US8673646B2 - Electrochemical biosensor for direct determination of percentage of glycated hemoglobin - Google Patents

Electrochemical biosensor for direct determination of percentage of glycated hemoglobin Download PDF

Info

Publication number
US8673646B2
US8673646B2 US12/465,143 US46514309A US8673646B2 US 8673646 B2 US8673646 B2 US 8673646B2 US 46514309 A US46514309 A US 46514309A US 8673646 B2 US8673646 B2 US 8673646B2
Authority
US
United States
Prior art keywords
electrode
carbon
working electrode
amino acid
sample
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related, expires
Application number
US12/465,143
Other versions
US20100025264A1 (en
Inventor
Chong-Sheng Yuan
Neal K. Blue
Abhijit Datta
Limin Liu
Lei Fang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Diazyme Laboratories Inc
Original Assignee
General Atomics Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by General Atomics Corp filed Critical General Atomics Corp
Priority to US12/465,143 priority Critical patent/US8673646B2/en
Publication of US20100025264A1 publication Critical patent/US20100025264A1/en
Assigned to GENERAL ATOMICS reassignment GENERAL ATOMICS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: FANG, LEI, DATTA, ABHIJIT, LIU, LIMIN, YUAN, CHONG-SHENG
Assigned to GENERAL ATOMICS reassignment GENERAL ATOMICS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BLUE, NEAL K.
Application granted granted Critical
Publication of US8673646B2 publication Critical patent/US8673646B2/en
Assigned to DIAZYME LABORATORIES, INC. reassignment DIAZYME LABORATORIES, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: GENERAL ATOMICS
Expired - Fee Related legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/72Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving blood pigments, e.g. haemoglobin, bilirubin or other porphyrins; involving occult blood
    • G01N33/721Haemoglobin
    • G01N33/723Glycosylated haemoglobin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/001Enzyme electrodes
    • C12Q1/005Enzyme electrodes involving specific analytes or enzymes
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/543Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
    • G01N33/54366Apparatus specially adapted for solid-phase testing
    • G01N33/54373Apparatus specially adapted for solid-phase testing involving physiochemical end-point determination, e.g. wave-guides, FETS, gratings
    • G01N33/5438Electrodes
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/902Oxidoreductases (1.)
    • G01N2333/906Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.7)

