2/3 and rN 3 (20 μg/ml of each protein) for 2 h at 20°C.
PUU vims G1/G2 ELISA
Bank vole sera were analyzed for presence of antibodies reactive with the PUU virus envelope glycoproteins (G1 and G2) by an ELISA. The human Mabs G1-1 E7- 1 E5 and 1C9 (Lundkvist et al., 1993a; 1993b), specific for PUU virus G1 and G2 (epitopes G1-b and G2-a2), respectively, 5 μg/ml in coating buffer, were adsorbed to microtiter plates overnight at 4°C. All the following incubations were performed for 1 h at 37°C with five washes between each step. Unsaturated protein binding sites were blocked with 3% BSA in PBS. Detergent-treated native PUU virus antigen prepared as previously described (Lundkvist and Niklasson, 1992), or control antigen (diluent only), followed by serial two-fold dilutions of sera (starting at 1 :200), were added to the plates. ALP-labelled donkey anti-mouse IgG (Jackson, West Grove, PA), followed by p-nitrophenyl phosphate substrate (Sigma), were used to detect specific antibody binding according to the manufacturer's instrudions. End-point titers were determined as described above. The specificity of the assay was examined by Mab reactivity. Bank vole Mabs 5A2 and 5B7, specific for additional G1- and G2-epitopes (G1-a and G2-b), respectively, and consequently not interactive in the antigen binding by the human Mabs used for antigen capture, and the N-specific Mab 3E11, were conjugated to biotin as described elsewhere (Harlow and Lane, 1988). Biotinylated Mabs (0.1 μg/ml) were incubated for 1 h. Peroxidase-conjugated streptavidin (Sigma), followed by tetramethylbenzidine substrate (Sigma) were used according to the manufacturer's instructions to deted specific antibody binding. Animal immunization and PUU virus challenge
To assess immunogenicity as well as protection, 4- to 10-week-old bank voles, derived from a PUU virus free colony established several years earlier with animals captured in Sweden, were immunized with purified truncated PUU virus N-GST fusion proteins, baculovirus PUU N (bac-PUU-N), or GST-c as a negative control. Bank voles were injeded s.c. with 50 μg of specific proteins emulsified in Freund's complete adjuvant. The second and third injections were given with 3 week intervals, using the same amount of proteins in incomplete Freund's adjuvant and PBS, respectively.
Serum antibody responses against PUU virus were measured 1 day before challenge by immunofluorescence assay (IFA; Lundkvist et al., 1991) and focus reduction
neutralization test (FRNT; Niklasson et al., 1991). Bank voles were challenged s.c. 2 weeks after the last injection (8 weeks post primary immunization) with 104 ID50 of PUU virus (strain Kazan). Animals were sacrificed at 21 days post challenge, and lungs were examined for presence of PUU virus specific antigen by Hantavirus antigen-ELISA as previously described (Lundkvist et al., 1995b). Expression of truncated recombinant PUU virus N.
The GST-fusion proteins rN 1a (aa 1-79), rN 1b (aa 1-118) rN 2b (aa 135-214), rN 2c (aa 135-327), and rN 3 (aa 229-327) were cloned and expressed to high levels in E.coli. These GST-proteins and an earlier described construct rN 2/3 (aa 1-267), used for immunization of bank voles and in ELISA, were purified with glutathione sepharose beads in the presence of N-lauroylsarcosine with moderate to high yields. Epitope mapping with truncated rN fragments
The localization of B-cell epitopes in the N protein of PUU virus was investigated by a panel of bank vole Mabs, which recognize seven distinct antigenic sites on N, and with polyclonal sera from wild-trapped or experimentally infected bank voles. When assayed in immunoblotting with four truncated recombinant PUU virus N- fragments, the six Mabs 5E1 , 5B5, 3G5, 1C12, 2E12, and 4E5, recognized all fragments covering the amino-terminal region of the protein, thus identifying six epitopes within the amino-terminal region (aa 1-79, Table 1). When two types of TUL virus rN proteins were assayed with Mabs that previously had been found cross- reactive with TUL virus (Plyusnin et al., 1994), Mab 2E12 recognized rN Tot (aa 1- 430) but not rN Eco (aa 1-61), indicating that this Mab reacted with a region located between aa 62-79. A similar pattern was found for Mab 3G5, although the reactivity with rN Tot was weak. In addition to bac-PUU-N, Mab 3H9 reacted exclusively with two fragments, rN 2/3 (aa 1-267) and rN 3 (aa 229-327), which correlated well with the previously reported mapping of its epitope (N-a) to aa 251-260 (Lundkvist et al., 1995a).
Pooled polyclonal sera from wild-trapped, PUU virus IgG-positive bank voles, from experimentally PUU virus infected bank voles, and from bank voles immunized with bac-PUU-N were analyzed for IgG reactivity with truncated PUU rN fragments by ELISA (Table 2). The two sera obtained from infected animals were highly reactive with the amino-terminal fragments, in contrast to low or no reactivity with the
fragments covering aa 135-327. Serum from animals immunized with bac-PUU-N reacted equally with all the different fragments except for rN 2b (aa 135-214). To examine the reactivity with the carboxy-terminal of N, sera were absorbed with rN 2/3 and 3 (equivalent to aa 1-327) before testing for reactivity to bac-PUU-N. Although the pooled sera from bac-PUU-N immunized animals showed the highest reactivity, significant reactions were also seen with the serum pools from naturally and experimentally infected bank voles, suggesting the presence of B-cell epitopes between aa 328-433 (Table 2). No reactivity with the fragments rN 2/3 and 3 could be detected after the absorption. PEPSCAN
In total, 141 overlapping 14-mer peptides of PUU virus (strain Sotkamo), covering the whole N in three-aa shifts, were used for epitope mapping using the PEPSCAN method. Several linear B-cell epitopes were identified over the entire N when a pool of polyclonal antisera, drawn from experimentally infected bank voles, were analyzed. Pooled sera from IgG-positive, wild-trapped, bank voles revealed a similar pattern, although the reactivity was mainly directed to the first 50% (aa 1-210) of the protein. No unspecific reactivities were seen when a pool of sera from 5 non-infected colonized bank voles were analyzed. Immunogenicity of rN and synthetic peptides. Sera from bank voles immunized with different rN fragments or bac-PUU-N were analyzed for the presence of antibodies to native PUU virus antigen. Pooled sera from bank voles infected with PUU virus, from non-infected animals, and from animals immunized with GST-c, were used as positive and negative controls, respectively. All rN fragments, as well as bac-PUU-N, evoked high titers of IgG reactive with native PUU N as determined by IFA. The result indicated the presence of several distinct immunogenic regions in the protein. The end-point titers are displayed in Table 3.
All except one of the pooled immune sera were found negative for neutralizing activity when assayed by FRNT (Table 3). Sera from animals immunized with rN 2/3 neutralized PUU virus at the lowest dilution (1 :40). Sera from bank voles experimentally or naturally infected with PUU virus showed neutralizing end-point titers of 1280.
A 30-aa synthetic peptide (P4, aa 241-270), covering the Mab epitope N-a (Lundkvist et al., 1995a), located within a region of N previously defined as a major epitope in the human antibody response to PUU virus infection (Vapalahti et al., 1995a), was used for immunization of bank voles and Balb/C mice. When analyzed by IFA, pooled sera from bank voles and mice immunized with P4-KLH conjugate showed high reactivity with native PUU virus N with end-point titers of 800 and 6400, respectively. Bank voles immunized with P4 alone (i.e.. without KLH-conjugation), raised N-specific IgG as well (titer 400). Protection of bank voles from infection with PUU virus An animal model that mimics the symptoms of PUU virus infection in humans has not been described. PUU virus causes a prolonged or persistent infection in bank voles, with no apparent pathogenicity. However, viral antigen can be detected routinely in selected organs of naturally or experimentally infected animals. To evaluate potential protective immune responses to PUU virus N, we developed a virus challenge model in bank voles, the major natural reservoir of this virus. We found that our stock of PUU virus strain Kazan, passaged exclusively in bank voles, infected all animals, as judged by N antigen detected in lungs, up to a dilution of 1 :106. In contrast, PUU virus strain Sotkamo, isolated and passaged in Vero E6, did not infect all animals reproducibly and viral antigen was found only sporadically. Therefore, for the protection experiments, animals were challenged with PUU virus strain Kazan diluted 1:103, equivalent to 104 ID50.
To evaluate the ability of the recombinant-expressed PUU virus N proteins to elicit a protective response in bank voles, the animals were given three immunizations with each rN protein. Serum antibody titers were measured after the third immunization (Table 3). Three weeks after the challenge with PUU virus, the animals were sacrificed and the lungs examined for the presence of PUU virus N antigen. None of the bank voles immunized with the bac-PUU-N preparation or the rN fragments 1a (aa 1-79), 1b (aa 1-118) and 2/3 (1-267) displayed N antigen in their lungs after challenge (Table 4). One out of three animals immunized with rN 3 (aa 229-327) displayed N antigen. All five control animals immunized with GST-c and all eight non-immunized animals became N antigen positive after challenge.