Definitions

  • the present invention relates to electrochemical biosensors for measuring the percentage of glycated hemoglobin (HbA1c) in blood samples without a separate measurement of total hemoglobin.
  • HbA1c biosensors can be used for diabetic monitoring at doctor's offices or homes of patients.
  • a glycated protein is a substance which is produced by the non-enzymatic and irreversible binding of the amino group of an amino acid constituting a protein, with the aldehyde group of a reducing sugar such as aldose. See e.g., U.S. Pat. No. 6,127,138.
  • Such a non-enzymatic and irreversible binding reaction is also called “Amadori rearrangement,” and therefore the above-mentioned glycated protein may also be called “Amadori compound” in some cases.
  • Nonenzymatic glycation of proteins has been implicated in the development of certain diseases, e.g., diabetic complications and the aging process (Takahashi et al., J. Biol. Chem., 272(19):12505-7 (1997); and Baynes and Monnier, Prog. Clin. Biol. Res., 304:1-410 (1989)).
  • This reaction leads to dysfunction of target molecules through formation of sugar adducts and cross-links.
  • Considerable interest has focused on the Amadori product that is the most important “early” modification during nonenzymatic glycation in vitro and in vivo.
  • U.S. Pat. No. 6,127,138 discloses that a sample containing a glycated protein is treated with Protease XIV or a protease from Aspergillus genus, thereafter (or while treating the sample with the above protease) FAOD (fructosyl amino acid oxidase) is caused to react with the sample so as to measure the amount of oxygen consumed by the FAOD reaction or the amount of the resultant reaction product, thereby to measure the glycated protein.
  • FAOD structurallysyl amino acid oxidase
  • U.S. Pat. No. 6,008,006 discloses that the amount of glycated proteins in a sample can be quantified by reacting the sample with first a reagent which is a combination of a protease and a peroxidase and second with a ketoamine oxidase.
  • U.S. Pat. No. 6,008,006 also discloses a kit which contains the combined peroxidase/protease enzyme reagent and also the ketoamine oxidase.
  • U.S. Pub. No. 2005/0014935 discloses methods and kits for measuring amount of glycated protein using a chimeric amadoriase.
  • U.S. Pub. No. 2003/0162242 and EP 1304385 A1 also disclose methods of selectively determining glycated hemoglobin.
  • Electrode sensors for H 2 O 2 detection have been well developed and electrode strips for H 2 O 2 detection have now become commercially available. See, e.g., Luo et al., Biosensors and Bioelectronics 22:482-488, 2006; Wang et al., Chem. Rev. 108:814-825, 2008; U.S. App. Pub. No. 2009/0090623.
  • HbA1c test has become another important test for better monitoring diabetic conditions. Glucose tests report the glucose levels in the blood for the particular moment, whereas HbA1c tests give an average glucose level of the past 3 months. By testing HbA1c levels, physicians can have a better understanding on how their patients' glucose levels were controlled in the past 3 months, which in turn helps doctors to make therapeutic decisions. Recently, there is a growing trend to use HbA1c test as a screen test for identification of diabetic conditions. Therefore, a HbA1c test device that is as simple as a glucose meter and can be used by patients as a self-test device is highly desirable.
  • the invention provides an electrode device for use in an electrochemical sensor for measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising: an electrode support; a working electrode placed on the electrode support, wherein a fructosyl amino acid oxidase is placed (such as deposited) on or near the working electrode; and a counter or a reference electrode placed on the electrode support and spaced from the working electrode.
  • HbA1c glycated hemoglobin
  • the device further comprises a reference or a counter electrode placed on the electrode support and spaced from the other electrodes on the support.
  • the working electrode and/or the counter electrode further comprise a mediator which shuttles electrons between the hydrogen peroxide generated from said fructosyl amino acid oxidase-catalyzed reaction and the working electrode to create a current representative of the amount of the glycated hemoglobin in the sample.
  • the mediator may comprises one or more agents selected from the group consisting of ferrocene, Prussian Blue, metal phthalocyonine, and tetrathiafulvalene (TTF). Other mediators capable of shuttling electrons between the reaction media and the electrode may also be used.
  • the working electrode and/or the counter electrode further comprise a catalyst which catalyzes the redox reaction of hydrogen peroxide.
  • the catalyst comprises one or more platinum group metal such as Ir-carbon, Rh-carbon, and Ru-carbon.
  • Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
  • the device may further comprise a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance and/or a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance which are placed (such as deposited) on or near the working electrode.
  • the first oxidizing agent and/or the second oxidizing agent may be placed on the electrode support.
  • the device may further comprise one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids which are placed (such as deposited) on or near the working electrode.
  • the one or more proteases may be placed on the electrode support.
  • the device may further comprise a detergent that lyses red blood cells in a blood sample and releases hemoglobin, wherein the detergent is placed (such as deposited) on or near the working electrode, or in a sample well separated from the electrodes.
  • the fructosyl amino acid oxidase is formulated in a matrix and is placed on or near the working electrode.
  • one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids are formulated in a matrix and are placed on the top of the matrix containing the fructosyl amino acid oxidase on the working electrode.
  • the matrix comprises an enzyme immobilizing agent (such as a linking agent) and a thickening polymer.
  • the device further comprises an insulation/covering layer defining an enclosed space over the working, counter and/or reference electrodes, wherein said insulation/covering layer forms a well for receiving a sample, wherein the sample well is located on the electrodes or near the electrodes.
  • the device further comprises a sample transfer path between said sample well and said working electrode.
  • the sample well contains a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance and a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance.
  • the sample well further contains one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids.
  • the sample well further contains a detergent that lyses red blood cells in a blood sample and releases hemoglobin.
  • the device comprises a capillary-fill channel for receiving a sample through capillary action, wherein one end of the channel is in contact with the working electrode.
  • the working electrode and/or the counter electrode in the device described herein comprises a metallized carbon selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
  • the reference electrode in the device described comprises Ag/AgCl.
  • the electrodes are screen-printed using thick film technology or using thin film lithography.
  • the invention also provides a method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising a) applying a blood sample to the working electrode of the electrode device described herein, wherein the blood sample has been treated with or is treated in the device with 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between the working electrode and the reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; c) measuring an electrical current between the working electrode and the counter electrode or a charge passed at the
  • the invention also provides a method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising a) applying a blood sample to the sample receiving well of the electrode device described herein, wherein the blood sample has been treated with or is treated in the device with 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between the working electrode and the reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; c) detecting or measuring an electrical current between the working electrode and the counter electrode or a
  • the hydrogen peroxide generated by the fructosyl amino acid oxidase-catalyzed reaction is electrochemically detected directly or indirectly via a mediator or a catalyst.
  • the electrical potential is applied between the working electrode and the reference electrode in a time delayed manner.
  • the electrode device described herein may further comprise a second working electrode and an additional enzyme that reacts with glucose such as glucose oxidase or glucose dehydrogenase to measure both HbA1c and glucose using a single device.
  • glucose such as glucose oxidase or glucose dehydrogenase
  • the invention also provides an electrochemical biosensor comprising the electrode device described herein and an apparatus (such as a reader) for signal detection.
  • the apparatus for signal detection may further comprise a wireless data connection which transfers the test results to a data base or to one or more email addresses.
  • the invention also provides a kit for measuring percentage of glycated hemoglobin (HbA1c) in a sample, said kit comprising an electrode device described herein, and a reader for detecting the electrical current or charge generated from the electrode device.
  • the kit may further comprise a reagent which lyses blood cells to release hemoglobin; a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance; and/or a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids.
  • the kit may further comprise instruction to perform the methods described herein.
  • FIG. 1 shows an electrode device with three electrodes: working electrode, reference electrode, and counter electrode.
  • FIG. 2 shows an electrode device with two electrodes: working electrode and reference electrode.
  • FIG. 3 shows an electrode device with three electrodes (working electrode, reference electrode, and counter electrode), a separate sample receiving well, and a microchannel between the sample receiving well and the working electrode.
  • FIG. 4 shows an electrode device with a capillary-fill microchannel.
  • the microchannel is formed by lamination on top of the electrode support.
  • FIG. 5 shows amperometry of blood samples with known HbA1c percentages.
  • the lysed samples were pipetted onto the biosensor for electrochemical measurement.
  • FIG. 6 shows amperometry of blood samples with known HbA1c percentages.
  • the biosensor was dipped into the lysed blood samples for electrochemical measurement.
  • FIG. 7 shows amperometry of blood samples with known HbA1c percentages.
  • the biosensor has a capillary-fill microchannel created by lamination, and was dipped into the lysed blood samples for a few seconds and then used for electrochemical measurement.
  • the invention provides electrochemical biosensors for measuring the percentage of glycated hemoglobin (HbA1c) in blood samples without a separate measurement of total hemoglobin and methods of using these biosensors.
  • the biosensors are based on the principle of enzymatic generation of H 2 O 2 from glycated hemoglobin molecules and electrochemical detection of H 2 O 2 using an electrochemical biosensor.
  • the biosensors described are designed to measure the percentage of glycated hemoglobin (HbA1c) in blood samples using methods involving the following reactions or process to generate H 2 O 2 : a) lysing red blood cells in a blood sample with a lysing buffer to release hemoglobin; b) oxidizing the lysate with a first oxidizing agent which selectively oxidizes low molecular weight reducing substances; c) oxidizing the lysate with a second oxidizing agent which selectively oxidizes high molecular weight reducing substances; d) contacting the lysate with a protease to form protein fragments and/or amino acids containing glycated peptides and/or glycated amino acids; and e) contacting the protein fragments with a fructosyl amino acid oxidase (such as fructosyl valine oxidase (FVO)) to generate hydrogen peroxide (H 2 O 2 ).
  • the H 2 O 2 generated is measured using a biosensor, and the electrical current or charge measured from the biosensor is used to determine the percentage of total glycated hemoglobin or percentage of glycated hemoglobin A1c in the sample by comparing the measured current or charge to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately.
  • a reference such as a calibration curve
  • HbA1c in the sample can be directly reported by using a H 2 O 2 detection electrode device and a signal detecting meter without the need of a separate measurement of total hemoglobin.
  • a “fructosyl amino acid oxidase” or “FAOD” refers to an enzyme catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H 2 O 2 , as shown in the following reaction: R 1 —CO—CH 2 —NH—R 2 +O 2 +H 2 O ⁇ R 1 —CO—CHO+R 2 —NH 2 +H 2 O 2
  • R 1 represents the aldose residue of a reducing sugar and R 2 represents a residue of an amino acid, protein or peptide.
  • An example of FAOD is fructosyl valine oxidase (FVO).
  • FVO fructosyl valine oxidase
  • Other synonyms of amadoriase includes amadoriase and fructosyl amine:oxygen oxidoreductase (FAOO).
  • FVO fructosyl valine oxidase
  • FVO fructosyl valine oxidase
  • FVO fructosyl valine oxidase
  • FVO fructosyl valine oxidase
  • FOO fructosyl amine:oxygen oxidoreductase
  • the name “fructosyl amino acid oxidase” is used herein, although all such chemical synonyms are contemplated.
  • “Fructosyl amino acid oxidase” also encompasses a functional fragment or a derivative that still substantially retain its enzymatic activity catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H 2 O 2 .
  • a functional fragment or derivative retains at least 50% of its amadoriase activity.
  • a functional fragment or derivative retains at least 60%, 70%, 80%, 90%, 95%, 99% or 100% of its amadoriase activity. It is also intended that a fructosyl amino acid oxidase can include conservative amino acid substitutions that do not substantially alter its activity.
  • Suitable conservative substitutions of amino acids are known to those of skill in this art and may be made generally without altering the biological activity of the resulting molecule.
  • Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson, et al., Molecular Biology of the Gene, 4th Edition, 1987, The Benjamin/Cummings Pub. Co., p. 224).
  • Such exemplary substitutions are preferably made in accordance with those set forth in TABLE 1 as follows:
  • peroxidase refers to an enzyme that catalyses a host of reactions in which hydrogen peroxide is a specific oxidizing agent and a wide range of substrates act as electron donors. It is intended to encompass a peroxidase with conservative amino acid substitutions that do not substantially alter its activity. The chief commercially available peroxidase is horseradish peroxidase.
  • composition refers to any mixture of two or more products or compounds. It may be a solution, a suspension, a liquid, a powder, a paste, aqueous, non-aqueous, or any combination thereof.
  • the invention provides an electrode device for use with an electrochemical detector for measuring the percentage of glycated hemoglobin (HbA1c) in a blood sample without a need of a separate measurement of the total amount of hemoglobin.
  • the electrode device is so designed that it specifically measures the amount of H 2 O 2 generated by a specific enzymatic reaction catalyzed by a fructosyl amino acid oxidase (such as a fructosyl valine oxidase (FVO)).
  • the electrode device comprises an electrode support on which a working and a reference electrode, a working and a counter electrode, or a working, a reference and a counter electrode are placed. The electrodes are spaced from each other on the electrode support.
  • the enzyme FAOD is placed (such as deposited or cast) on or near (including around) the working electrode.
  • the electrodes may be covered by an insulation layer to protect the electric connecting pathway and to define the electrode area or electrode contacts. See FIGS. 1-4 .
  • the electrode device may further comprise a covering layer to form a sample well with a defined space. See FIG. 3 .
  • the sample well can be located around the working electrode or in a separate position which is connected to the working electrode through a sample transfer path (such as a microchannel). See FIG. 3 .
  • the sample well may also be in the form of a capillary-fill channel which allows the sample receiving through capillary action. One end of the capillary-fill channel is in contact with the working electrode.
  • the capillary-fill channel can be created by a layer through lamination. An example of such capillary-fill channel is shown in FIG. 4 . Any other sample well or capillary-fill channel design known in the art may be included in the device. See, e.g., U.S. Pat. No. 6,270,637.
  • An electrochemical biosensor generally includes an electrode device and an apparatus (reader) for signal detection.
  • the apparatus for signal detection may further comprise a wireless data connection which transfers the test results to a data base or to one or more email addresses.
  • the electrodes may be made by any methods known in the art.
  • electrodes may be made by thick-film technology (such as screen-printing and ink-jet printing) or thin film lithography on the electrode support (such as a polyester substrate).
  • the electrical contacts of the electrodes are silver, and electrodes (working, counter and/or reference) are printed on the top of silver electrode bases.
  • the working electrode and/or the counter electrode are screen-printed with metallized carbons such as Ir-Carbon, Rh-Carbon, and Ru-Carbon.
  • Ir-Carbon, Rh-Carbon, and Ru-Carbon are nanoparticles.
  • the reference electrode is screen-printed with Ag/AgCl.
  • a catalyst such as platinum group metal (Rh, Ir, Ru, Os) is included in the working electrode and/or the counter electrode.
  • the catalyst can be deposited by combining into a conductive composition for printing the electrode.
  • the conductive composition includes, but is not limited to, a metallized carbon, a polymer (comprising a binder and a water-strength polymer) and water or an inorganic solvent (such as 0.1 M, pH 7.0 phosphate buffer).
  • the metal in the metallized carbon can be pure metal such as platinum, gold, silver, palladium, ruthenium, rhodium, iridium, oxide or alloys thereof.
  • the metallized carbon includes metal coated on the surface of the carbon particle with nano-sized dimension.
  • the binder includes hydroxyethyl cellulose or hydroxypropyl cellulose.
  • the wet-strength polymer includes polyethylenimine; poly(acrylic acid), potassium salt; poly(acrylic acid), sodium salt; poly(acrylic acid-co-acrylamide), potassium salt; poly(acrylic acid), sodium salt-graft-poly(ethylene oxide); poly(2-hydroxyethyl methacrylate); poly(2-hydroxypropyl methacrylate); poly(isobutylene-co-maleic acid) or combinations thereof.
  • the binder is cross-linked with the wet-strength polymer. Therefore, after forming the electrode on the strip by screen printing, the water or inorganic solvent is evaporated by the following-up steps.
  • a mediator is included in the working electrode and/or counter electrode, and the mediator can be selected from commonly used mediators such as ferrocene, Prussian Blue, and any other known mediators. See, e.g., U.S. Pat. Nos. 6,863,800; and 6,329,161.
  • the electrode device comprises a strip having a substrate as the electrode support; at least two electrodes disposed on the substrate to define a sample area; and a reagent disposed on the sample area, wherein the electrode having metal in the range of 0.1-5% in weight, graphite in the range of below 55% in weight, and polymer.
  • the graphite is fine particle size and the metal is coated on the surface of the graphite particle with nano-sized dimension.
  • the metal may comprise platinum, gold, silver, palladium, ruthenium, rhodium, iridium, oxides or alloys thereof.
  • the polymer may comprise a binder (including hydroxyethyl cellulose or hydroxypropyl cellulose) and a wet-strength polymer (including polyethylenimine; poly(acrylic acid), potassium salt; poly(acrylic acid), sodium salt; poly(acrylic acid-co-acrylamide), potassium salt; poly(acrylic acid), sodium salt-graft-poly(ethylene oxide); poly(2-hydroxyethyl methacrylate); poly(2-hydroxypropyl methacrylate); poly(isobutylene-co-maleic acid) or combinations thereof).
  • the electrode device may further comprise a conductive layer disposed between the electrode and the substrate; and the conductive layer may be screen-printed by graphite dispersed in an organic solvent.
  • the conductive layer and the electrode are formed by screen printing in different steps.
  • the reagent comprises an enzyme (such as a fructosyl amino acid oxidase). Examples of the electrode devices are described in U.S. Patent Application Pub. No. 2009/0090623, which is incorporated by reference in its entirety.
  • the enzyme fructosyl amino acid oxidase (such as FVO) is formulated in a matrix containing enzyme immobilizing agent such as glutaraldehyde and thickening polymer such as 2-hydroxyethyl cellulose, and is deposited or cast near or on the working electrode.
  • the enzyme fructosyl amino acid oxidase (such as FVO) is further included in a separate reagent layer which is placed on the top of the layer of immobilized enzyme on the working electrode.
  • the reactions involved in measuring the percentage of glycated hemoglobin use a lysing buffer which releases hemoglobin from red blood cells in the blood sample, a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance, a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids.
  • a lysing buffer which releases hemoglobin from red blood cells in the blood sample
  • a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance
  • a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance
  • a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids.
  • these reagents may be placed (such as deposited or cast
  • a protease is formulated in a matrix containing enzyme immobilizing agent and thickening polymer, and is deposited or cast near or on the working electrode.
  • the protease(s) is further included in a separate reagent layer which is placed on the top of the layer of immobilized FAOD enzyme near or on the working electrode.
  • the electrode device may further comprise a sample well, a sample transfer path (such as microchannel) from the sample well to the working electrode, or a capillary-fill channel, and one or more of the reagents may be placed (such as deposited or cast) in the sample well, the sample transfer path or the capillary-fill channel.
  • the hemoglobin in the blood sample is digested into glycated peptides or glycated amino acids before reaching the working electrode.
  • one or more of these reagents are placed (such as deposited or cast) on the strip support in the area surrounding the working electrode or in the area between the counter electrode and the working electrode and/or between the reference electrode and the working electrode.
  • these reagents may be mixed with ink based solution and screen-printed on the strip support.
  • the electrode device is configured as a biopotentiostats that contains two working electrodes, one counter electrode and one reference electrode.
  • One working electrode is used for HbA1c test and the other is used for glucose test.
  • the enzyme used for glucose test can be glucose oxidase or glucose dehydrogenase, and the enzyme used for HbA1c test is the fructosyl amino acid oxidase (such as FVO).
  • the electrode device of the invention can be in different electrode structures and can be made using methods known in the art.
  • electrode device may be made with screen-printing methods. See, e.g., U.S. Pat. Nos. 5,682,884; 5,120,420; 5,320,732.
  • Blood samples that can be assayed using the electrode device include whole blood or collected blood cells.
  • the red blood cells in the blood sample are lysed to release hemoglobin.
  • Any lysing buffer e.g., in the acidic or alkaline pH ranges that can lyse the red blood cells and release the hemoglobin can be used.
  • Lysing buffer generally contains a detergent, such as Triton (e.g., Triton X-100), Tween (e.g., Tween 20), sodium dodecyl sulfate (SDS), cetyltrimethylammonium bromide (CTAB), tetradecyltrimethylammonium bromide (TTAB), polyoxyethylene lauryl ethers (POEs), and Nonidet P-40 (NP-40).
  • Triton e.g., Triton X-100
  • Tween e.g., Tween 20
  • sodium dodecyl sulfate SDS
  • CTCAB cetyltrimethylammonium bromide
  • TTAB tetradecyltrimethylammonium bromide
  • POEs polyoxyethylene lauryl ethers
  • NP-40 Nonidet P-40
  • protease can be used. Either an endo-type protease or an exo-type protease can be used.
  • exemplary endo-type proteases include trypsin, ⁇ -chymotrypsin, subtilisin, proteinase K, papain, cathepsin B, pepsin, thermolysin, protease XVII, protease XXI, lysyl-endopeptidase, prolether and bromelain F.
  • exemplary exo-type proteases include an aminopeptidase or a carboxypeptidase.
  • the protease is proteinase K, pronase E, ananine, thermolysin, subtilisin or cow pancreas proteases.
  • Metaloproteases and neutral proteinases from Aspergillus sps, Alicyclobacillus sps, and Bacillus sps may also be used.
  • the protease can be used to generate a glycated peptide of any suitable size.
  • the protease can be used to generate a glycated peptide from about 2 to about 30 amino acid residues.
  • the protease is used to generate glycated glycine, glycated valine or glycated lysine residue or a glycated peptide comprising glycated glycine, glycated valine or glycated lysine residue.
  • Fructosyl amino acid oxidase may be purified or recombinantly produced. Any naturally occurring species may be used.
  • the FAOD used is of Aspergillus sp. origin (See, e.g., Takahashi et al., J. Biol. Chem. 272(6):3437-43, 1997).
  • Other fructosyl amino acid oxidase e.g., disclosed in GenBank Accession No.
  • U82830 (Takahashi et al., J. Biol. Chem., 272(19):12505-12507 (1997) and disclosed U.S. Pat. No. 6,127,138 can also be used.
  • a functional fragment or a derivative of an amadoriase that still substantially retain its enzymatic activity catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H 2 O 2 can also be used.
  • a functional fragment or a derivative of an amadoriase retains at least 50% of its enzymatic activity.
  • a functional fragment or a derivative of an amadoriase retain at least 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% of its enzymatic activity.
  • the fructosyl amino acid oxidase comprises from the N-terminus to C-terminus: a) a first peptidyl fragment comprising a bacterial leader sequence from about 5 to about 30 amino acid residues; and b) a second peptidyl fragment comprising an FVO.
  • the FVO comprises the following amino acid sequence:
  • the chimeric protein may be produced in bacterial cells, such as E. coli .
  • the protein produced may be purified and assayed for the enzymatic activities.
  • Assays for enzymatic activities of FAOD are known in the art (See e.g., Takahashi et al., J. Biol. Chem., 272(6):3437-43 (1997) and U.S. Pat. No. 6,127,138).
  • Four exemplary assays for enzymatic activities of amadoriases are disclosed in Takahashi et al., J. Biol. Chem., 272(6):3437-43 (1997).
  • the first oxidizing agent is a type of oxidizing agent that selectively oxidizes low molecular weight (M.W. ⁇ 3000) reducing substances.
  • the first oxidizing agent has higher oxidizing power toward low molecular weight reducing substances than high molecular weight (M.W.>3000) reducing substances.
  • low molecular weight substances in the blood sample are ascorbic acid and free thio containing molecules.
  • first oxidizing agent are Dess-Martin periodinane and N-ethyl maleimide.
  • Other examples of first oxidizing agents are sodium iodoacetate, sodium periodate, and Chloramine-T.
  • more than one first oxidizing agents are used.
  • the second oxidizing agent is a type of oxidizing agent that selectively oxidizes high molecular weight (M.W.>3000) reducing substances.
  • the second oxidizing agent has higher oxidizing power toward high molecular weight reducing substances than low molecular weight reducing substance.
  • An example of high molecular weight substances in the blood sample is hemoglobin.
  • second oxidizing agent is a tetrazolium salt (e.g., 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt, or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt).
  • second oxidizing agent are sodium dodecyl sulfate, potassium ferricyanide (III), and potassium iodate. In some embodiments, more than one second oxidizing agent is used.
  • a blood sample may be treated with a lysing buffer, a first oxidizing agent, a second oxidizing agent and a protease before applying the sample to the electrode device.
  • the detergent, first oxidizing agent, second oxidizing agent and protease may be formulated in one or more reagents, and may be in liquid or lyophilized powder. These reagents may be included in the kit described herein.
  • the lysing buffer and the first oxidizing agent may be formulated in one reagent.
  • the second oxidizing agent and the protease may be in one or separate reagent.
  • a lysis buffer containing a detergent, Dess-Martin Periodinane and N-ethyl Maleimide may be used to lyse the blood cells.
  • a lysis buffer may contain 25-100 mM CHES pH 9.4, 1-3% Triton X-100, 0.1-5 mM (such as about any of 0.1, 0.5, 1, 2, 3, 4, or 5 mM) Dess-Martin Periodinane, and 0.2-5 mM (such as about any of 0.2, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM) N-ethyl Maleimide.
  • Reagent R1a containing a buffer, CaCl 2 and a protease, and Reagent R1b containing a buffer, sodium chloride and WST3 and a protease may be mixed for use in digesting glycated hemoglobin into glycated peptide or glycated amino acids in the lysed blood sample.
  • Reagent R1a may contain 10-50 mM MES buffer pH 6.5, 5-10 mM CaCl 2 , and 500-1500 U/ml neutral protease (Toyobo Co., Ltd.); and Reagent R1b may contain 10-50 mM MES pH 6.5, 100-200 mM sodium chloride, and 0.2-6 mM (such as about any of 0.2, 0.5, 1, 2, 3, 4, 5, or 6 mM) WST3 (2-(4-Iodopenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium, monosodium salt (manufactured by Dojindo Laboratories)), and 10-200 unit (such as about any of 10, 50, 60, 70, 80, 90, 100, 150, or 200 unit) of protease in 100 uL pH 7.0 5 mM MES buffer solution Examples of reagents are described in Example 1 here
  • kits comprising the electrode device described herein.
  • the kits may further comprise reagents for use of the electrode device if not all reagents needed are placed in the electrode device.
  • the kits may further comprise instructions for using the electrode device and/or reagents.