In order to confirm our initial observation that the absence of N antigen in lungs of bank voles after viral challenge indicated protection, post-challenge sera were analyzed. Since IFA detects antibodies reactive with all the different viral structural proteins, and the pre-challenge immunizations elicited high levels of N-reactive antibodies, we developed an ELISA based on human Mabs for specific detection of bank vole IgG reactive with the PUU virus envelope glycoproteins (G1 and G2). Protected animals should posses antibodies only to the N protein with which they were immunized, whereas animals that did become infected would exhibit demonstrable antibodies also to the viral glycoproteins. The assay was proven to detect only antibodies directed to the two PUU virus envelope glycoproteins when the antigen-specificity was evaluated by PUU virus N-, G1- and G2-specific Mabs. No cross-reaction, due to unspecific binding to the solid-phase of N antigen, was shown with the N-specific Mab, which demonstrated disassociation of the detergent- disrupted and indirectly coated viral components. The detection limit of the assay was estimated to be less than 15 ng/ml of bank vole IgG by end-point titration of pooled G1- and G2-specific Mabs.
Individual post-challenge sera were examined for glycoprotein-specific antibodies by the G1/G2 ELISA. All animals immunized with the amino-terminal fragment rN 1b (aa 1-118), rN 2/3 (aa 1-267), or total bac-PUU-N, and lacking detectable N antigen, were found completely negative for glycoprotein-specific antibodies after challenge (Table 4). In contrast, non-immunized animals or animals immunized with GST-c all showed high titers of glycoprotein-specific antibodies after challenge, as did PUU virus-immune wild-trapped bank voles (Tables 3 and 4). This confirmed that all animals immunized with proteins corresponding to aa 1-118 or larger amino-terminal fragments of PUU N were not infected with PUU virus after challenge. One out of five animals immunized with the short amino-terminal fragment rN 1a (aa 1-79) developed glycoprotein-specific antibodies after challenge. The absence of N antigen in its lungs, however, suggested partial protection. One of the animals immunized with rN 3 (aa 229-327) displayed N antigen in its lungs and developed high levels of glycoprotein-specific antibodies after challenge. The results showed that immunization with fragments rN 1b or rN 3 may protect some animals from infection while not as effectively as immunizations with larger parts of PUU virus N.
Conclusions
The PUU virus nucleocapsid protein was shown to contain several B-cell epitopes recognized by the bank vole, the natural reservoir of this hantavirus. Six of seven previously defined epitopes, recognized by Mabs generated from a virus-infected bank vole, were mapped within the first 20% of the protein (aa 1-79), thereby indicating the amino-terminal region of PUU N as a major antigenic region. The localization of four Mab-epitopes within aa 1-61, and two between aa 62-79, correlated well with our earlier mapping data, based on additivity and competitive ELISAs, together with reactivity patterns with various hantavirus strains, which suggested that several of the epitopes were partially or completely overlapping (Lundkvist et al., 1991; Lundkvist and Niklasson, 1992).
Polyclonal sera from naturally or experimentally infected bank voles revealed the presence of B-cell epitopes over the entire N. Although sera from infected animals were non-reactive with the rN 2 b fragment (aa 135-214), PEPSCAN data indicated the presence of antigenic domains also within this region. The suggestion that the amino-terminal region constitutes the major antigenic target in PUU virus infected bank voles, as indicated by the end-point titers to the different N-fragments, is in concordance with the Mab-epitope mapping. In contrast, immunizations with complete N (bac-PUU-N) gave rise to similar IgG levels to all different fragments, except rN 2b. Although the PEPSCAN data and the IgG end-point titers to the different rN fragments correlated to some extent, discrepancies were found. The latter method detected reactivities primarily to the amino-terminus, while PEPSCAN detected epitopes throughout the protein. This could be due to several reasons; e.g. the low reactivity seen with the middle part of N using rN fragments can be explained either by epitopes hidden in the protein and/or that these linear epitopes, detected by PEPSCAN, are not properly presented in E.co//-expressed rN. We have previously shown that the epitopes N-a and N-e are not recognized in rN expressed as β-gal-N fusion protein in contrast to the baculovirus recombinant where all examined N- epitopes were detected (Vapalahti et al., 1995b). N-a, but not N-e, was properly expressed in the GST fusion-proteins used in this study (data not shown). These results suggested that, although highly immunogenic and antigenic domains are present throughout N, the IgG responses in infected bank voles are mainly directed
to the amino-terminus. Studies on the human IgG response to PUU virus N have shown a similar pattern, i.e. data based on truncated N proteins indicated the amino- terminal part as the major antigenic region although PEPSCAN data revaled the presence of antigenic domains also in other parts of the protein (Lundkvist et al., 1995a; Vapalahti et al., 1992; 1995a; F. Elgh and A. Lundkvist, unpublished). Similarly, it has been shown for Sin Nombre virus that the major domain for the humoral reactivity resides within the amino-terminus of an E.coli expressed N protein (Jenison et al., 1994; Yamada et al., 1995).