  • kits comprise a electrode device described herein, a meter or a reader for detecting or measuring an electrical current between the working electrode and counter electrode or a charge passed at the working electrode of the electrode device, and one or more of the reagents selected from the group consisting of 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids.
  • the meter or the reader comprises a lot enabling the electrode device to insert therein.
  • FIG. 1 shows an exemplary electrode device made with screen-printing methods.
  • This biosensor comprises a working electrode, a reference electrode, and a counter electrode. Both working electrode and counter electrode are Ir-Carbon modified or Prussian Blue modified; and the reference electrode is a Ag/AgCl electrode. These electrodes are screen-printed on a polyester substrate.
  • the working electrode and the counter electrode are prepared by screen-printing on the polyester substrate.
  • the electrical contacts of these electrodes are silver, and the electrodes are first printed with a silver ink.
  • Ir-Carbon ink or Prussian Blue ink is further printed on the silver based electrodes.
  • Ir-Carbon ink is prepared by mixing and homogenization (for example, for about 5.0 minutes) of 0.5-2.0 g Ir-Carbon with 5-30 ml of an ink based solution containing 0.5-5 ml polyethylenimine and 0.1-1.0 g 2-hydroxyethyl cellulose.
  • Ir-Carbon ink is prepared by mixing 0.9 g Ir-Carbon with 5 ml of an ink based solution (prepared by mixing 10 ml pH 7.0 phosphate buffer with 1.36 ml polyethylenimine and 0.34 g 2-hydroxyethyl cellulose until a clear homogeneous solution has been obtained).
  • Prussian Blue ink is prepared by mixing and homogenization (for about 5 minutes) of 0.5-2.0 g Prussian Blue particles with 5-30 ml of commercial carbon ink. The Prussian Blue particles were prepared using the following procedure. One gram of graphite powder and 10 ml 0.1 M iron (III) chloride were mixed with stirring for 2 minutes.
  • AgCl/Ag reference electrode is also prepared by screen-printing on the polyester substrate.
  • the electrical contacts of the reference electrode are silver prepared by printing with a silver ink.
  • a AgCl thick film is used and printed over the silver based electrode, serving as the Ag/AgCl reference electrode. See Fang et al., Sensors and Actuators B 129:818-825, 2008.
  • Fructosyl amino acid oxidase (such as FVO) ink is prepared by mixing 1 ml of Ir-Carbon ink with fructosyl amino acid oxidase until a clear solution is obtained.
  • a protease, a lysing buffer, a first oxidizing agent, and/or a second oxidizing agent described herein may also be included in the FAOD ink.
  • the FAOD ink is added onto the Ir-Carbon working electrode and allowed to dry.
  • the Prussian Blue-modified electrochemical sensor structure described above may also be used as the basis for the construction of a fructosyl amino acid oxidase biosensor.
  • Fructosyl amino acid oxidase (such as FVO) is prepared by mixing 1 ml of Prussian Blue ink with fructosyl amino acid oxidase until a clear solution is obtained.
  • a protease, a lysing buffer, a first oxidizing agent, and/or a second oxidizing agent described herein may also be included in the FAOD ink.
  • the FAOD ink is added onto the Ir-Carbon working electrode and allowed to dry.
  • the invention also provides methods of measuring percentage of glycated hemoglobin (HbA1c) in a blood sample using the electrode device described herein. If a lysing buffer containing a detergent, a first oxidizing agent, a second oxidizing agent and a protease are included in the electrode device, a blood sample may be applied directly into the electrode device. If one or more of these reagents are not included in the electrode device, a blood sample may be pretreated before applying into the electrode device. For example, a blood sample may be treated with a buffer containing a detergent, a first and a second oxidizing agent, and one or more protease(s) to lyse the blood cells in a tube.
  • a buffer containing a detergent, a first and a second oxidizing agent, and one or more protease(s) to lyse the blood cells in a tube.
  • the lysate is then applied to the working electrode by pipetting onto the working electrode, by capillary-filling into the working electrode, or by dipping the electrode device into the lysed sample. If the electrode device has a sample receiving space, the lysate is applied to the sample receiving space on the electrode device for further reaction with FAOD to generate H 2 O 2 for amperometric detection.
  • An electrical potential is applied between the working electrode and the counter electrode and/or between the working electrode and the reference electrode.
  • An electrical current is measured between the working electrode and the counter electrode, between the working electrode and the reference electrode, or a charge passed at the working electrode is measured, and the measured current or charge corresponds to the amount of H 2 O 2 generated.
  • the charge passing through the working electrode is measure over a period of time, such as 1-5 minutes.
  • the methods of the invention comprises a) applying a blood sample to the working electrode of the electrode device, wherein the blood sample has been treated with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between said working electrode and said reference electrode (e.g., amperometrially or voltammetrically) suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; and c) detecting an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; and whereby the percentage of glycated hemoglobin, and
  • the methods comprises applying a sample to a sample receiving space (e.g., an aperture, a sample well, a capillary-fill channel) of an electrode device, wherein the electrode device comprises 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; applying an electrical potential between the working electrode and the counter electrode or between the working electrode and the reference electrode (e.g., amperometrially or voltammetrically); and measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; whereby the percentage of glycated hemoglobin (HbA1c) is determined based on the measured
  • the percentage of total glycated hemoglobin or percentage of glycated hemoglobin A1c in a blood sample is determined by comparing the measured electrical current or charge to a reference (such as a calibration curve).
  • the calibration curve is established using calibrator, i.e., samples (including blood samples and artificial calibrators) with known percentage of glycated hemoglobin or known percentage of glycated hemoglobin A1c.
  • the calibration curve is prepared by measuring the electrical current using the biosensor for calibration samples by performing the same steps as the unknown samples without measuring the total hemoglobin separately; and graphing the correlation between the electrical current or charge of the calibration samples and the known percentage of glycated hemoglobin or known percentage of glycated hemoglobin A1c of the calibration samples.
  • whole blood samples having percentages of glycated hemoglobin A1c value assigned by comparison to a suitable higher order reference material can be used as calibrators.
  • the percentage of glycated hemoglobin A1c may be determined by another recognized method such as HPLC.
  • Calibrators are tested the same way as the unknown samples using the methods described herein.
  • the electrical current or charge measured for calibrators are plotted against the expected HbA1c value to establish the calibration curve.
  • the calibration curve information for each lot of device may be electronically stored in the device so that there is no need for users to construct a calibration curve by themselves.
  • Calibrators other than whole blood sample may also be used to establish a calibration curve.
  • Hemolysate samples (lysed blood samples), glycated peptides, glycated amino acid, and glycated amino acid derivatives in a suitable buffered protein matrix solution having percentage of glycated hemoglobin A1c value assigned by comparison to a suitable higher order reference material can be used as artificial calibrators.
  • calibration samples may be prepared in a phosphate buffered solution with 10% BSA and appropriate amounts of synthesized fructosyl propylamine (glycated amino acid) corresponding to various percentage of HbA1c (e.g., from 5% o 12%).
  • Artificial calibrators are tested the same way as unknown samples except that the lysing step may not be used. The electrical current values measured for these calibrators are plotted against the expected HbA1c value to establish the calibration curve. Artificial calibrators may be lyophilized or stabilized for extended shelf life.
  • Blood samples that can be assayed using the present methods and biosensors include whole blood or collected blood cells.
  • the present methods and biosensors may be used for any suitable purpose, such as in the prognosis or diagnosis of a disease or disorder (e.g., diabetes).
  • a biosensor with a working electrode, a reference electrode, and a counter electrode was prepared. Both working electrode and counter electrode are Ir-Carbon modified; and the reference electrode is Ag/AgCl electrode.
  • the working electrode and the counter electrode were prepared by screen-printing on the polyester substrate. The electrical contacts of these electrodes are silver, and the electrodes were first printed with a silver ink. Ir-Carbon ink was further printed on the silver based electrodes. Ir-Carbon ink was prepared by mixing and homogenization of 0.5-2 g Ir-Carbon with 5-30 ml of an ink based solution (containing polyethylenimine and 2-hydroxyethyl cellulose).
  • the working electrode also contains a fructosyl amino acid oxidase.
  • Fructosyl amino acid oxidase (such as FVO having the amino acid sequence shown in SEQ ID NO:1) ink was prepared by mixing 1 ml of Ir-Carbon ink with fructosyl amino acid oxidase until a clear solution was obtained.
  • Ag/AgCl reference electrode was also prepared by screen-printing on the polyester substrate.
  • the electrical contacts of the reference electrode were prepared by printing with a silver ink.
  • a AgCl thick film was used and printed over the silver based electrode, serving as the Ag/AgCl reference electrode.
  • 100 ul blood sample was lysed in 900 ul of lysis buffer containing 50 mM CHES pH 9.4, 2% Triton X-100, 0.1-5 mM (such as 0.1, 0.5, 1, 2, 3, 4, or 5 mM) Dess-Martin Periodinane, and 0.2-5 mM (such as 0.2, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM) N-ethyl Maleimide.
  • 0.1-5 mM such as 0.1, 0.5, 1, 2, 3, 4, or 5 mM
  • Dess-Martin Periodinane Dess-Martin Periodinane
  • 0.2-5 mM such as 0.2, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM
  • the lysate was mixed with lyophilized powder from 5 ml reagent R1a (25 mM MES buffer pH 6.5, 5 mM CaCl 2 , and 1000 U/ml neutral protease (Toyobo Co., Ltd.)), lyophilized powder from 2.5 mL reagent R1b (25 mM MES pH 6.5, 150 mM sodium chloride, and 0.2-6 mM (such as 0.2, 0.5, 1, 2, 3, 4, 5, or 6 mM) WST3 (2-(4-Iodopenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium, monosodium salt (manufactured by Dojindo Laboratories)), and 10-200 unit (such as 10, 50, 60, 70, 80, 90, 100, 150, or 200 unit) of protease in 100 uL pH 7.0 5 mM MES buffer solution.
  • the biosensor described in Example 1 was laminated manually to form a capillary-fill device. See FIG. 4 .
  • the biosensor was dipped into the incubated solution described in Example 1 for a few seconds to fill the microchannel with the blood lysate through capillary action.
  • the biosensor is then used for electrochemical measurement.
  • the electrochemical measurement was carried out at +0.25V vs. the Ag/AgCl reference for 120 seconds.
  • the current measured for each sample is shown in FIG. 7 .
  • Data in FIG. 7 demonstrate that the current measured from the biosensor fits into a linear model with the HbA1c percentage in the blood sample, and the biosensor and the methods can be used for determination of percentage of glycated hemoglobin without a separate measurement of total hemoglobin.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Organic Chemistry (AREA)
  • Microbiology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The invention provides electrochemical biosensors for direct determination of percentage of glycated hemoglobin in blood samples without the need of a separated measurement of total hemoglobin content in blood samples. The invention provides methods for using the electrochemical biosensors.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the priority benefit of provisional patent application U.S. Ser. No. 61/052,888, filed May 13, 2008, which is incorporated herein in its entirety by reference.
FIELD OF THE INVENTION
The present invention relates to electrochemical biosensors for measuring the percentage of glycated hemoglobin (HbA1c) in blood samples without a separate measurement of total hemoglobin. HbA1c biosensors can be used for diabetic monitoring at doctor's offices or homes of patients.
BACKGROUND OF THE INVENTION
A glycated protein is a substance which is produced by the non-enzymatic and irreversible binding of the amino group of an amino acid constituting a protein, with the aldehyde group of a reducing sugar such as aldose. See e.g., U.S. Pat. No. 6,127,138. Such a non-enzymatic and irreversible binding reaction is also called “Amadori rearrangement,” and therefore the above-mentioned glycated protein may also be called “Amadori compound” in some cases.
Nonenzymatic glycation of proteins has been implicated in the development of certain diseases, e.g., diabetic complications and the aging process (Takahashi et al., J. Biol. Chem., 272(19):12505-7 (1997); and Baynes and Monnier, Prog. Clin. Biol. Res., 304:1-410 (1989)). This reaction leads to dysfunction of target molecules through formation of sugar adducts and cross-links. Considerable interest has focused on the Amadori product that is the most important “early” modification during nonenzymatic glycation in vitro and in vivo.
Various assays for glycated proteins are known. For example, U.S. Pat. No. 6,127,138 discloses that a sample containing a glycated protein is treated with Protease XIV or a protease from Aspergillus genus, thereafter (or while treating the sample with the above protease) FAOD (fructosyl amino acid oxidase) is caused to react with the sample so as to measure the amount of oxygen consumed by the FAOD reaction or the amount of the resultant reaction product, thereby to measure the glycated protein.
In another example, U.S. Pat. No. 6,008,006 discloses that the amount of glycated proteins in a sample can be quantified by reacting the sample with first a reagent which is a combination of a protease and a peroxidase and second with a ketoamine oxidase. U.S. Pat. No. 6,008,006 also discloses a kit which contains the combined peroxidase/protease enzyme reagent and also the ketoamine oxidase. U.S. Pub. No. 2005/0014935 discloses methods and kits for measuring amount of glycated protein using a chimeric amadoriase. U.S. Pub. No. 2003/0162242 and EP 1304385 A1 also disclose methods of selectively determining glycated hemoglobin.
Methods for determining percentage of glycated hemoglobin A1c that require a separate measurement of total hemoglobin in the samples have been described. When a chemistry analyzer is used to determine the value of percentage of glycated hemoglobin A1c, a dual channel format is required. In this format, two separate assays are performed to determine 1) glycated hemoglobin A1c concentration, and 2) total hemoglobin concentration in the samples; and followed by calculating the ratio of glycated HbA1c to total hemoglobin to obtain percentage of HbA1c. Methods of directly assaying percentage of glycated hemoglobin without a separate measurement of total hemoglobin are described in WO 2008/013874.
Various electrochemical biosensors are known to use specific enzyme reactions to determine the amount of an analyte that serves as the enzyme substrate through electrochemical detection methods. The most utilized biosensor is the biosensor for glucose test that utilizes glucose oxidase to react with glucose in the blood and to generate H2O2 for detection electrochemically using designed electrodes including working, counter and reference with or without a mediator or catalyst. Electrode sensors for H2O2 detection have been well developed and electrode strips for H2O2 detection have now become commercially available. See, e.g., Luo et al., Biosensors and Bioelectronics 22:482-488, 2006; Wang et al., Chem. Rev. 108:814-825, 2008; U.S. App. Pub. No. 2009/0090623.
Besides the glucose test, an HbA1c test has become another important test for better monitoring diabetic conditions. Glucose tests report the glucose levels in the blood for the particular moment, whereas HbA1c tests give an average glucose level of the past 3 months. By testing HbA1c levels, physicians can have a better understanding on how their patients' glucose levels were controlled in the past 3 months, which in turn helps doctors to make therapeutic decisions. Recently, there is a growing trend to use HbA1c test as a screen test for identification of diabetic conditions. Therefore, a HbA1c test device that is as simple as a glucose meter and can be used by patients as a self-test device is highly desirable.
SUMMARY OF THE INVENTION
The invention provides an electrode device for use in an electrochemical sensor for measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising: an electrode support; a working electrode placed on the electrode support, wherein a fructosyl amino acid oxidase is placed (such as deposited) on or near the working electrode; and a counter or a reference electrode placed on the electrode support and spaced from the working electrode.
In some embodiments, the device further comprises a reference or a counter electrode placed on the electrode support and spaced from the other electrodes on the support.
In some embodiments, the working electrode and/or the counter electrode further comprise a mediator which shuttles electrons between the hydrogen peroxide generated from said fructosyl amino acid oxidase-catalyzed reaction and the working electrode to create a current representative of the amount of the glycated hemoglobin in the sample. The mediator may comprises one or more agents selected from the group consisting of ferrocene, Prussian Blue, metal phthalocyonine, and tetrathiafulvalene (TTF). Other mediators capable of shuttling electrons between the reaction media and the electrode may also be used.
In some embodiments, the working electrode and/or the counter electrode further comprise a catalyst which catalyzes the redox reaction of hydrogen peroxide. The catalyst comprises one or more platinum group metal such as Ir-carbon, Rh-carbon, and Ru-carbon. In some embodiments, Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
In some embodiments, the device may further comprise a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance and/or a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance which are placed (such as deposited) on or near the working electrode. For example, the first oxidizing agent and/or the second oxidizing agent may be placed on the electrode support. In some embodiments, the device may further comprise one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids which are placed (such as deposited) on or near the working electrode. For example, the one or more proteases may be placed on the electrode support. In some embodiments, the device may further comprise a detergent that lyses red blood cells in a blood sample and releases hemoglobin, wherein the detergent is placed (such as deposited) on or near the working electrode, or in a sample well separated from the electrodes.
In some embodiments, the fructosyl amino acid oxidase is formulated in a matrix and is placed on or near the working electrode. In some embodiments, one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids are formulated in a matrix and are placed on the top of the matrix containing the fructosyl amino acid oxidase on the working electrode. In some embodiments, the matrix comprises an enzyme immobilizing agent (such as a linking agent) and a thickening polymer.
In some embodiments, the device further comprises an insulation/covering layer defining an enclosed space over the working, counter and/or reference electrodes, wherein said insulation/covering layer forms a well for receiving a sample, wherein the sample well is located on the electrodes or near the electrodes. In some embodiments, the device further comprises a sample transfer path between said sample well and said working electrode. In some embodiments, the sample well contains a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance and a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance. In some embodiments, the sample well further contains one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids. In some embodiments, the sample well further contains a detergent that lyses red blood cells in a blood sample and releases hemoglobin. In some embodiments, the device comprises a capillary-fill channel for receiving a sample through capillary action, wherein one end of the channel is in contact with the working electrode.
In some embodiments, the working electrode and/or the counter electrode in the device described herein comprises a metallized carbon selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon. In some embodiments, the reference electrode in the device described comprises Ag/AgCl.
In some embodiments, the electrodes are screen-printed using thick film technology or using thin film lithography.
The invention also provides a method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising a) applying a blood sample to the working electrode of the electrode device described herein, wherein the blood sample has been treated with or is treated in the device with 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between the working electrode and the reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; c) measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; and whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately. The blood sample may be applied to the working electrode by pipetting the sample onto the working electrode, by dipping the electrode device into the sample, or by capillary action through a capillary-fill channel.
The invention also provides a method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising a) applying a blood sample to the sample receiving well of the electrode device described herein, wherein the blood sample has been treated with or is treated in the device with 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between the working electrode and the reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; c) detecting or measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; and whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately. In some embodiments, the blood sample is lysed in a lysing buffer in a separate tube or vial, and the blood lysate is then applied into the sample receiving well.
In any of the methods described herein, the hydrogen peroxide generated by the fructosyl amino acid oxidase-catalyzed reaction is electrochemically detected directly or indirectly via a mediator or a catalyst. In any of the methods described herein, the electrical potential is applied between the working electrode and the reference electrode in a time delayed manner.
In some embodiments, the electrode device described herein may further comprise a second working electrode and an additional enzyme that reacts with glucose such as glucose oxidase or glucose dehydrogenase to measure both HbA1c and glucose using a single device.
The invention also provides an electrochemical biosensor comprising the electrode device described herein and an apparatus (such as a reader) for signal detection. In some embodiments, the apparatus for signal detection may further comprise a wireless data connection which transfers the test results to a data base or to one or more email addresses.
The invention also provides a kit for measuring percentage of glycated hemoglobin (HbA1c) in a sample, said kit comprising an electrode device described herein, and a reader for detecting the electrical current or charge generated from the electrode device. The kit may further comprise a reagent which lyses blood cells to release hemoglobin; a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance; and/or a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids. The kit may further comprise instruction to perform the methods described herein.
It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art.
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
FIG. 1 shows an electrode device with three electrodes: working electrode, reference electrode, and counter electrode.
FIG. 2 shows an electrode device with two electrodes: working electrode and reference electrode.
FIG. 3 shows an electrode device with three electrodes (working electrode, reference electrode, and counter electrode), a separate sample receiving well, and a microchannel between the sample receiving well and the working electrode.
FIG. 4 shows an electrode device with a capillary-fill microchannel. The microchannel is formed by lamination on top of the electrode support.
FIG. 5 shows amperometry of blood samples with known HbA1c percentages. The lysed samples were pipetted onto the biosensor for electrochemical measurement.
FIG. 6 shows amperometry of blood samples with known HbA1c percentages. The biosensor was dipped into the lysed blood samples for electrochemical measurement.
FIG. 7 shows amperometry of blood samples with known HbA1c percentages. The biosensor has a capillary-fill microchannel created by lamination, and was dipped into the lysed blood samples for a few seconds and then used for electrochemical measurement.
DETAILED DESCRIPTION OF THE INVENTION
The invention provides electrochemical biosensors for measuring the percentage of glycated hemoglobin (HbA1c) in blood samples without a separate measurement of total hemoglobin and methods of using these biosensors. The biosensors are based on the principle of enzymatic generation of H2O2 from glycated hemoglobin molecules and electrochemical detection of H2O2 using an electrochemical biosensor.
The biosensors described are designed to measure the percentage of glycated hemoglobin (HbA1c) in blood samples using methods involving the following reactions or process to generate H2O2: a) lysing red blood cells in a blood sample with a lysing buffer to release hemoglobin; b) oxidizing the lysate with a first oxidizing agent which selectively oxidizes low molecular weight reducing substances; c) oxidizing the lysate with a second oxidizing agent which selectively oxidizes high molecular weight reducing substances; d) contacting the lysate with a protease to form protein fragments and/or amino acids containing glycated peptides and/or glycated amino acids; and e) contacting the protein fragments with a fructosyl amino acid oxidase (such as fructosyl valine oxidase (FVO)) to generate hydrogen peroxide (H2O2). The H2O2 generated is measured using a biosensor, and the electrical current or charge measured from the biosensor is used to determine the percentage of total glycated hemoglobin or percentage of glycated hemoglobin A1c in the sample by comparing the measured current or charge to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately. By using a reference (such as a calibration curve), HbA1c in the sample can be directly reported by using a H2O2 detection electrode device and a signal detecting meter without the need of a separate measurement of total hemoglobin.
A. Definitions
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this invention belongs. All patents, applications, published applications and other publications referred to herein are incorporated by reference in their entirety. If a definition set forth in this section is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein incorporated by reference, the definition set forth in this section prevails over the definition that is incorporated herein by reference.
As used herein, “a” or “an” means “at least one” or “one or more.”
As used herein, a “fructosyl amino acid oxidase” or “FAOD” refers to an enzyme catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H2O2, as shown in the following reaction:
R1—CO—CH2—NH—R2+O2+H2O→R1—CO—CHO+R2—NH2+H2O2
wherein R1 represents the aldose residue of a reducing sugar and R2 represents a residue of an amino acid, protein or peptide. An example of FAOD is fructosyl valine oxidase (FVO). Other synonyms of amadoriase includes amadoriase and fructosyl amine:oxygen oxidoreductase (FAOO). For purposes herein, the name “fructosyl amino acid oxidase” is used herein, although all such chemical synonyms are contemplated. “Fructosyl amino acid oxidase” also encompasses a functional fragment or a derivative that still substantially retain its enzymatic activity catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H2O2. Typically, a functional fragment or derivative retains at least 50% of its amadoriase activity. Preferably, a functional fragment or derivative retains at least 60%, 70%, 80%, 90%, 95%, 99% or 100% of its amadoriase activity. It is also intended that a fructosyl amino acid oxidase can include conservative amino acid substitutions that do not substantially alter its activity. Suitable conservative substitutions of amino acids are known to those of skill in this art and may be made generally without altering the biological activity of the resulting molecule. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson, et al., Molecular Biology of the Gene, 4th Edition, 1987, The Benjamin/Cummings Pub. Co., p. 224). Such exemplary substitutions are preferably made in accordance with those set forth in TABLE 1 as follows:
TABLE 1
Original residue Conservative substitution
Ala (A) Gly; Ser
Arg (R) Lys
Asn (N) Gln; His
Cys (C) Ser
Gln (Q) Asn
Glu (E) Asp
Gly (G) Ala; Pro
His (H) Asn; Gln
Ile (I) Leu; Val
Leu (L) Ile; Val
Lys (K) Arg; Gln; Glu
Met (M) Leu; Tyr; Ile
Phe (F) Met; Leu; Tyr
Ser (S) Thr
Thr (T) Ser
Trp (W) Tyr
Tyr (Y) Trp; Phe
Val (V) Ile; Leu
Other substitutions are also permissible and may be determined empirically or in accord with known conservative substitutions.
As used herein, “peroxidase” refers to an enzyme that catalyses a host of reactions in which hydrogen peroxide is a specific oxidizing agent and a wide range of substrates act as electron donors. It is intended to encompass a peroxidase with conservative amino acid substitutions that do not substantially alter its activity. The chief commercially available peroxidase is horseradish peroxidase.
As used herein, a “composition” refers to any mixture of two or more products or compounds. It may be a solution, a suspension, a liquid, a powder, a paste, aqueous, non-aqueous, or any combination thereof.
B. Electrochemical Biosensors for Directly Assaying Percentage of Glycated Hemoglobin