Examination by IFA revealed that all the different rN fragments elicited significant levels of IgG levels reactive with native PUU N. The highly immunogenic nature of the amino-terminal part was further confirmed by the relatively high antibody titers to native N evoked in animals immunized with rN 1a (aa 1-79); none of the pooled sera raised to the larger rN fragments or to the entire N (i.e. bac-PUU-N or during viral infection) showed higher titers to native N. The peptide P4, conjugated to KLH, elicited high antibody responses to native N both in bank voles and mice.
Interestingly, bank voles immunized with P4 alone (i.e. without KLH-conjugation), raised N-specific IgG as well, indicating the presence of at least one specific T-cell epitope within aa 241-270.
The absence of known HFRS-like disease in animals made it impossible to evaluate the ability of our recombinant proteins to moderate disease; however, a more stringent assay for measurement of protection from PUU virus infection was developed. As demonstrated by virus challenge experiments, none of the animals immunized with the amino-terminal fragments or with complete recombinant N (bac- PUU-N) displayed N antigen in their lungs even after challenge with 104 ID50of PUU virus. When post-challenge sera were analyzed, only one of the animals (immunized with the shortest amino-terminal fragment), did not appear to be completely protected as judged by the presence of glycoprotein-specific antibodies. This confirmed that all animals immunized with proteins corresponding to aa 1-118, or with larger amino-terminal fragments of PUU N, were completely protected against infection. In line with this, HTN virus recombinant N has previously been shown to protect hamsters or suckling mice from HTN virus infection (Schmaljohn et al., 1990; Yoshimatsu et al., 1993). The results from our animal model also emphasize the
importance of investigating not only the presence of viral antigen, but also the antibody responses.
The envelope glycoproteins are presumed to be the major elements involved in induction of immunity to hantaviruses. This assumption is based on passive protection experiments and by the neutralizing activity detected in vitro for Mabs directed to G1 and G2, but not to N (Schmaljohn et al., 1990; Lundkvist and Niklasson 1992). The significance of the N-specific antibody response in vivo is, however, not yet completely understood. A Mab specific for HTN virus N has been shown to protect from virus infection and N-specific polyclonal sera to significantly increase the time before death in a mouse model (Yoshimatsu et al., 1993). N- specific Mabs have been shown to partially protect bank voles from PUU virus infection (Lundkvist et al., unpublished). Therefore, it is likely that the explanation to the reported absence of neutralizing activity for all hantavirus N-specific Mabs, as determined by NT or FRNT, is due to the use of in vitro systems, which do not necessarily reflect the situation in vivo. Accordingly, the humoral response to N may, in addition to the glycoprotein-specific antibody response, be of importance for the immunity e.g. via antibody dependent cell-mediated cytotoxity and complement- mediated cytolysis.
Previous reports have suggested that a cell-mediated response to HTN virus is involved in protection (Asada et al., 1987, 1988; Yoshimatsu et al., 1993). Since all except one of the pooled pre-chalienge sera in our experiments were found negative for neutralizing antibodies when assayed by FRNT, the protection, evoked by the different regions of PUU virus N, was interpreted as mainly dependent on cell- mediated immune responses. Additional information is required to further define the important aspects of the immunity to PUU virus. Our data suggest, regardless of the mechanism(s), that our recombinant expressed N proteins are clearly capable of inducing a response that can protect animals from infection after challenge with high doses of PUU virus.
In conclusion, our results revealed the location of several B-cell epitopes in PUU virus N and indicated that the amino-terminus is the major antigenic domain in infected bank voles. Our data further demonstrated the feasibility of using expressed or synthetic fragments of PUU virus N to elicit high antibody responses to the native
protein and indicated the importance of N, especially the amino-terminus, in the course of protective immunity. This study may also provide a basis for future experiments concerning recombinant-expressed PUU virus proteins as potential human vaccines.
Table 1. Summary of Mab reactivity in immunoblotting with truncated rN proteins.
Mab
(epitope)
3H9 5E1 5B5 3G5 1C12 2E12 4E5
Antigen (N-a) (N-b) (N-c) (N-d) (N-f) (N-g) (N-h)
PUU virus
rN 1a (1-79) a + + + + + +
rN 1b (1-118) „ + + + + + +
rN 2 3 (1-267) +
rN 3 (229-327) +
bac-PUU-N
(1-433) +
Tula virus
rN Eco (1-61)
rN Tot (1-430) (+)
a + positive reaction; (+) weak reaction; - negative
Table 2. IgG reactivity of bank vole sera to truncated Puumala virus rN proteins.
Serum
Antigen PUU (wild)3 PUU (Kazan)" Bac-PUU-Nc Non-immune
rN 1a (1-79) 51200° 51200 12800 <200
rN 1b (1-118) 12800 12800 3200 <200
rN 2/3 (1-267) 51200 3200 12800 <200
rN 2b (135-214) <200 <200 200 <200
rN 2c (135-327) 200 200 12800 <200
rN 3 (229-327) <200 200 3200 <200
C-terminale 3200 800 12800 <200
bac-PUU-N (1-433) 3200 3200 12800 <200
Pooled sera (n = 5) from PUU virus IgG positive bank voles trapped in northern
Sweden b Pooled sera (n = 5) drawn 3 weeks after experimental infection with PUU virus strain Kazan. c Pooled sera (n = 2) from bank voles immunized with bac-PUU-N. d Reciprocal end-point ELISA titers e Sera were pre-absorbed with rN 2/3 and rN 3 (together equivalent to aa 1 - 327) before titration to bac-PUU-N.
Table 3. Immune responses to Puumala virus in bank voles after immunizations with authentic, expressed or synthetic Puumala virus N.
Reciprocal end -point titers
No. of
Immunogen animals IFA FRNT G1/G2 ELISA rN 1a (1-79) 2 6400 <40 <200
3 3200 <40 <200 rN 1b (1-118) 3 3200 <40 <200 rN 2/3 (1-267) 3 1600 40 <200 rN 3 (229-327) 3 3200 <40 <200 bac-PUU-N (1-433) 2 1600 <40 <200
GST-c 5 <100 <40 <200
PUU virus (wild)3 5 1600 1280 6400
PUU virus (Kazan)b 5 1600 1280 12800
P4 3 400 <40 <200
P4-KLH 3 800 <40 <200
P4-KLH (mice) 3 6400 <40 <200
Non-immune control 2 <100 <40 <200
3 Sera from PUU virus IgG positive wild bank voles trapped in northern Sweden. b Sera drawn 3 weeks after experimental infection with PUU virus strain Kazan.
Table 4. Challenge of bank voles immunized with recombinant Puumala virus N.
Immunogen Antigen in lungs G1/G2 antibody rN 1a (1-79) 0/5a 1/5° (12800)c rN 1b (1-118) 0/3 0/3 rN 2/3 (1-267) 0/3 0/3 rN 3 (229-327) 1/3 1/3 (>25600) bac-PUU-N (1-433) 0/8 0/8
GST-c 5/5 5/5 (12800 - >25600)
Non-immune control 8/8 8/8 (6400 - >25600)
3 Number of N-antigen positive/number of inoculated. b Number of G1/G2-specifιc antibody positive/number c Range of titer for all infected animals in each group.
REFERENCES
Antic, D., Lim, B. -U., Kang, C. Y. (1991). Nudeotide sequence and coding capacity of the large (L) genomic RNA segment of Seoul 80-39 virus, a member of the hantavirus genus. Virus Res. 19, 59-66.
Asada, H., Tamura, M., Kondo, K., Dohi, Y., and Yamanishi, K. (1988). Cell-mediated immunity to virus causing haemorrhagic fever with renal syndrome: generation of cytotoxic T lymphocytes. J. Gen. Virol. 69, 2179-2188.
Asada, H., Balachandra, K., Tamura, M., Kondo, K., and Yamanishi, K. (1989). Cross- reactive immunity among different serotype of virus causing haemorrhagic fever with renal syndrome. J. Gen. Virol. 70, 819-825.
Berzins, K., Periman, H., Wahlin, B., Carlsson, J., Wahlgren, M., Udomsangpetch, R., Bjόrkman, A., Patarroyo, M. E., and Periman, P. (1986). Rabbit and human antibodies to a repeated amino acid sequence of a Plasmodium falciparum antigen, Pf 155, react with the native protein and inhibit merozoite invasion. Proc. Natl. Acad. Sci. USA. 83, 1065-1069.
Brummer-Korvenkontio, M., Vaheri, A., Hovi, T., von Bonsdorff, C-H., Vuorimies, J., Manni, T., Penttinen, K, Oker-Blom, N., and Lahdevirta, J. (1980). Nephropathia epidemica: detection of antigen in bank voles and serologic diagnosis of human infection. J. Infect. Dis. 141, 131-134.
Frangioni, J. and Neel, B. (1993). Solubilisation and purification of enzymatically active glutathione s-transferase (pGEX) fusion proteins. Analytical Biochemistry 210, 179-187.
Gavrilovskaya, I. N., Chumakov, M. P., Apekina, N. S., Rylceva, E. V., Martiyanova, L. I., Gorbachkova, E. A., Bernshtein, A. D., Zakharova, M. A. and Boiko, V. A. (1983). Adaption to laboratory and wild animals of the haemorrhagic fever with renal syndrome virus present in the foci of European U.S.S.R. Arch. Virol. 77, 87-90.