In one aspect, the invention provides an electrode device for use with an electrochemical detector for measuring the percentage of glycated hemoglobin (HbA1c) in a blood sample without a need of a separate measurement of the total amount of hemoglobin. The electrode device is so designed that it specifically measures the amount of H2O2 generated by a specific enzymatic reaction catalyzed by a fructosyl amino acid oxidase (such as a fructosyl valine oxidase (FVO)). The electrode device comprises an electrode support on which a working and a reference electrode, a working and a counter electrode, or a working, a reference and a counter electrode are placed. The electrodes are spaced from each other on the electrode support. The enzyme FAOD is placed (such as deposited or cast) on or near (including around) the working electrode. The electrodes may be covered by an insulation layer to protect the electric connecting pathway and to define the electrode area or electrode contacts. See FIGS. 1-4. The electrode device may further comprise a covering layer to form a sample well with a defined space. See FIG. 3. The sample well can be located around the working electrode or in a separate position which is connected to the working electrode through a sample transfer path (such as a microchannel). See FIG. 3. The sample well may also be in the form of a capillary-fill channel which allows the sample receiving through capillary action. One end of the capillary-fill channel is in contact with the working electrode. The capillary-fill channel can be created by a layer through lamination. An example of such capillary-fill channel is shown in FIG. 4. Any other sample well or capillary-fill channel design known in the art may be included in the device. See, e.g., U.S. Pat. No. 6,270,637.
An electrochemical biosensor generally includes an electrode device and an apparatus (reader) for signal detection. The apparatus for signal detection may further comprise a wireless data connection which transfers the test results to a data base or to one or more email addresses.
The electrodes may be made by any methods known in the art. For example, electrodes may be made by thick-film technology (such as screen-printing and ink-jet printing) or thin film lithography on the electrode support (such as a polyester substrate). In some embodiments, the electrical contacts of the electrodes are silver, and electrodes (working, counter and/or reference) are printed on the top of silver electrode bases. In some embodiments, the working electrode and/or the counter electrode are screen-printed with metallized carbons such as Ir-Carbon, Rh-Carbon, and Ru-Carbon. In some embodiments, Ir-Carbon, Rh-Carbon, and Ru-Carbon are nanoparticles. In some embodiments, the reference electrode is screen-printed with Ag/AgCl.
In some embodiments, a catalyst such as platinum group metal (Rh, Ir, Ru, Os) is included in the working electrode and/or the counter electrode. For example, the catalyst can be deposited by combining into a conductive composition for printing the electrode. The conductive composition includes, but is not limited to, a metallized carbon, a polymer (comprising a binder and a water-strength polymer) and water or an inorganic solvent (such as 0.1 M, pH 7.0 phosphate buffer). The metal in the metallized carbon can be pure metal such as platinum, gold, silver, palladium, ruthenium, rhodium, iridium, oxide or alloys thereof. For example, the metallized carbon includes metal coated on the surface of the carbon particle with nano-sized dimension. The binder includes hydroxyethyl cellulose or hydroxypropyl cellulose. The wet-strength polymer includes polyethylenimine; poly(acrylic acid), potassium salt; poly(acrylic acid), sodium salt; poly(acrylic acid-co-acrylamide), potassium salt; poly(acrylic acid), sodium salt-graft-poly(ethylene oxide); poly(2-hydroxyethyl methacrylate); poly(2-hydroxypropyl methacrylate); poly(isobutylene-co-maleic acid) or combinations thereof. Generally, the binder is cross-linked with the wet-strength polymer. Therefore, after forming the electrode on the strip by screen printing, the water or inorganic solvent is evaporated by the following-up steps.
In some embodiments, a mediator is included in the working electrode and/or counter electrode, and the mediator can be selected from commonly used mediators such as ferrocene, Prussian Blue, and any other known mediators. See, e.g., U.S. Pat. Nos. 6,863,800; and 6,329,161.
In some embodiments, the electrode device comprises a strip having a substrate as the electrode support; at least two electrodes disposed on the substrate to define a sample area; and a reagent disposed on the sample area, wherein the electrode having metal in the range of 0.1-5% in weight, graphite in the range of below 55% in weight, and polymer. In some embodiments, the graphite is fine particle size and the metal is coated on the surface of the graphite particle with nano-sized dimension. The metal may comprise platinum, gold, silver, palladium, ruthenium, rhodium, iridium, oxides or alloys thereof. The polymer may comprise a binder (including hydroxyethyl cellulose or hydroxypropyl cellulose) and a wet-strength polymer (including polyethylenimine; poly(acrylic acid), potassium salt; poly(acrylic acid), sodium salt; poly(acrylic acid-co-acrylamide), potassium salt; poly(acrylic acid), sodium salt-graft-poly(ethylene oxide); poly(2-hydroxyethyl methacrylate); poly(2-hydroxypropyl methacrylate); poly(isobutylene-co-maleic acid) or combinations thereof). The electrode device may further comprise a conductive layer disposed between the electrode and the substrate; and the conductive layer may be screen-printed by graphite dispersed in an organic solvent. In some embodiments, the conductive layer and the electrode are formed by screen printing in different steps. In some embodiments, the reagent comprises an enzyme (such as a fructosyl amino acid oxidase). Examples of the electrode devices are described in U.S. Patent Application Pub. No. 2009/0090623, which is incorporated by reference in its entirety.
In some embodiments, the enzyme fructosyl amino acid oxidase (such as FVO) is formulated in a matrix containing enzyme immobilizing agent such as glutaraldehyde and thickening polymer such as 2-hydroxyethyl cellulose, and is deposited or cast near or on the working electrode. In some embodiments, the enzyme fructosyl amino acid oxidase (such as FVO) is further included in a separate reagent layer which is placed on the top of the layer of immobilized enzyme on the working electrode.
The reactions involved in measuring the percentage of glycated hemoglobin (HbA1c) use a lysing buffer which releases hemoglobin from red blood cells in the blood sample, a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance, a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids. One or more of these reagents may be placed (such as deposited or cast) near or on the working electrode. In some embodiments, a protease is formulated in a matrix containing enzyme immobilizing agent and thickening polymer, and is deposited or cast near or on the working electrode. In some embodiments, the protease(s) is further included in a separate reagent layer which is placed on the top of the layer of immobilized FAOD enzyme near or on the working electrode. In some embodiments, the electrode device may further comprise a sample well, a sample transfer path (such as microchannel) from the sample well to the working electrode, or a capillary-fill channel, and one or more of the reagents may be placed (such as deposited or cast) in the sample well, the sample transfer path or the capillary-fill channel. For example, the hemoglobin in the blood sample is digested into glycated peptides or glycated amino acids before reaching the working electrode. In some embodiments, one or more of these reagents are placed (such as deposited or cast) on the strip support in the area surrounding the working electrode or in the area between the counter electrode and the working electrode and/or between the reference electrode and the working electrode. For example, these reagents may be mixed with ink based solution and screen-printed on the strip support.
In a further embodiment, the electrode device is configured as a biopotentiostats that contains two working electrodes, one counter electrode and one reference electrode. One working electrode is used for HbA1c test and the other is used for glucose test. The enzyme used for glucose test can be glucose oxidase or glucose dehydrogenase, and the enzyme used for HbA1c test is the fructosyl amino acid oxidase (such as FVO).
The electrode device of the invention can be in different electrode structures and can be made using methods known in the art. For example, electrode device may be made with screen-printing methods. See, e.g., U.S. Pat. Nos. 5,682,884; 5,120,420; 5,320,732.
Blood samples that can be assayed using the electrode device include whole blood or collected blood cells. The red blood cells in the blood sample are lysed to release hemoglobin. Any lysing buffer (e.g., in the acidic or alkaline pH ranges) that can lyse the red blood cells and release the hemoglobin can be used. Lysing buffer generally contains a detergent, such as Triton (e.g., Triton X-100), Tween (e.g., Tween 20), sodium dodecyl sulfate (SDS), cetyltrimethylammonium bromide (CTAB), tetradecyltrimethylammonium bromide (TTAB), polyoxyethylene lauryl ethers (POEs), and Nonidet P-40 (NP-40).
Any suitable protease can be used. Either an endo-type protease or an exo-type protease can be used. Exemplary endo-type proteases include trypsin, α-chymotrypsin, subtilisin, proteinase K, papain, cathepsin B, pepsin, thermolysin, protease XVII, protease XXI, lysyl-endopeptidase, prolether and bromelain F. Exemplary exo-type proteases include an aminopeptidase or a carboxypeptidase. In one example, the protease is proteinase K, pronase E, ananine, thermolysin, subtilisin or cow pancreas proteases. Metaloproteases and neutral proteinases from Aspergillus sps, Alicyclobacillus sps, and Bacillus sps may also be used.
The protease can be used to generate a glycated peptide of any suitable size. For example, the protease can be used to generate a glycated peptide from about 2 to about 30 amino acid residues. In another example, the protease is used to generate glycated glycine, glycated valine or glycated lysine residue or a glycated peptide comprising glycated glycine, glycated valine or glycated lysine residue.
Glycated peptide and/or glycated amino acid are contacted with a fructosyl amino acid oxidase. Any fructosyl amino acid oxidase (FAOD) can be used. Fructosyl amino acid oxidase may be purified or recombinantly produced. Any naturally occurring species may be used. In one example, the FAOD used is of Aspergillus sp. origin (See, e.g., Takahashi et al., J. Biol. Chem. 272(6):3437-43, 1997). Other fructosyl amino acid oxidase, e.g., disclosed in GenBank Accession No. U82830 (Takahashi et al., J. Biol. Chem., 272(19):12505-12507 (1997) and disclosed U.S. Pat. No. 6,127,138 can also be used. A functional fragment or a derivative of an amadoriase that still substantially retain its enzymatic activity catalyzing the oxidative deglycation of Amadori products to yield corresponding amino acids, glucosone, and H2O2 can also be used.
Normally, a functional fragment or a derivative of an amadoriase retains at least 50% of its enzymatic activity. Preferably, a functional fragment or a derivative of an amadoriase retain at least 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% of its enzymatic activity.
Any of the chimeric proteins having the enzymatic activities of FVO described in the U.S. Pub. No. 2005/0014935 can be used. In some embodiments, the fructosyl amino acid oxidase comprises from the N-terminus to C-terminus: a) a first peptidyl fragment comprising a bacterial leader sequence from about 5 to about 30 amino acid residues; and b) a second peptidyl fragment comprising an FVO. In some embodiments, the FVO comprises the following amino acid sequence:
(SEQ ID NO: 1)
MGGSGDDDDLALAVTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPY
PVPSAISAGNDVNKVISSGQYSNNKDEIEVNEILAEEAFNGWKNDPLFKP
YYHDTGLLMSACSQEGLDRLGVRVRPGEDPNLVELTRPEQFRKLAPEGVL
QGDFPGWKGYFARSGAGWAHARNALVAAAREAQRMGVKFVTGTPQGRVVT
LIFENNDVKGAVTGDGKIWRAERTFLCAGASAGQFLDFKNQLRPTAWTLV
HIALKPEERALYKNIPVIFNIERGFFFEPDEERGEIKICDEHPGYTNMVQ
SADGTMMSIPFEKTQIPKEAETRVRALLKETMPQLADRPFSFARICWCAD
TANREFLIDRHPQYHSLVLGCGASGRGFKYLPSIGNLIVDAMEGKVPQKI
HELIKWNPDIAANRNWRDTLGRFGGPNRVMDFHDVKEWTNVQYRDISKLK
GELEGLPIPNPLLRTGHHHHHH.
The chimeric protein may be produced in bacterial cells, such as E. coli. The protein produced may be purified and assayed for the enzymatic activities. Assays for enzymatic activities of FAOD are known in the art (See e.g., Takahashi et al., J. Biol. Chem., 272(6):3437-43 (1997) and U.S. Pat. No. 6,127,138). Four exemplary assays for enzymatic activities of amadoriases are disclosed in Takahashi et al., J. Biol. Chem., 272(6):3437-43 (1997).
The first oxidizing agent is a type of oxidizing agent that selectively oxidizes low molecular weight (M.W.<3000) reducing substances. The first oxidizing agent has higher oxidizing power toward low molecular weight reducing substances than high molecular weight (M.W.>3000) reducing substances. Examples of low molecular weight substances in the blood sample are ascorbic acid and free thio containing molecules. Examples of first oxidizing agent are Dess-Martin periodinane and N-ethyl maleimide. Other examples of first oxidizing agents are sodium iodoacetate, sodium periodate, and Chloramine-T. In some embodiments, more than one first oxidizing agents (e.g., both Dess-Martin periodinane and N-ethyl maleimide) are used.
The second oxidizing agent is a type of oxidizing agent that selectively oxidizes high molecular weight (M.W.>3000) reducing substances. The second oxidizing agent has higher oxidizing power toward high molecular weight reducing substances than low molecular weight reducing substance. An example of high molecular weight substances in the blood sample is hemoglobin. An example of second oxidizing agent is a tetrazolium salt (e.g., 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt, or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt). Other examples of second oxidizing agent are sodium dodecyl sulfate, potassium ferricyanide (III), and potassium iodate. In some embodiments, more than one second oxidizing agent is used.
For the embodiments that a detergent, a first oxidizing agent, a second oxidizing agent and a protease are not placed in the electrode device, a blood sample may be treated with a lysing buffer, a first oxidizing agent, a second oxidizing agent and a protease before applying the sample to the electrode device. The detergent, first oxidizing agent, second oxidizing agent and protease may be formulated in one or more reagents, and may be in liquid or lyophilized powder. These reagents may be included in the kit described herein. In some embodiments, the lysing buffer and the first oxidizing agent (e.g., N-ethylmaleimide and/or Dess Martin Periodinane) may be formulated in one reagent. In some embodiments, the second oxidizing agent and the protease may be in one or separate reagent. A lysis buffer containing a detergent, Dess-Martin Periodinane and N-ethyl Maleimide may be used to lyse the blood cells. For example, a lysis buffer may contain 25-100 mM CHES pH 9.4, 1-3% Triton X-100, 0.1-5 mM (such as about any of 0.1, 0.5, 1, 2, 3, 4, or 5 mM) Dess-Martin Periodinane, and 0.2-5 mM (such as about any of 0.2, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM) N-ethyl Maleimide. Reagent R1a containing a buffer, CaCl2 and a protease, and Reagent R1b containing a buffer, sodium chloride and WST3 and a protease may be mixed for use in digesting glycated hemoglobin into glycated peptide or glycated amino acids in the lysed blood sample. For example, Reagent R1a may contain 10-50 mM MES buffer pH 6.5, 5-10 mM CaCl2, and 500-1500 U/ml neutral protease (Toyobo Co., Ltd.); and Reagent R1b may contain 10-50 mM MES pH 6.5, 100-200 mM sodium chloride, and 0.2-6 mM (such as about any of 0.2, 0.5, 1, 2, 3, 4, 5, or 6 mM) WST3 (2-(4-Iodopenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium, monosodium salt (manufactured by Dojindo Laboratories)), and 10-200 unit (such as about any of 10, 50, 60, 70, 80, 90, 100, 150, or 200 unit) of protease in 100 uL pH 7.0 5 mM MES buffer solution Examples of reagents are described in Example 1 herein and in U.S. Patent Application Pub. No. 2008/0096230.
The invention also provides kits comprising the electrode device described herein. The kits may further comprise reagents for use of the electrode device if not all reagents needed are placed in the electrode device. The kits may further comprise instructions for using the electrode device and/or reagents. In some embodiments, the kits comprise a electrode device described herein, a meter or a reader for detecting or measuring an electrical current between the working electrode and counter electrode or a charge passed at the working electrode of the electrode device, and one or more of the reagents selected from the group consisting of 1) a detergent which lyses red blood cell and releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids. In some embodiments, the meter or the reader comprises a lot enabling the electrode device to insert therein.
Exemplary Embodiments
FIG. 1 shows an exemplary electrode device made with screen-printing methods. This biosensor comprises a working electrode, a reference electrode, and a counter electrode. Both working electrode and counter electrode are Ir-Carbon modified or Prussian Blue modified; and the reference electrode is a Ag/AgCl electrode. These electrodes are screen-printed on a polyester substrate.
The working electrode and the counter electrode are prepared by screen-printing on the polyester substrate. The electrical contacts of these electrodes are silver, and the electrodes are first printed with a silver ink. Ir-Carbon ink or Prussian Blue ink is further printed on the silver based electrodes. Ir-Carbon ink is prepared by mixing and homogenization (for example, for about 5.0 minutes) of 0.5-2.0 g Ir-Carbon with 5-30 ml of an ink based solution containing 0.5-5 ml polyethylenimine and 0.1-1.0 g 2-hydroxyethyl cellulose. For example, Ir-Carbon ink is prepared by mixing 0.9 g Ir-Carbon with 5 ml of an ink based solution (prepared by mixing 10 ml pH 7.0 phosphate buffer with 1.36 ml polyethylenimine and 0.34 g 2-hydroxyethyl cellulose until a clear homogeneous solution has been obtained). Prussian Blue ink is prepared by mixing and homogenization (for about 5 minutes) of 0.5-2.0 g Prussian Blue particles with 5-30 ml of commercial carbon ink. The Prussian Blue particles were prepared using the following procedure. One gram of graphite powder and 10 ml 0.1 M iron (III) chloride were mixed with stirring for 2 minutes. Next, 2-20 ml of 0.1 M potassium ferricyanide were added, and the resulting solution was stirred for 10 min. The resulting mixture was filtered, and was dried at 100° C. for 2-20 hours. AgCl/Ag reference electrode is also prepared by screen-printing on the polyester substrate. The electrical contacts of the reference electrode are silver prepared by printing with a silver ink. A AgCl thick film is used and printed over the silver based electrode, serving as the Ag/AgCl reference electrode. See Fang et al., Sensors and Actuators B 129:818-825, 2008.
The iridium-modified electrochemical sensor structure described above is used as the basis for the construction of a fructosyl amino acid oxidase biosensor. Fructosyl amino acid oxidase (such as FVO) ink is prepared by mixing 1 ml of Ir-Carbon ink with fructosyl amino acid oxidase until a clear solution is obtained. A protease, a lysing buffer, a first oxidizing agent, and/or a second oxidizing agent described herein may also be included in the FAOD ink. The FAOD ink is added onto the Ir-Carbon working electrode and allowed to dry.
The Prussian Blue-modified electrochemical sensor structure described above may also be used as the basis for the construction of a fructosyl amino acid oxidase biosensor. Fructosyl amino acid oxidase (such as FVO) is prepared by mixing 1 ml of Prussian Blue ink with fructosyl amino acid oxidase until a clear solution is obtained. A protease, a lysing buffer, a first oxidizing agent, and/or a second oxidizing agent described herein may also be included in the FAOD ink. The FAOD ink is added onto the Ir-Carbon working electrode and allowed to dry.
C. Methods of Using Electrochemical Biosensors for Assaying Percentage of Glycated Hemoglobin
The invention also provides methods of measuring percentage of glycated hemoglobin (HbA1c) in a blood sample using the electrode device described herein. If a lysing buffer containing a detergent, a first oxidizing agent, a second oxidizing agent and a protease are included in the electrode device, a blood sample may be applied directly into the electrode device. If one or more of these reagents are not included in the electrode device, a blood sample may be pretreated before applying into the electrode device. For example, a blood sample may be treated with a buffer containing a detergent, a first and a second oxidizing agent, and one or more protease(s) to lyse the blood cells in a tube. The lysate is then applied to the working electrode by pipetting onto the working electrode, by capillary-filling into the working electrode, or by dipping the electrode device into the lysed sample. If the electrode device has a sample receiving space, the lysate is applied to the sample receiving space on the electrode device for further reaction with FAOD to generate H2O2 for amperometric detection.
An electrical potential is applied between the working electrode and the counter electrode and/or between the working electrode and the reference electrode. An electrical current is measured between the working electrode and the counter electrode, between the working electrode and the reference electrode, or a charge passed at the working electrode is measured, and the measured current or charge corresponds to the amount of H2O2 generated. In some embodiments, the charge passing through the working electrode is measure over a period of time, such as 1-5 minutes.
In some embodiments, the methods of the invention comprises a) applying a blood sample to the working electrode of the electrode device, wherein the blood sample has been treated with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; b) applying an electrical potential between said working electrode and said reference electrode (e.g., amperometrially or voltammetrically) suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; and c) detecting an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; and whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately.
In some embodiments, the methods comprises applying a sample to a sample receiving space (e.g., an aperture, a sample well, a capillary-fill channel) of an electrode device, wherein the electrode device comprises 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance; 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids; applying an electrical potential between the working electrode and the counter electrode or between the working electrode and the reference electrode (e.g., amperometrially or voltammetrically); and measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode; whereby the percentage of glycated hemoglobin (HbA1c) is determined based on the measured current or charge as compared to a reference (such as a calibration curve) without measuring the total hemoglobin in the blood sample separately. In some embodiments, the application of an electrical potential onto the working/reference or working/counter electrode is delayed for certain period of time to allow the reactions between the oxidants and reducing substances (such as hemoglobin) in the sample to reach completion or close to completion.
The percentage of total glycated hemoglobin or percentage of glycated hemoglobin A1c in a blood sample is determined by comparing the measured electrical current or charge to a reference (such as a calibration curve). The calibration curve is established using calibrator, i.e., samples (including blood samples and artificial calibrators) with known percentage of glycated hemoglobin or known percentage of glycated hemoglobin A1c.
In some embodiments, the calibration curve is prepared by measuring the electrical current using the biosensor for calibration samples by performing the same steps as the unknown samples without measuring the total hemoglobin separately; and graphing the correlation between the electrical current or charge of the calibration samples and the known percentage of glycated hemoglobin or known percentage of glycated hemoglobin A1c of the calibration samples. For example, whole blood samples having percentages of glycated hemoglobin A1c value assigned by comparison to a suitable higher order reference material can be used as calibrators. Alternative, the percentage of glycated hemoglobin A1c may be determined by another recognized method such as HPLC. Calibrators are tested the same way as the unknown samples using the methods described herein. The electrical current or charge measured for calibrators are plotted against the expected HbA1c value to establish the calibration curve. The calibration curve information for each lot of device may be electronically stored in the device so that there is no need for users to construct a calibration curve by themselves.
Calibrators other than whole blood sample may also be used to establish a calibration curve. Hemolysate samples (lysed blood samples), glycated peptides, glycated amino acid, and glycated amino acid derivatives in a suitable buffered protein matrix solution having percentage of glycated hemoglobin A1c value assigned by comparison to a suitable higher order reference material can be used as artificial calibrators. For example, calibration samples may be prepared in a phosphate buffered solution with 10% BSA and appropriate amounts of synthesized fructosyl propylamine (glycated amino acid) corresponding to various percentage of HbA1c (e.g., from 5% o 12%). Artificial calibrators are tested the same way as unknown samples except that the lysing step may not be used. The electrical current values measured for these calibrators are plotted against the expected HbA1c value to establish the calibration curve. Artificial calibrators may be lyophilized or stabilized for extended shelf life.
Blood samples that can be assayed using the present methods and biosensors include whole blood or collected blood cells. The present methods and biosensors may be used for any suitable purpose, such as in the prognosis or diagnosis of a disease or disorder (e.g., diabetes).
EXAMPLES Example 1 Electrochemical Sensing of HbA1c by Pipetting a Sample onto a Biosensor or Dipping Biosensor into a Sample
A biosensor with a working electrode, a reference electrode, and a counter electrode was prepared. Both working electrode and counter electrode are Ir-Carbon modified; and the reference electrode is Ag/AgCl electrode. The working electrode and the counter electrode were prepared by screen-printing on the polyester substrate. The electrical contacts of these electrodes are silver, and the electrodes were first printed with a silver ink. Ir-Carbon ink was further printed on the silver based electrodes. Ir-Carbon ink was prepared by mixing and homogenization of 0.5-2 g Ir-Carbon with 5-30 ml of an ink based solution (containing polyethylenimine and 2-hydroxyethyl cellulose). The working electrode also contains a fructosyl amino acid oxidase. Fructosyl amino acid oxidase (such as FVO having the amino acid sequence shown in SEQ ID NO:1) ink was prepared by mixing 1 ml of Ir-Carbon ink with fructosyl amino acid oxidase until a clear solution was obtained.
Ag/AgCl reference electrode was also prepared by screen-printing on the polyester substrate. The electrical contacts of the reference electrode were prepared by printing with a silver ink. A AgCl thick film was used and printed over the silver based electrode, serving as the Ag/AgCl reference electrode.
To test the biosensor, blood samples with known HbA1c percentage were lysed by a lysis buffer (50 mM CHES pH 9.4 and 2% Triton X-100) at room temperature for 10 minutes. The blood lysates were treated with oxidizing agents and protease (Toyobo Co., Ltd.) at 37° C. for 10 minutes. For example, 100 ul blood sample was lysed in 900 ul of lysis buffer containing 50 mM CHES pH 9.4, 2% Triton X-100, 0.1-5 mM (such as 0.1, 0.5, 1, 2, 3, 4, or 5 mM) Dess-Martin Periodinane, and 0.2-5 mM (such as 0.2, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM) N-ethyl Maleimide. The lysate was mixed with lyophilized powder from 5 ml reagent R1a (25 mM MES buffer pH 6.5, 5 mM CaCl2, and 1000 U/ml neutral protease (Toyobo Co., Ltd.)), lyophilized powder from 2.5 mL reagent R1b (25 mM MES pH 6.5, 150 mM sodium chloride, and 0.2-6 mM (such as 0.2, 0.5, 1, 2, 3, 4, 5, or 6 mM) WST3 (2-(4-Iodopenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium, monosodium salt (manufactured by Dojindo Laboratories)), and 10-200 unit (such as 10, 50, 60, 70, 80, 90, 100, 150, or 200 unit) of protease in 100 uL pH 7.0 5 mM MES buffer solution. The final solution had a total volume of 1.1 mL and was incubated at temperature 37° C. for 10 minutes.
3 uL of the incubated solution was placed (by pipetting) onto the working electrode with enzyme FAOD for electrochemical measurement. The electrochemical measurement was carried out at +0.25V vs. the Ag/AgCl reference electrode for 120 seconds. The current between the working electrode and the counter electrode measured for each sample is shown in FIG. 4. Alternatively, the biosensor was dipped into the incubated solution for electrochemical measurement. The electrochemical measurement was carried out at the +0.25V vs. the Ag/AgCl reference electrode for 120 seconds. The current measured for each sample is shown in FIG. 5. Data in FIGS. 5 and 6 demonstrate that the current measured from the biosensor fits into a linear model with the HbA1c percentage in the blood sample, and the biosensor and the methods can be used for determination of the percentage of glycated hemoglobin without a separate measurement of total hemoglobin.
Example 2 Electrochemical Sensing of HbA1c Using a Biosensor with a Capillary Fill Device
The biosensor described in Example 1 was laminated manually to form a capillary-fill device. See FIG. 4.
The biosensor was dipped into the incubated solution described in Example 1 for a few seconds to fill the microchannel with the blood lysate through capillary action. The biosensor is then used for electrochemical measurement. The electrochemical measurement was carried out at +0.25V vs. the Ag/AgCl reference for 120 seconds. The current measured for each sample is shown in FIG. 7. Data in FIG. 7 demonstrate that the current measured from the biosensor fits into a linear model with the HbA1c percentage in the blood sample, and the biosensor and the methods can be used for determination of percentage of glycated hemoglobin without a separate measurement of total hemoglobin.
Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity and understanding, it will be apparent to those skilled in the art that certain changes and modifications may be practiced. Therefore, descriptions and examples should not be construed as limiting the scope of the invention, which is delineated by the appended claims.