Geysen, H. M., Rodda, S. J., Mason, T. J., Tribbick, G., and Schoffs, P. G. (1987). Strategies for epitope analysis using peptide synthesis. J. Immunol. Methods. 102, 259-274.
Harlow, E. and Lane, D. (1988). Antibodies: A laboratory manual, Cold Spring Harbour Laboratory, Cold Spring Harbour.
Jenison, S., Yamada, T., Morris, C, Andersson, B., Torrez-Martinez, N., Keller, N., and Hjelle, B. (1994). Characterization of human antibody responses to Four Corners Hantavirus infections among patients with Hantavirus pulmonary syndrome. J. Virol. 68, 3000-3006.
Lundkvist, A., Fatouros, A., and Niklasson, B. (1991). Antigenic variation of European haemorrhagic fever with renal syndrome virus strains characterized using bank vole monoclonal antibodies. J. Gen. Virol. 72, 2097-2103.
Lundkvist, A., and Niklasson, B. (1992). Bank vole monoclonal antibodies against Puumala virus envelope glycoproteins; identification of epitopes involved in neutralization. Arch. Virol. 126, 93-105.
Lundkvist, A., Hδrling, J., Athlin, L, Rosen, A., and Niklasson, B. (1993a). Neutralizing human monoclonal antibodies against Puumala virus, causative agent of nephropathia epidemica: A novel method using antigen-coated magnetic beads for specific B-cell isolation. J. Gen. Virol. 74, 1303-1310.
Lundkvist, A., Scholander, C, and Niklasson, B. (1993b). Anti-idiotypic antibodies against Puumala virus glycoprotein-specific monoclonal antibodies inhibit virus infection in cell culture. Arch. Virol. 132, 255-265.
Lundkvist, A., and Niklasson, B. (1994). Hemorrhagic fever with renal syndrome and other hantavirus infections. Rev. Med. Virol. 4, 177-184.
Lundkvist, A., Bjόrsten, S., Niklasson, B., and Ahlborg, N. (1995a). Mapping of B-cell determinants in the nucleocapsid protein of Puumala virus: definition of epitopes specific for acute IgG recognition in humans. Clin. Diag. Lab. Immunol. 2, 82-86.
Lundkvist, A., Hόrling, J., Bjόrsten, S., and Niklasson, B. (1995b). Sensitive detection of hantaviruses by biotin-strepavidin enhanced immunoassays based on bank vole monoclonal antibodies. J. Virol. Methods. 52, 75-86.
Niklasson, B., Jonsson, M., Lundkvist, A., Hόrling, J., and Tkachenko, E. (1991). European isolates of viruses causing hemorrhagic fever with renal syndrome compared by neutralization test. Am. J. Trop. Med. Hyg. 45, 660-665.
Nichol, S. T., Spiropoulou, C. F., Morzunov, S., Rollin, P. E., Ksiazek, T. G., Feldmann, H., Sanchez, A., Childs, J., Zaki, S., and Peters, C. J. (1993). Genetic identification of a hantavirus associated with a outbreak of acute respiratory illness. Science 262, 914- 917.
Plyusnin, A., Vapalahti, O., Lankinen, H., Lehvaslaiho, H., Apekina, N., Myasnikov, Y., Kallio-Kokko, H., Henttonen, H., Lundkvist, A., Brummer-Korvenkontio, M., Gavrilovskaya, l., and Vaheri, A. (1994). Tula virus: a newly detected hantavirus carried by European common voles. J. Virol. 68, 7833-7838.
Schmaljohn, C. S., Hasty, S. E., Dalrymple, J. M., LeDuc J. W., Lee H. W., von Bonsdorff, C.-H., Brummer-Korvenkontio, M., Vaheri, A., Tsai, T. F., Regnery, H. L., Goldgaber, D., and Lee, P. W. (1985). Antigenic and genetic properties of viruses linked to hemorrhagic fever with renal syndrome. Science 227, 1041-1044.
Schmaljohn, C. S., Chu, Y-K., Schmaljohn, A. L., and Dalrymple, J. M. (1990). Antigenic subunits of Hantaan virus expressed by baculovirus and vaccinia virus recombinants. J. Virol. 64, 3162-3170.
Studier, F. W., Rosenberg, A., Dunn, J. J., and Dubendorff, J. W. (1990). Use of T7 RNA polymerase to direct expression of cloned genes. Methods. Enzymol. 185, 60- 89.