Claims (56)

The claimed invention is:
1. A method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising:
a) applying a blood sample to a sample receiving well of an electrode device, wherein the blood sample has been treated with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance 3) a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, and 4) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids;
wherein the electrode device comprises:
i) an electrode support;
ii) a working electrode placed on the electrode support, wherein a fructosyl amino acid oxidase is placed on or near the working electrode;
iii) a counter electrode placed on the electrode support;
iv) a reference electrode placed on the electrode support, wherein the working, counter and reference electrodes are spaced from each other;
wherein the working electrode and/or the counter electrode further comprise a catalyst which catalyzes the redox reaction of hydrogen peroxide; and
v) an insulation/covering layer defining an enclosed space over the working electrode, the counter electrode, and the reference electrode, wherein said insulation/covering layer forms a well for receiving a sample, wherein the sample well is located on the electrodes or near the electrodes;
wherein (i) the second oxidizing agent is a tetrazolium salt which is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt; (ii) the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1; or (iii) the protease generates a glycated peptide from about 2 to about 30 amino acid residues;
b) applying an electrical potential between the working electrode and the reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; and
c) measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode;
whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference without measuring the total hemoglobin in the blood sample separately.
2. The method of claim 1, wherein the hydrogen peroxide generated by the fructosyl amino acid oxidase-catalyzed reaction is electrochemically detected directly or indirectly via a mediator or a catalyst.
3. The method of claim 1, wherein the electrical potential is applied between the working electrode and the reference electrode in a time delayed manner.
4. The method of claim 1, wherein the reference is a calibration curve.
5. The method of claim 1, wherein the electrode device further comprises a capillary-fill channel for receiving a sample through capillary action, wherein one end of the channel is in contact with the working electrode.
6. The method of claim 1, wherein the working electrode and the counter electrode further comprise a mediator which shuttles electrons between the hydrogen peroxide generated from said fructosyl amino acid oxidase-catalyzed reaction and the working electrode to create a current representative of the amount of the glycated hemoglobin in the sample.
7. The method of claim 6, wherein the mediator comprises one or more agents selected from the group consisting of ferrocene, Prussian Blue, metal phthalocyonine, and tetrathiafulvalene (TTF).
8. The method of claim 1, wherein the catalyst comprises one or more agents selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
9. The method of claim 8, wherein said Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
10. The method of claim 1, wherein the fructosyl amino acid oxidase is formulated in a matrix and is placed on or near the working electrode.
11. The method of claim 10, wherein the matrix comprises an enzyme immobilizing agent and a thickening polymer.
12. The method of claim 1, wherein the electrode device further comprises a sample transfer path between said sample well and said working electrode.
13. The method of claim 1, wherein the working electrode and/or the counter electrode comprise a metallized carbon selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
14. The method of claim 13, wherein Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
15. The method of claim 1, wherein the reference electrode is Ag/AgCl.
16. The method of claim 1, wherein the electrodes are screen-printed using thick film technology or using thin film lithography.
17. The method of claim 1, wherein the first oxidizing agent is selected from the group consisting of Dess-Martin periodinane, N-ethyl maleimide, sodium iodoacetate, sodium periodate, and Chloramine-T.
18. The method of claim 1, wherein the tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.
19. The method of claim 1, wherein the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1.
20. The method of claim 1, wherein the protease generates a glycated peptide from about 2 to about 30 amino acid residues.
21. A method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising:
a) applying a blood sample to a sample receiving well of an electrode device; wherein the electrode device comprises:
i) an electrode support;
ii) a working electrode placed on the electrode support, wherein a fructosyl amino acid oxidase is placed on or near the working electrode;
iii) a counter electrode placed on the electrode support;
iv) a reference electrode placed on the electrode support, wherein the working, counter and reference electrodes are spaced from each other;
wherein the working electrode and/or the counter electrode further comprise a catalyst which catalyzes the redox reaction of hydrogen peroxide; and
v) an insulation/covering layer defining an enclosed space over the working electrode, the counter electrode, and the reference electrode, wherein said insulation/covering layer forms a well for receiving a sample, wherein the sample well is located on the electrodes or near the electrodes, and contains a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance, a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance, one or more proteases which digest glycated hemoglobin into glycated peptides or glycated amino acids, and a detergent that lyses red blood cells in a blood sample and releases hemoglobin; and
vi) a sample transfer path between said sample well and said working electrode;
wherein (i) the second oxidizing agent is a tetrazolium salt which is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt; (ii) the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1; or (iii) the protease generates a glycated peptide from about 2 to about 30 amino acid residues;
b) applying an electrical potential between said working electrode and said reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; and
c) measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode;
whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference without measuring the total hemoglobin in the blood sample separately.
22. The method of claim 21, wherein the hydrogen peroxide generated by the fructosyl amino acid oxidase-catalyzed reaction is electrochemically detected directly or indirectly via a mediator or a catalyst.
23. The method of claim 21, wherein the electrical potential is applied between the working electrode and the reference electrode in a time delayed manner.
24. The method of claim 21, wherein the reference is a calibration curve.
25. The method of claim 21, wherein the working electrode and the counter electrode further comprise a mediator which shuttles electrons between the hydrogen peroxide generated from said fructosyl amino acid oxidase-catalyzed reaction and the working electrode to create a current representative of the amount of the glycated hemoglobin in the sample.
26. The method of claim 25, wherein the mediator comprises one or more agents selected from the group consisting of ferrocene, Prussian Blue, metal phthalocyonine, and tetrathiafulvalene (TTF).
27. The method of claim 21, wherein the catalyst comprises one or more agents selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
28. The method of claim 27, wherein said Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
29. The method of claim 21, wherein the fructosyl amino acid oxidase is formulated in a matrix and is placed on or near the working electrode.
30. The method of claim 29, wherein the matrix comprises an enzyme immobilizing agent and a thickening polymer.
31. The method of claim 21, wherein the working electrode and/or the counter electrode comprise a metallized carbon selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
32. The method of claim 31, wherein Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
33. The method of claim 21, wherein the reference electrode is Ag/AgCl.
34. The method of claim 21, wherein the electrodes are screen-printed using thick film technology or using thin film lithography.
35. The method of claim 21, wherein the first oxidizing agent is selected from the group consisting of Dess-Martin periodinane, N-ethyl maleimide, sodium iodoacetate, sodium periodate, and Chloramine-T.
36. The method of claim 21, wherein the tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.
37. The method of claim 21, wherein the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1.
38. The method of claim 21, wherein the protease generates a glycated peptide from about 2to about 30 amino acid residues.
39. A method of measuring percentage of glycated hemoglobin (HbA1c) in a sample, comprising:
a) applying a blood sample to a working electrode of an electrode device, wherein the blood sample has been treated with 1) a lysing buffer which releases hemoglobin from red blood cells in the blood sample; 2) a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance if the first oxidizing agent is not placed on or near the working electrode, or a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance if the second oxidizing agent is not placed on or near the working electrode, and 3) a protease which digests glycated hemoglobin into glycated peptides or glycated amino acids;
wherein the electrode device comprises:
i) an electrode support;
ii) a working electrode placed on the electrode support, wherein a fructosyl amino acid oxidase is placed on or near the working electrode, and wherein a first oxidizing agent which selectively oxidizes a low molecular weight reducing substance or a second oxidizing agent which selectively oxidizes a high molecular weight reducing substance is placed on or near the working electrode;
iii) a counter electrode placed on the electrode support; and
iv) a reference electrode placed on the electrode support, wherein the working, counter and reference electrodes are spaced from each other;
wherein (i) the second oxidizing agent is a tetrazolium salt which is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt; (ii) the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1; or (iii) the protease generates a glycated peptide from about 2 to about 30 amino acid residues;
b) applying an electrical potential between said working electrode and said reference electrode suitable for monitoring the hydrogen peroxide generated from the fructosyl amino acid oxidase-catalyzed reaction; and
c) measuring an electrical current between the working electrode and the counter electrode or a charge passed at the working electrode;
whereby the percentage of glycated hemoglobin in the sample is determined based on the measured current or charge as compared to a reference without measuring the total hemoglobin in the blood sample separately.
40. The method of claim 39, wherein the treated blood sample is pipetted onto the working electrode.
41. The method of claim 39, wherein the electrode device comprises the capillary-fill channel for receiving a sample through capillary action and one end of the channel is in contact with the working electrode, and wherein the treated blood sample is applied to the working electrode through a capillary-fill channel.
42. The method of claim 39, wherein the working electrode and the counter electrode further comprise a mediator which shuttles electrons between the hydrogen peroxide generated from said fructosyl amino acid oxidase-catalyzed reaction and the working electrode to create a current representative of the amount of the glycated hemoglobin in the sample.
43. The method of claim 42, wherein the mediator comprises one or more agents selected from the group consisting of ferrocene, Prussian Blue, metal phthalocyonine, and tetrathiafulvalene (TTF).
44. The method of claim 39, wherein the working electrode and/or the counter electrode further comprise a catalyst which catalyzes the redox reaction of hydrogen peroxide.
45. The method of claim 44, wherein the catalyst comprises one or more agents selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
46. The method of claim 45, wherein said Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
47. The method of claim 39, wherein the fructosyl amino acid oxidase is formulated in a matrix and is placed on or near the working electrode.
48. The method of claim 47, wherein the matrix comprises an enzyme immobilizing agent and a thickening polymer.
49. The method of claim 39, wherein the working electrode and/or the counter electrode comprise a metallized carbon selected from the group consisting of Ir-carbon, Rh-carbon, and Ru-carbon.
50. The method of claim 49, wherein Ir-carbon, Rh-carbon, and Ru-carbon are nanoparticles.
51. The method of claim 39, wherein the reference electrode is Ag/AgCl.
52. The method of claim 39, wherein the electrodes are screen-printed using thick film technology or using thin film lithography.
53. The method of claim 39, wherein the first oxidizing agent is selected from the group consisting of Dess-Martin periodinane, N-ethyl maleimide, sodium iodoacetate, sodium periodate, and Chloramine-T.
54. The method of claim 39, wherein the tetrazolium salt is 2-(4-iodophenyl)-3-(2,4-dinitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt or 2-(4-iodophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium monosodium salt.
55. The method of claim 39, wherein the fructosyl amino acid oxidase comprises the amino acid sequence of SEQ ID NO:1.
56. The method of claim 39, wherein the protease generates a glycated peptide from about 2 to about 30 amino acid residues.
US12/465,143 2008-05-13 2009-05-13 Electrochemical biosensor for direct determination of percentage of glycated hemoglobin Expired - Fee Related US8673646B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US12/465,143 US8673646B2 (en) 2008-05-13 2009-05-13 Electrochemical biosensor for direct determination of percentage of glycated hemoglobin

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US5288808P 2008-05-13 2008-05-13
US12/465,143 US8673646B2 (en) 2008-05-13 2009-05-13 Electrochemical biosensor for direct determination of percentage of glycated hemoglobin

Publications (2)

Publication Number Publication Date
US20100025264A1 US20100025264A1 (en) 2010-02-04
US8673646B2 true US8673646B2 (en) 2014-03-18

Family

ID=41172400

Family Applications (1)

Application Number Title Priority Date Filing Date
US12/465,143 Expired - Fee Related US8673646B2 (en) 2008-05-13 2009-05-13 Electrochemical biosensor for direct determination of percentage of glycated hemoglobin

Country Status (4)

Country Link
US (1) US8673646B2 (en)
EP (1) EP2283149A1 (en)
CN (1) CN102076867A (en)
WO (1) WO2009140343A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019103948A1 (en) 2017-11-22 2019-05-31 Jim Connolly Method of analysis of undiluted whole blood samples with an electrochemical biosensor
US11199551B1 (en) 2017-11-22 2021-12-14 Jim Connolly Test sensors, systems, and analysis techniques for measuring glycated hemoglobin in undiluted blood samples
KR20220006979A (en) * 2020-07-09 2022-01-18 동우 화인켐 주식회사 Biosensor
EP3887398A4 (en) * 2018-11-29 2022-10-19 Polymer Technology Systems, Inc. SYSTEMS AND METHODS OF ELECTROCHEMICAL POINT OF HEMOGLOBIN DETECTION
US12044649B2 (en) 2017-11-22 2024-07-23 Jim Connolly Multi-zone, fixed potential test sensor heating system method
EP4459273A1 (en) * 2023-05-03 2024-11-06 Vilnius University A method for obtaining an enzyme electrode with a membrane for detection and quantification of l-amino acids and enzyme electrode with a membrane for detection and quantification of l-amino acids

Families Citing this family (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7943385B2 (en) 2006-07-25 2011-05-17 General Atomics Methods for assaying percentage of glycated hemoglobin
WO2008013874A1 (en) 2006-07-25 2008-01-31 General Atomics Methods for assaying percentage of glycated hemoglobin
EP2283149A1 (en) 2008-05-13 2011-02-16 General Atomics Electrochemical biosensor for direct determination of percentage of glycated hemoglobin
GB0820817D0 (en) * 2008-11-13 2008-12-24 Wireless Biodevices Ltd Electrode, electrochemical sensor and apparatus, and methods for operating the same
JP5352742B2 (en) * 2009-08-07 2013-11-27 オームクス コーポレーション Enzymatic redox-change chemical elimination (E-TRACE) immunoassay
US20110139636A1 (en) * 2009-12-14 2011-06-16 Lai Rebecca Y Gold-plated screen-printed electrodes and their use as electrochemical sensors
US8877034B2 (en) 2009-12-30 2014-11-04 Lifescan, Inc. Systems, devices, and methods for measuring whole blood hematocrit based on initial fill velocity
US8101065B2 (en) 2009-12-30 2012-01-24 Lifescan, Inc. Systems, devices, and methods for improving accuracy of biosensors using fill time
US8932445B2 (en) 2010-09-30 2015-01-13 Cilag Gmbh International Systems and methods for improved stability of electrochemical sensors
US8617370B2 (en) 2010-09-30 2013-12-31 Cilag Gmbh International Systems and methods of discriminating between a control sample and a test fluid using capacitance
WO2012100078A1 (en) 2011-01-19 2012-07-26 Ohmx Corporation Enzyme triggered redox altering chemical elimination (e-trace) immmunoassay
US8702931B2 (en) * 2011-04-18 2014-04-22 Indian Institute Of Science Low cost electrochemical disposable sensor for measuring glycated hemoglobin
JP6203183B2 (en) 2011-10-17 2017-09-27 オームクス コーポレイション Single direct detection of the percentage of hemoglobin A1C using an enzyme-induced redox change chemical elimination (E-TRACE) immunoassay
WO2013067349A1 (en) 2011-11-04 2013-05-10 Ohmx Corporation Novel chemistry used in biosensors
EP2802669A1 (en) 2012-01-09 2014-11-19 Ohmx Corporation Enzyme cascade methods for e-trace assay signal amplification
US9939402B2 (en) * 2012-02-09 2018-04-10 Lg Electronics Inc. Blood sugar detecting method and cartridge using same
TW201344195A (en) * 2012-04-20 2013-11-01 Anatech Co Ltd Method and device for detecting glycohemoglobin
EP2870173B1 (en) 2012-07-09 2018-10-17 Roche Diagniostics GmbH Recombinantly produced neutral protease originating from paenibacillus polymyxa
WO2014018899A1 (en) 2012-07-27 2014-01-30 Ohmx Corporation Electric measurement of monolayers following pro-cleave detection of presence and activity of enzymes and other target analytes
EP2877592B1 (en) 2012-07-27 2016-09-21 Ohmx Corporation Electronic measurements of monolayers following homogeneous reactions of their components
ES2744633T3 (en) 2013-03-14 2020-02-25 Instr Laboratory Co Whole blood hemolysis sensor
EP3211079B1 (en) * 2014-10-24 2020-12-02 Kikkoman Corporation Amadoriase having enhanced dehydrogenase activity
EP3454056A4 (en) * 2016-02-25 2019-06-26 PHC Holdings Corporation Biosensor
TWI589870B (en) * 2016-05-05 2017-07-01 Vida Biotechnology Co Ltd Biological test strip with isolated structure and method of use
EP3589948A4 (en) 2017-03-03 2020-12-30 Polymer Technology Systems, Inc. Systems and methods for enzymatic a1c detection and quantification
CN107045068A (en) * 2017-04-14 2017-08-15 刘锦 Portable physiological Indexs measure instrument and its detection method based on micro-fluidic paper chip
IT201700070452A1 (en) 2017-06-23 2018-12-23 Fondazione St Italiano Tecnologia THERMOSTABILIZED AMADORIASES AND USES THEREOF
US11703513B2 (en) 2017-08-07 2023-07-18 Polymer Technology Systems, Inc. Systems and methods for enzymatic A1C detection and quantification
US11874249B2 (en) * 2017-08-23 2024-01-16 Mayo Foundation For Medical Education And Research Graphite biosensor and circuit structure and method of manufacture
MX2019010428A (en) * 2017-12-12 2020-01-09 Polymer Technology Systems Inc Systems and methods for sample preparation for enzymatic a1c detection and quantification.
CN108562751A (en) * 2018-05-04 2018-09-21 深圳市西尔曼科技有限公司 The detection method of enzyme membrane and preparation method thereof, glycosylated hemoglobin
US12085529B2 (en) 2018-05-18 2024-09-10 Provigate Inc. Glycated protein sensor, measurement method, program, and sensor manufacture method
CN108732222B (en) * 2018-05-21 2020-02-18 浙江工业大学 A method for simultaneous rapid detection of glycated hemoglobin and glycated serum protein in blood
CN109884149A (en) * 2019-02-02 2019-06-14 常州市第二人民医院 Glycosylated hemoglobin electrochemical luminescence enzyme sensor preparation method
EP3851040A1 (en) * 2020-01-16 2021-07-21 PKvitality Body monitoring device and associated method
WO2021181154A1 (en) * 2020-03-10 2021-09-16 Abdolahad Mohammad An electrochemical method and device for detecting the effect of anticancer drugs
CN113588748A (en) * 2021-07-12 2021-11-02 成都云芯医联科技有限公司 Full blood triggered electrochemical test paper
CN113588750B (en) * 2021-07-16 2024-01-19 成都云芯医联科技有限公司 Electrochemical test card for simultaneously measuring hemoglobin and glycosylated hemoglobin and manufacturing method thereof
CN115112742A (en) * 2022-07-01 2022-09-27 山东先声生物制药有限公司 Method for correcting molecular weight isoelectric point by using physicochemical reference substance
KR102869232B1 (en) * 2022-11-10 2025-10-14 계명대학교 산학협력단 Glycated hemoglobin measuring device using carbon electrode and biosensor for simultaneously measuring glucose and glycated hemoglobin using the same and Method for manufacturing glycated hemoglobin measuring device using carbon electrode and method for manufacturing biosensor for simultaneously measuring glucose and glycated hemoglobin