Vapalahti, O., Kallio-Kokko, H., Salonen, E.-M., Brummer-Korvenkontio, M., and Vaheri, A. (1992). Cloning and sequencing of Puumala virus Sotkamo strain S and M RNA segments: evidence for strain variation in hantaviruses and expression of the nucleocapsid protein. J. Gen. Virol. 73, 829-838.
Vapalahti, O., Kallio-Kokko, H., Narvanen, A., Julkunen, I., Lundkvist, A., Plyusnin, A., Lehvaslaiho, H., Brummer-Korvenkontio, M., Vaheri, A., and Lankinen, H.
(1995a). Human B-cell epitopes of Puumala virus nucleocapsid protein, the major antigen in early serological response. J. Med. Virol. 46: 293-303.
Vapalahti, O., Lundkvist, A., Kallio-Kokko, H., Paukku, K., Julkunen, I., Lankinen, H., and Vaheri, A. (1995b). Antigenic properties and diagnostic potential of Puumala virus nucleocapsid protein expressed in insect cells. J. Clin. Microbiol. in press
Xiao, S.-Y., LeDuc, J. W., Chu, Y.K., and Schmaljohn, C. S. (1994). Phylogenetic analysis of virus isolates in the genus Hantaviruses, family Bunyaviridae. Virology 198, 295-217.
Yamada, Y., Hjelle, B., Lanzi, R., Morris, C, Andersson, B. and Jenison, S. (1995). Antibody responses to Four Corners hantavirus infections in the Deer mouse (Peromyscus maniculatus): identification of an immunodominant region of the viral nucleocapsid protein. J. Virol. 69, 1939-1943.
Yanagihara, R., and Gajdusek, D. C. (1988). Hemorrhagic fever with renal syndrome: a historical perspective and review of recent advances. In: Gear JHS (ed) Handbook on viral and rickettsial hemorrhagic fevers. CRC Press, Boca Raton, pp 151-188.
Yoshimatsu, K., Yoo, Y.-C, Yoshida, R., Ishihara, C, Azuma, I., and Arikawa, J. (1993). Protective immunity of Hantaan virus nucleocapsid and envelope protein studied using baculovirus-expressed proteins. Arch. Virol. 130, 365-376.
Claims
1. Virus vaccine, which comprises, as an immunizing component, at least one member of the group consisting of a) a recombinant protein having the amino-acid sequence of Fig.1, b) fragments of said protein which comprise B-cell and/or T-cell epitopes, and c) amino-acid sequences which are at least 80% homologous to the sequences of a) or b) and which comprise B-cell and/or T-cell epitopes.
2. Virus vaccine according to claim 1 , wherein said member is coupled to an adjuvant.
3. Virus vaccine according to claim 1 or 2, wherein said member is selected from the members b) which have the amino-acid sequences of Fig.2, Fig.3, Fig.4, Fig.5, and Fig.6.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU17401/97A AU1740197A (en) | 1996-02-06 | 1997-02-06 | Vaccine against hantavirus |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
SE9600436-1 | 1996-02-06 | ||
SE9600436A SE9600436D0 (en) | 1996-02-06 | 1996-02-06 | Vaccine against hantavirus |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1997028819A1 true WO1997028819A1 (en) | 1997-08-14 |
Family
ID=20401291
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/SE1997/000180 WO1997028819A1 (en) | 1996-02-06 | 1997-02-06 | Vaccine against hantavirus |
Country Status (3)
Country | Link |
---|---|
AU (1) | AU1740197A (en) |
SE (1) | SE9600436D0 (en) |
WO (1) | WO1997028819A1 (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002053183A1 (en) * | 2001-01-03 | 2002-07-11 | Eurocine Ab | Hantavirus vaccin with adjuvant |
US11198715B2 (en) | 2016-07-22 | 2021-12-14 | Massachusetts Institute Of Technology | Selective Bfl-1 peptides |
US11286299B2 (en) * | 2018-09-17 | 2022-03-29 | Massachusetts Institute Of Technology | Peptides selective for Bcl-2 family proteins |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995006250A1 (en) * | 1993-08-25 | 1995-03-02 | University Of New Mexico | Molecular clones producing recombinant dna antigens of the hards virus |
-
1996
- 1996-02-06 SE SE9600436A patent/SE9600436D0/en unknown
-
1997
- 1997-02-06 AU AU17401/97A patent/AU1740197A/en not_active Abandoned
- 1997-02-06 WO PCT/SE1997/000180 patent/WO1997028819A1/en active Application Filing
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995006250A1 (en) * | 1993-08-25 | 1995-03-02 | University Of New Mexico | Molecular clones producing recombinant dna antigens of the hards virus |
Non-Patent Citations (3)
Title |
---|
ARCH. VIROL., Volume 130, 1993, K. YOSHIMATSU et al., "Protective Immunity of Hantaan Virus Nucleocapsid and Envelope Protein Studied Using Baculovirus-Expressed Protein", pages 365-376. * |