Citations (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2713581A (en) 1949-02-23 1955-07-19 Montclair Res Corp Certain tetrazolium salts and process for preparing them
GB738585A (en) 1952-07-17 1955-10-19 May & Baker Ltd Improvements in or relating to tetrazolium compounds
GB1513488A (en) 1976-11-11 1978-06-07 Lushina O Method of preparing 2h-tetrazolium chlorides and 2h-tetrazolium chlorides hydrochlorides
EP0121352A1 (en) 1983-03-28 1984-10-10 The Public Health Laboratory Service Board A leader sequence to promote the secretion of gene products
EP0127958A2 (en) 1983-05-05 1984-12-12 MediSense, Inc. Sensor electrode systems
US4588684A (en) 1983-04-26 1986-05-13 Chiron Corporation a-Factor and its processing signals
EP0186643A1 (en) 1984-11-23 1986-07-02 Région Wallonne représentée par l'Exécutif Régional Wallon Method for the production of vector plasmids capable of transforming an Escherichia coli host bacterium and to promote and control the expression of heterologous DNA
EP0189918A2 (en) 1985-01-29 1986-08-06 E.I. Du Pont De Nemours And Company Heat-fusion pipe fitting system
EP0196864A2 (en) 1985-03-25 1986-10-08 Cetus Corporation Alkaline phosphatase-mediated processing and secretion of recombinant proteins, DNA sequences for use therein and cells transformed using such sequences
EP0239931A2 (en) 1986-04-04 1987-10-07 Roche Diagnostics GmbH Process and reagent for the determination of substrates or enzyme activities
WO1989003886A1 (en) 1987-10-30 1989-05-05 Oncogen, A Limited Partnership Expression systems for preparation of polypeptides in prokaryotic cells
US4837331A (en) 1983-05-30 1989-06-06 Wako-Pure Chemical Industries, Ltd. Stabilization of tetrazolium salts with cyclodextrins
US4847195A (en) 1985-05-31 1989-07-11 Syntex (U.S.A.) Inc. Glucose-6-phosphate dehydrogenase conjugates useful in polyiodothyronine assays
US4948729A (en) 1985-03-25 1990-08-14 Cetus Corporation Production of soluble recombinant proteins
WO1990012113A1 (en) 1989-04-13 1990-10-18 Enzymatics, Inc. The use of fluid insoluble oxidizing agents to eliminate interfering substances in oxidation-reduction measuring systems
US5030563A (en) 1987-07-07 1991-07-09 Genetics Institute, Inc. Bacterial hypersecretion using mutant repressor sequence
US5120420A (en) 1988-03-31 1992-06-09 Matsushita Electric Industrial Co., Ltd. Biosensor and a process for preparation thereof
US5137821A (en) 1988-12-29 1992-08-11 Toyo Jozo Company, Ltd. Gene and process of making glucose-6-phosphate dehydrogenase
US5171670A (en) 1989-05-12 1992-12-15 The General Hospital Corporation Recombinant dna method for production of parathyroid hormone
US5196314A (en) 1986-04-04 1993-03-23 Boehringer Mannheim Gmbh Process and reagent for the determination of substrates or enzyme activities
WO1993006125A1 (en) 1991-09-20 1993-04-01 The United States Of America, Represented By The Secretary, Department Of Health And Human Services ISOLATION AND CHARACTERIZATION OF cDNA OF PLASMODIUM FALCIPARUM GLUCOSE-6-PHOSPHATE DEHYDROGENASE
US5229286A (en) 1990-07-30 1993-07-20 Boehringer Mannheim Gmbh Cloning and overexpression of glucose-6-phosphate dehydrogenase from leuconostoc dextranicus
US5244796A (en) 1990-10-12 1993-09-14 Syracuse University Cloned leuconostoc mesenteroides glucose-6-phosphate dehydrogenase genes and method of making glucose-6-phospate dehydrogenase
US5312759A (en) 1989-12-20 1994-05-17 Iatron Laboratories, Inc. Method for measurement of fructosamines using 1,2-quinones
US5320732A (en) 1990-07-20 1994-06-14 Matsushita Electric Industrial Co., Ltd. Biosensor and measuring apparatus using the same
US5344770A (en) 1991-01-17 1994-09-06 Kao Corporation Bacillus SP. ferm BP-3376 and a method for its use to produce an alkaline proteinase K-16
US5385846A (en) * 1993-06-03 1995-01-31 Boehringer Mannheim Corporation Biosensor and method for hematocrit determination
US5509410A (en) 1983-06-06 1996-04-23 Medisense, Inc. Strip electrode including screen printing of a single layer
US5628890A (en) 1995-09-27 1997-05-13 Medisense, Inc. Electrochemical sensor
US5681529A (en) 1994-08-25 1997-10-28 Nihon Medi-Physics Co., Ltd. Biological fluid analyzing device
US5682884A (en) 1983-05-05 1997-11-04 Medisense, Inc. Strip electrode with screen printing
US5710248A (en) 1996-07-29 1998-01-20 University Of Iowa Research Foundation Peptide tag for immunodetection and immunopurification
US5712138A (en) 1994-10-05 1998-01-27 Kyoto Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase
EP0821064A2 (en) 1996-07-23 1998-01-28 Kyoto Daiichi Kagaku Co., Ltd. Recombinant fructosyl amino acid oxidase
US5789221A (en) 1994-03-03 1998-08-04 Kyogo Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase and process for producing the same
US5824527A (en) 1995-04-11 1998-10-20 Kyoto Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase and process for producing the same
US5856104A (en) 1996-10-28 1999-01-05 Affymetrix, Inc. Polymorphisms in the glucose-6 phosphate dehydrogenase locus
US5879921A (en) 1996-11-07 1999-03-09 Novo Nordisk A/S Recombinant expression of a glucose oxidase from a cladosporium strain
US5885811A (en) 1988-07-05 1999-03-23 University Of Maryland Leader sequence inducing a post-translational modification of polypeptides in bacteria gene therefor and subtilin variant of enhanced stability and activity
US5948665A (en) 1996-02-16 1999-09-07 Oriental Yeast Co. Ltd. Hexokinase obtained from thermophilic yeast Kluyveromyces fragilis
US5972294A (en) 1996-04-04 1999-10-26 Lifescan, Inc. Reagent test strip for determination of blood glucose
US5972745A (en) 1997-05-30 1999-10-26 International Business Machines Corporation Method or forming self-aligned halo-isolated wells
US5985591A (en) 1997-11-26 1999-11-16 Kyoto Daiichi Kagaku Co., Ltd. Method for the determination of glycosylated proteins
US6008006A (en) 1995-05-05 1999-12-28 Genzyme Limited Et Al. Determination of glycated proteins
US6069297A (en) 1996-12-09 2000-05-30 Sloan-Kettering Institute For Cancer Research Glucose-6-phosphate dehydrogenase deficient mice and methods of using same
US6127138A (en) 1997-04-24 2000-10-03 Kyoto Daiichi Kagaku Co., Ltd. Method of enzymatically measuring glycated protein
US6127345A (en) 1997-01-21 2000-10-03 Smithkline Beecham Corporation Polynucleotides encoding the glucose 6-phosphate dehydrogenase of Streptococcus pneumoniae
US6143164A (en) 1997-02-06 2000-11-07 E. Heller & Company Small volume in vitro analyte sensor
US6194200B1 (en) 1987-10-30 2001-02-27 Oncogen Expression systems for preparation of polypeptides in prokaryotic cells
US6270637B1 (en) 1997-12-05 2001-08-07 Roche Diagnostics Corporation Electrochemical biosensor test strip
US6329161B1 (en) 1993-12-02 2001-12-11 Therasense, Inc. Subcutaneous glucose electrode
US20020009779A1 (en) 2000-05-19 2002-01-24 Meyers Rachel A. 50365, a novel hexokinase family member and uses therefor
US6352835B1 (en) 1998-11-17 2002-03-05 Kyoto Daiichi Kagaku Co. Ltd. Method of measuring substance in sample using a redox reaction
US6380380B1 (en) 1999-01-04 2002-04-30 Specialty Assays, Inc. Use of nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucliotide phosphate (NADP) analogs to measure enzyme activities metabolites and substrates
EP1223224A1 (en) 1999-10-01 2002-07-17 Kikkoman Corporation Method of assaying glycoprotein
US6451574B1 (en) 1995-03-09 2002-09-17 The Procter & Gamble Company Proteinase K variants having decreased adsorption and increased hydrolysis
USRE37919E1 (en) 1989-05-12 2002-12-03 The General Hospital Corporation Recombinant DNA method for production of parathyroid hormone
US20030032077A1 (en) * 2001-08-10 2003-02-13 Nipro Corporation Recording medium and blood glucose monitoring system using the recording medium
EP1304385A1 (en) 2000-07-14 2003-04-23 ARKRAY, Inc. Method of selectively determining glycated hemoglobin
US20030211564A1 (en) * 2002-05-10 2003-11-13 Suyue Qian Multilayer reagent test strips and methods for using the same to quantify glycated protein in a physiological sample
US20040063213A1 (en) 2000-09-28 2004-04-01 Kaoru Hirai Assay method with the use of redox reaction
US20040166560A1 (en) 2001-02-09 2004-08-26 Rainer Mueller Expression of recombinant proteinase k <I> from tritirachium album </I>in yeast
US20040171130A1 (en) 2000-06-21 2004-09-02 Haruhiko Yokoi Novel glucose-6-phosphate dehydrogenase
US20050014935A1 (en) 2003-07-17 2005-01-20 Chong-Sheng Yuan Methods and compositions for determination of glycated proteins
US6863800B2 (en) 2002-02-01 2005-03-08 Abbott Laboratories Electrochemical biosensor strip for analysis of liquid samples
EP1542015A1 (en) 1995-10-16 2005-06-15 LXN Corporation Electrochemical determination of fructosamine
EP1614746A1 (en) 2003-03-17 2006-01-11 Koji Sode Fructosylamine oxidase
US20070099283A1 (en) 2001-02-09 2007-05-03 Rainer Mueller Recombinant proteinase k
WO2007094354A1 (en) 2006-02-14 2007-08-23 National Institute Of Advanced Industrial Science And Technology HEMOGLOBIN A1c SENSOR
US7276147B2 (en) 2001-11-16 2007-10-02 Roche Diagnostics Operations, Inc. Method for determining the concentration of an analyte in a liquid sample using small volume samples and fast test times
US7276146B2 (en) 2001-11-16 2007-10-02 Roche Diagnostics Operations, Inc. Electrodes, methods, apparatuses comprising micro-electrode arrays
WO2008013874A1 (en) * 2006-07-25 2008-01-31 General Atomics Methods for assaying percentage of glycated hemoglobin
US7381539B2 (en) 2002-06-07 2008-06-03 Arkray, Inc. Method of assay by oxidation-reduction reaction with formazan
US20080176296A1 (en) 2001-11-13 2008-07-24 Oskar Zelder Gene Coding for Glucose-6-Phosphate-Dehydrogenase Proteins
US20080299597A1 (en) 2006-07-25 2008-12-04 Chong-Sheng Yuan Methods for assaying percentage of glycated hemoglobin
US20090090623A1 (en) 2007-05-21 2009-04-09 Delta Electronics, Inc. Biosensor having integrated heating element and electrode with metallic catalyst
WO2009140343A1 (en) 2008-05-13 2009-11-19 General Atomics Electrochemical biosensor for direct determination of percentage of glycated hemoglobin