JOURNAL OF GENERAL VIROLOGY, Volume 73, 1992, OLLI VAPALAHTI et al., "Cloning and Sequencing of Puumala Virus Sotkamo Strain S and M RNA Segments: Evidence For Strain Variation in Hantaviruses and Expression of the Nucleocapsid Protein", pages 829-838. * |
JOURNAL OF MEDICAL VIROLOGY, Volume 46, 1995, OLLI VAPALAHTI et al., "Human B-Cell Epitopes of Puumala Virus Nucleocapsid Protein, the Major Antigen in Early Serological Response", pages 293-303. * |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002053183A1 (en) * | 2001-01-03 | 2002-07-11 | Eurocine Ab | Hantavirus vaccin with adjuvant |
US11198715B2 (en) | 2016-07-22 | 2021-12-14 | Massachusetts Institute Of Technology | Selective Bfl-1 peptides |
US11286299B2 (en) * | 2018-09-17 | 2022-03-29 | Massachusetts Institute Of Technology | Peptides selective for Bcl-2 family proteins |
Also Published As
Publication number | Publication date |
---|---|
SE9600436D0 (en) | 1996-02-06 |
AU1740197A (en) | 1997-08-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Lundkvist et al. | Characterization of Puumala virus nucleocapsid protein: identification of B-cell epitopes and domains involved in protective immunity | |
US6630144B1 (en) | Monoclonal antibodies to Ebola glycoprotein | |
Vapalahti et al. | Human B‐cell epitopes of Puumala virus nucleocapsid protein, the major antigen in early serological response | |
US7335356B2 (en) | Monoclonal antibodies and complementarity-determining regions binding to Ebola glycoprotein | |
ES2453973T3 (en) | Human antibodies against rabies and their uses | |
US6207169B1 (en) | Compounds and methods for the diagnosis and treatment of Ehrlichia infection | |
US5691449A (en) | Respiratory syncytial virus vaccines | |
JPH03502687A (en) | Respiratory syncytial viruses: vaccines and diagnostics | |
AU704688B2 (en) | Synthetic peptides and vaccines comprising same | |
Lundkvist et al. | Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus | |
Staropoli et al. | Affinity-purified dengue-2 virus envelope glycoprotein induces neutralizing antibodies and protective immunity in mice | |
KR100927221B1 (en) | Polypeptide fragment of hepatitis E virus, vaccine composition and diagnostic kit using the same | |
US20020018780A1 (en) | Epitope-based vaccine for respiratory syncytial virus F-protein | |
Lundkvist et al. | Characterization of Tula virus antigenic determinants defined by monoclonal antibodies raised against baculovirus-expressed nucleocapsid protein | |
Daniel et al. | Identification of an immunodominant linear neutralization domain on the S2 portion of the murine coronavirus spike glycoprotein and evidence that it forms part of complex tridimensional structure | |
US6824778B2 (en) | Prophylactic and therapeutic monoclonal antibodies | |
Wills et al. | Antigenic characterization of the live attenuated Japanese encephalitis vaccine virus SA14-14-2: a comparison with isolates of the virus covering a wide geographic area | |
Daniel et al. | Protection from lethal coronavirus infection by affinity-purified spike glycoprotein of murine hepatitis virus, strain A59 | |
Seong et al. | Mapping of antigenic determinant regions of the Bor56 protein of Orientia tsutsugamushi | |
Hörling et al. | Single amino acid substitutions in Puumala virus envelope glycoproteins G1 and G2 eliminate important neutralization epitopes | |
Matheise et al. | Antigenic analysis of the F protein of the bovine respiratory syncytial virus: identification of two distinct antigenic sites involved in fusion inhibition | |
HU219507B (en) | Peptides that elicit neutralizing antibodies against genetically divergent hiv-1 strains | |
WO1997028819A1 (en) | Vaccine against hantavirus | |
US6187310B1 (en) | Recombinant Entamoeba histolytica lectin subunit peptides and reagents specific for members of the 170 kDa subunit multigene family | |
US6783759B2 (en) | Compositions and methods for modulating variola virus |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AL AU BA BB BG BR CA CN CU CZ EE GE HU IL IS JP KP KR LC LK LR LT LV MG MK MN MX NO NZ PL RO SG SI SK TR TT UA US UZ VN AM AZ BY KG KZ MD RU TJ TM |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): KE LS MW SD SZ UG AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
NENP | Non-entry into the national phase |
Ref country code: JP Ref document number: 97528451 Format of ref document f/p: F |
|
122 | Ep: pct application non-entry in european phase |