Patent Citations (116)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2713581A (en) 1949-02-23 1955-07-19 Montclair Res Corp Certain tetrazolium salts and process for preparing them
GB738585A (en) 1952-07-17 1955-10-19 May & Baker Ltd Improvements in or relating to tetrazolium compounds
GB1513488A (en) 1976-11-11 1978-06-07 Lushina O Method of preparing 2h-tetrazolium chlorides and 2h-tetrazolium chlorides hydrochlorides
EP0121352B1 (en) 1983-03-28 1988-01-07 The Public Health Laboratory Service Board A leader sequence to promote the secretion of gene products
EP0121352A1 (en) 1983-03-28 1984-10-10 The Public Health Laboratory Service Board A leader sequence to promote the secretion of gene products
US4588684A (en) 1983-04-26 1986-05-13 Chiron Corporation a-Factor and its processing signals
EP0127958A2 (en) 1983-05-05 1984-12-12 MediSense, Inc. Sensor electrode systems
US5682884A (en) 1983-05-05 1997-11-04 Medisense, Inc. Strip electrode with screen printing
EP0351891B1 (en) 1983-05-05 1993-09-29 MediSense, Inc. Printed electrodes
EP0127958A3 (en) 1983-05-05 1987-06-16 Genetics International, Inc. Analytical equipment and sensor electrodes therefor
US5820551A (en) 1983-05-05 1998-10-13 Hill; Hugh Allen Oliver Strip electrode with screen printing
EP0127958B1 (en) 1983-05-05 1992-03-11 MediSense, Inc. Sensor electrode systems
EP0127958B2 (en) 1983-05-05 1996-04-10 MediSense, Inc. Sensor electrode systems
EP0351891A3 (en) 1983-05-05 1990-09-26 Medisense, Inc. Printed electrodes
EP0351891A2 (en) 1983-05-05 1990-01-24 MediSense, Inc. Printed electrodes
US4837331A (en) 1983-05-30 1989-06-06 Wako-Pure Chemical Industries, Ltd. Stabilization of tetrazolium salts with cyclodextrins
US5509410A (en) 1983-06-06 1996-04-23 Medisense, Inc. Strip electrode including screen printing of a single layer
EP0186643B1 (en) 1984-11-23 1989-09-13 Région Wallonne représentée par l'Exécutif Régional Wallon Method for the production of vector plasmids capable of transforming an Escherichia coli host bacterium and to promote and control the expression of heterologous DNA
EP0186643A1 (en) 1984-11-23 1986-07-02 Région Wallonne représentée par l'Exécutif Régional Wallon Method for the production of vector plasmids capable of transforming an Escherichia coli host bacterium and to promote and control the expression of heterologous DNA
EP0189918A2 (en) 1985-01-29 1986-08-06 E.I. Du Pont De Nemours And Company Heat-fusion pipe fitting system
EP0189918B1 (en) 1985-01-29 1990-01-31 E.I. Du Pont De Nemours And Company Heat-fusion pipe fitting system
EP0189918A3 (en) 1985-01-29 1987-06-24 E.I. Du Pont De Nemours And Company Heat-fusion pipe fitting system
US4948729A (en) 1985-03-25 1990-08-14 Cetus Corporation Production of soluble recombinant proteins
EP0196864A3 (en) 1985-03-25 1988-03-23 Cetus Corporation Alkaline phosphatase-mediated processing and secretion of recombinant proteins, dna sequences for use therein and cells transformed using such sequences
EP0196864A2 (en) 1985-03-25 1986-10-08 Cetus Corporation Alkaline phosphatase-mediated processing and secretion of recombinant proteins, DNA sequences for use therein and cells transformed using such sequences
US4847195A (en) 1985-05-31 1989-07-11 Syntex (U.S.A.) Inc. Glucose-6-phosphate dehydrogenase conjugates useful in polyiodothyronine assays
US5013647A (en) 1986-04-04 1991-05-07 Boehringer Mannheim Gmbh Removal of interfering reducing substances with tetrazolium salts in redox measurement reactions
EP0239931B1 (en) 1986-04-04 1992-03-18 Roche Diagnostics GmbH Process and reagent for the determination of substrates or enzyme activities
EP0239931A2 (en) 1986-04-04 1987-10-07 Roche Diagnostics GmbH Process and reagent for the determination of substrates or enzyme activities
EP0239931A3 (en) 1986-04-04 1988-05-18 Boehringer Mannheim Gmbh Process and reagent for the determination of substrates or enzyme activities
US5196314A (en) 1986-04-04 1993-03-23 Boehringer Mannheim Gmbh Process and reagent for the determination of substrates or enzyme activities
US5030563A (en) 1987-07-07 1991-07-09 Genetics Institute, Inc. Bacterial hypersecretion using mutant repressor sequence
US6194200B1 (en) 1987-10-30 2001-02-27 Oncogen Expression systems for preparation of polypeptides in prokaryotic cells
WO1989003886A1 (en) 1987-10-30 1989-05-05 Oncogen, A Limited Partnership Expression systems for preparation of polypeptides in prokaryotic cells
US5120420B1 (en) 1988-03-31 1999-11-09 Matsushita Electric Industrial Co Ltd Biosensor and a process for preparation thereof
US5120420A (en) 1988-03-31 1992-06-09 Matsushita Electric Industrial Co., Ltd. Biosensor and a process for preparation thereof
US5885811A (en) 1988-07-05 1999-03-23 University Of Maryland Leader sequence inducing a post-translational modification of polypeptides in bacteria gene therefor and subtilin variant of enhanced stability and activity
US5914250A (en) 1988-07-05 1999-06-22 University Of Maryland Leader sequence inducing a post-translational modification of polypeptides in bacteria, gene therefor, and subtilin variant of enhanced stability and activity
US5137821A (en) 1988-12-29 1992-08-11 Toyo Jozo Company, Ltd. Gene and process of making glucose-6-phosphate dehydrogenase
WO1990012113A1 (en) 1989-04-13 1990-10-18 Enzymatics, Inc. The use of fluid insoluble oxidizing agents to eliminate interfering substances in oxidation-reduction measuring systems
US5171670A (en) 1989-05-12 1992-12-15 The General Hospital Corporation Recombinant dna method for production of parathyroid hormone
USRE37919E1 (en) 1989-05-12 2002-12-03 The General Hospital Corporation Recombinant DNA method for production of parathyroid hormone
US5312759A (en) 1989-12-20 1994-05-17 Iatron Laboratories, Inc. Method for measurement of fructosamines using 1,2-quinones
US5320732A (en) 1990-07-20 1994-06-14 Matsushita Electric Industrial Co., Ltd. Biosensor and measuring apparatus using the same
US5308770A (en) 1990-07-30 1994-05-03 Boehringer Mannheim Gmbh Cloning and overexpression of glucose-6-phosphate dehydrogenase from Leuconostoc dextranicus
US5229286A (en) 1990-07-30 1993-07-20 Boehringer Mannheim Gmbh Cloning and overexpression of glucose-6-phosphate dehydrogenase from leuconostoc dextranicus
US5244796A (en) 1990-10-12 1993-09-14 Syracuse University Cloned leuconostoc mesenteroides glucose-6-phosphate dehydrogenase genes and method of making glucose-6-phospate dehydrogenase
US5344770A (en) 1991-01-17 1994-09-06 Kao Corporation Bacillus SP. ferm BP-3376 and a method for its use to produce an alkaline proteinase K-16
WO1993006125A1 (en) 1991-09-20 1993-04-01 The United States Of America, Represented By The Secretary, Department Of Health And Human Services ISOLATION AND CHARACTERIZATION OF cDNA OF PLASMODIUM FALCIPARUM GLUCOSE-6-PHOSPHATE DEHYDROGENASE
US5385846A (en) * 1993-06-03 1995-01-31 Boehringer Mannheim Corporation Biosensor and method for hematocrit determination
US6329161B1 (en) 1993-12-02 2001-12-11 Therasense, Inc. Subcutaneous glucose electrode
US5789221A (en) 1994-03-03 1998-08-04 Kyogo Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase and process for producing the same
US5972671A (en) 1994-03-03 1999-10-26 Kyoto Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase and process for producing the same
US5681529A (en) 1994-08-25 1997-10-28 Nihon Medi-Physics Co., Ltd. Biological fluid analyzing device
US5712138A (en) 1994-10-05 1998-01-27 Kyoto Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase
US6451574B1 (en) 1995-03-09 2002-09-17 The Procter & Gamble Company Proteinase K variants having decreased adsorption and increased hydrolysis
US5824527A (en) 1995-04-11 1998-10-20 Kyoto Daiichi Kagaku Co., Ltd. Fructosyl amino acid oxidase and process for producing the same
US6008006A (en) 1995-05-05 1999-12-28 Genzyme Limited Et Al. Determination of glycated proteins
US5628890A (en) 1995-09-27 1997-05-13 Medisense, Inc. Electrochemical sensor
EP1542015A1 (en) 1995-10-16 2005-06-15 LXN Corporation Electrochemical determination of fructosamine
US5948665A (en) 1996-02-16 1999-09-07 Oriental Yeast Co. Ltd. Hexokinase obtained from thermophilic yeast Kluyveromyces fragilis
US5972294A (en) 1996-04-04 1999-10-26 Lifescan, Inc. Reagent test strip for determination of blood glucose
EP0821064A2 (en) 1996-07-23 1998-01-28 Kyoto Daiichi Kagaku Co., Ltd. Recombinant fructosyl amino acid oxidase
US5948659A (en) 1996-07-23 1999-09-07 Kyoto Daiichi Kagaku Co., Ltd. Recombinant fructosyl amino acid oxidase
EP0821064B1 (en) 1996-07-23 2003-04-02 Kyoto Daiichi Kagaku Co., Ltd. Recombinant fructosyl amino acid oxidase
EP0821064A3 (en) 1996-07-23 1999-03-10 Kyoto Daiichi Kagaku Co., Ltd. Recombinant fructosyl amino acid oxidase
US5710248A (en) 1996-07-29 1998-01-20 University Of Iowa Research Foundation Peptide tag for immunodetection and immunopurification
US5856104A (en) 1996-10-28 1999-01-05 Affymetrix, Inc. Polymorphisms in the glucose-6 phosphate dehydrogenase locus
US5879921A (en) 1996-11-07 1999-03-09 Novo Nordisk A/S Recombinant expression of a glucose oxidase from a cladosporium strain
US6069297A (en) 1996-12-09 2000-05-30 Sloan-Kettering Institute For Cancer Research Glucose-6-phosphate dehydrogenase deficient mice and methods of using same
US6127345A (en) 1997-01-21 2000-10-03 Smithkline Beecham Corporation Polynucleotides encoding the glucose 6-phosphate dehydrogenase of Streptococcus pneumoniae
US6143164A (en) 1997-02-06 2000-11-07 E. Heller & Company Small volume in vitro analyte sensor
US6127138A (en) 1997-04-24 2000-10-03 Kyoto Daiichi Kagaku Co., Ltd. Method of enzymatically measuring glycated protein
US5972745A (en) 1997-05-30 1999-10-26 International Business Machines Corporation Method or forming self-aligned halo-isolated wells
US5985591A (en) 1997-11-26 1999-11-16 Kyoto Daiichi Kagaku Co., Ltd. Method for the determination of glycosylated proteins
US6270637B1 (en) 1997-12-05 2001-08-07 Roche Diagnostics Corporation Electrochemical biosensor test strip
US6352835B1 (en) 1998-11-17 2002-03-05 Kyoto Daiichi Kagaku Co. Ltd. Method of measuring substance in sample using a redox reaction
US6514720B2 (en) * 1998-11-17 2003-02-04 Kyoto Daiichi Kagaku Co., Ltd. Method of measuring substance in sample using a redox reaction
US6380380B1 (en) 1999-01-04 2002-04-30 Specialty Assays, Inc. Use of nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucliotide phosphate (NADP) analogs to measure enzyme activities metabolites and substrates
EP1223224A1 (en) 1999-10-01 2002-07-17 Kikkoman Corporation Method of assaying glycoprotein
EP1223224B1 (en) 1999-10-01 2010-09-01 Kikkoman Corporation Method of assaying glycoprotein
US20020009779A1 (en) 2000-05-19 2002-01-24 Meyers Rachel A. 50365, a novel hexokinase family member and uses therefor
US20040171130A1 (en) 2000-06-21 2004-09-02 Haruhiko Yokoi Novel glucose-6-phosphate dehydrogenase
EP1304385A1 (en) 2000-07-14 2003-04-23 ARKRAY, Inc. Method of selectively determining glycated hemoglobin
US20030162242A1 (en) 2000-07-14 2003-08-28 Satoshi Yonehara Method of selectively determining glycated hemoglobin
US7235378B2 (en) 2000-07-14 2007-06-26 Arkray, Inc. Method of selectively determining glycated hemoglobin
US20040063213A1 (en) 2000-09-28 2004-04-01 Kaoru Hirai Assay method with the use of redox reaction
US20040166560A1 (en) 2001-02-09 2004-08-26 Rainer Mueller Expression of recombinant proteinase k <I> from tritirachium album </I>in yeast
US20070099283A1 (en) 2001-02-09 2007-05-03 Rainer Mueller Recombinant proteinase k
US20030032077A1 (en) * 2001-08-10 2003-02-13 Nipro Corporation Recording medium and blood glucose monitoring system using the recording medium
US20080176296A1 (en) 2001-11-13 2008-07-24 Oskar Zelder Gene Coding for Glucose-6-Phosphate-Dehydrogenase Proteins
US7276147B2 (en) 2001-11-16 2007-10-02 Roche Diagnostics Operations, Inc. Method for determining the concentration of an analyte in a liquid sample using small volume samples and fast test times
US7276146B2 (en) 2001-11-16 2007-10-02 Roche Diagnostics Operations, Inc. Electrodes, methods, apparatuses comprising micro-electrode arrays
US6863800B2 (en) 2002-02-01 2005-03-08 Abbott Laboratories Electrochemical biosensor strip for analysis of liquid samples
US20030211564A1 (en) * 2002-05-10 2003-11-13 Suyue Qian Multilayer reagent test strips and methods for using the same to quantify glycated protein in a physiological sample
US20050255453A1 (en) 2002-05-10 2005-11-17 Suyue Qian Multilayer reagent test strips and methods for using the same to quantify glycated protein in a physiological sample
CN1456680A (en) 2002-05-10 2003-11-19 生命扫描有限公司 Multi-layer reagent strips and method for measuring saccharfied protein in physiological samples
US7381539B2 (en) 2002-06-07 2008-06-03 Arkray, Inc. Method of assay by oxidation-reduction reaction with formazan
EP1614746A1 (en) 2003-03-17 2006-01-11 Koji Sode Fructosylamine oxidase
WO2005017136A1 (en) 2003-07-17 2005-02-24 General Atomics Methods and compositions for determination of glycated proteins
US20080241880A1 (en) 2003-07-17 2008-10-02 Chong-Sheng Yuan Methods and compositions for determination of glycated proteins
US7153666B2 (en) 2003-07-17 2006-12-26 General Atomics Methods and compositions for determination of glycated proteins
US20050014935A1 (en) 2003-07-17 2005-01-20 Chong-Sheng Yuan Methods and compositions for determination of glycated proteins
EP1651759B1 (en) 2003-07-17 2008-01-09 General Atomics Methods and compositions for determination of glycated proteins
WO2007094354A1 (en) 2006-02-14 2007-08-23 National Institute Of Advanced Industrial Science And Technology HEMOGLOBIN A1c SENSOR
US20110250627A1 (en) 2006-07-25 2011-10-13 General Atomics Methods for assaying percentage of glycated hemoglobin
US20080299597A1 (en) 2006-07-25 2008-12-04 Chong-Sheng Yuan Methods for assaying percentage of glycated hemoglobin
WO2008013874A1 (en) * 2006-07-25 2008-01-31 General Atomics Methods for assaying percentage of glycated hemoglobin
US7855079B2 (en) 2006-07-25 2010-12-21 General Atomics Methods for assaying percentage of glycated hemoglobin
US7943385B2 (en) 2006-07-25 2011-05-17 General Atomics Methods for assaying percentage of glycated hemoglobin
US20110189712A1 (en) 2006-07-25 2011-08-04 General Atomics Methods for assaying percentage of glycated hemoglobin
US20080096230A1 (en) * 2006-07-25 2008-04-24 Chong-Sheng Yuan Methods for assaying percentage of glycated hemoglobin
US8318501B2 (en) 2006-07-25 2012-11-27 General Atomics Methods for assaying percentage of glycated hemoglobin
US8338184B2 (en) 2006-07-25 2012-12-25 General Atomics Methods for assaying percentage of glycated hemoglobin
US20090090623A1 (en) 2007-05-21 2009-04-09 Delta Electronics, Inc. Biosensor having integrated heating element and electrode with metallic catalyst
WO2009140343A1 (en) 2008-05-13 2009-11-19 General Atomics Electrochemical biosensor for direct determination of percentage of glycated hemoglobin

Non-Patent Citations (109)

* Cited by examiner, † Cited by third party
Title
Allgrove, J. et al. (1988). Fructosamine or Glycated Haemoglobin as a Measure of Diabetic Control? Archives of Disease in Childhood 63:418-422.
Amendment After Final Action mailed on Jun. 22, 2006, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 12 pages.
Amendment in Response to Non-Final Office Action mailed on Nov. 25, 2005, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 25 pages.
Amendment in Response to Non-Final Office Action submitted on Feb. 19, 2010, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 16 pages.
Amendment in Response to Non-Final Office Action submitted on Jul. 19, 2010, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 10 pages.
Amendment in Response to Non-Final Office Action submitted on Nov. 4, 2010, for U.S. Appl. No. 12/120,122, filed May 13, 2008, 9 pages.
Anonymous. (1972). "IUPAC-IUB Commission on Biochemical Nomenclature Symbols for Amino-Acid Derivatives and Peptides Recommendations (1971)," Biochemistry 11(9):1726-1732.
Armbuster, D.A. (1987). "Frutosamine: Structure, Analysis, and Clinical Usefulness," Clin. Chem. 33(12):2153-2163.
Baker, J. et al. (1991). "Fructosamine Test-Plus, a Modified Fructosamine Assay Evaluated," Clin. Chem. 37(4):552-556.
Bastin, P. et al. (1996). "A Novel Epitope Tag System to Study Protein Targeting and Organelle Biogenesis in Trypanosoma brucei," Mol. Biochem. Parasitology 77:235-239.
Baynes, J.W. et al. eds. (1989). "The Maillard Reaction in Aging, Diabetes, and Nutrition," Progress in Clinical and Biological Resaerch, Alan R. Liss, Inc.: New York, NY, vol. 304, pp. vii-ix, (Table of Contents Only.).
Branden, C. et al. (1991). "Prediction, Engineering, and Design of Protein Structures," in Chapter 16 in Introduction to Protein Structure, Garland Publishing Inc.: New York, NY, pp. 247.
Chen, C-F. et al. (Jul. 1998). "Expression Vector Containing an N-Terminal Epitope Tag for Dictyostelium discoideum," BioTechniques 25(1):22-24.
Communication Pursuant to Article 96(2) EPC, mailed on Aug. 29, 2006, for EP Application No. 04 778 420.2-1222, filed on Jul. 16, 2004, 3 pages.
Communication under Rule 51(4) EPC, mailed on May 31, 2007,for EP Application No. 04 778 420.2-1222, filed on Jul. 16, 2004, 5 pages.
Diazyme (Date Unknown). "Fructosyl Amino Acid Oxidoreductase (Recombinant)," Laboratories Division, General Atomics, FAOX-TE Fact Sheet, pp. 71-74.
Entry into the European Phase, filed Feb. 17, 2006, for EP Application No. 04 778 420.2-1222, 18 pages.
Fang, L. et al. (Feb. 22, 2008, e-pub. Sep. 9, 2007). "An Electrochemical Biosensor of the Ketone 3-beta-hydroxybutyrate for Potential Diabetic Patient Management," Sensors and Actuators B: Chemical 129(2):818-825.
Fang, L. et al. (Feb. 22, 2008, e-pub. Sep. 9, 2007). "An Electrochemical Biosensor of the Ketone 3-β-hydroxybutyrate for Potential Diabetic Patient Management," Sensors and Actuators B: Chemical 129(2):818-825.
Final Office Action mailed on Feb. 23, 2006, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 10 pages.
Fossati, P. et al. (Feb. 1980). "Use of 3,5-Dichloro-2-hydroxybenzensulfonic Acid/ 4-Aminophenazone Chromogenic System in Direct Enzymic Assay of Uric Acid in Serum Urine," Clin. Chem. 26(2):227-231.
Frederick, K.R. et al. (Mar. 5, 1990). "Glucose Oxidase from Aspergillus niger," J. Biol. Chem. 265(7):3793-3802.
Freedictonary.com (Date Unknown). "Glycosylated Hemoglobin," located at , last visited on Nov. 4, 2010, 3 pages.
Freedictonary.com (Date Unknown). "Glycosylated Hemoglobin," located at <http://medical-dictionary.thefreedictionary.com/Hba1c>, last visited on Nov. 4, 2010, 3 pages.
GenBank Database Accession No. U82830, last updated May 15, 1997, located at <<http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=1769599>>, last visited on Aug. 20, 2007, two pages.
GenBank Database Accession No. U82830, last updated May 15, 1997, located at >, last visited on Aug. 20, 2007, two pages.
Gerhardingerm, C. et al. (Jan. 6, 1995). "Novel Degradation Pathway of Glycated Amino Acids into Free Fructosamine by a Pseudommonas sp. Soil Strain Extract," The Journal of Biological Chemistry 270(1):218-224.
Hardy, S.J.S. et al. (1989). "Biochemical Investigation of Protein Export in Escherichia coli," J. Cell. Sci. Suppl. 11:29-43.
Hobom, G. et al. (1995). "OmpA Fusion Proteins for Presentation of Foreign Antigens on the Bacterial Outer Membrane," Dev. Biol. Stand. 84:255-262.
International Preliminary Report on Patentability issued on Jan. 23, 2006, for PCT Patent Application No. PCT/US2004/022908, filed on Jul. 16, 2004, 6 pages.
International Preliminary Report on Patentability issued on Nov. 17, 2010, for PCT Patent Application No. PCT/US2009/043725, filed on May 13, 2009, 8 pages.
International Search Report mailed on Jan. 26, 2005, for PCT Patent Application No. PCT/US2004/022908, filed on Jul. 16, 2004, 5 pages.
International Search Report mailed on Nov. 20, 2007, for PCT Application No. PCT/US2007/016774, filed on Jul. 25, 2007, 3 pages.
International Search Report mailed on Nov. 4, 2009, for PCT Patent Application No. PCT/US2009/043725, filed on May 13, 2009, 2 pages.
INVITROGEN (2002). "pBAD TOPO TA Expression Kit," p. 75.
Kouzuma, T. et al. (2002). "An Enzymatic Method for the Measurement of Glycated Albumin in Biological Samples," Clin. Chimi. Acta. 324:61-71.
Kühn, S. et al. (1979). "Close Vicinity of IS1 Integration Sites in the Leader Sequence of the gal Operon of E. coli," Mol. Gen. Genet. 167(3):235-241.
Luo, Y-C. et al. (2006, e-pub Sep. 5, 2006). "An Amperometric Uric Acid Biosensor Based on Modified Ir-C Electrode," Biosensors and Bioelectronics 22:482-488.
Michiels, J. et al. (Apr. 2001). "Processing and Export of Peptide Pheromones and Bacteriocins Gram-Negative Bacteria," Trends Microbiol. 9(4):164-168.
Nagata, R. et al. (1995). "A Glucose Sensor Fabricated by the Screen Printing Technique," Biosens. Bioelectron. 10(3-4):261-267.
Nagelkerken, B. et al. (1997). "A Novel Epitope Tag for the Detection of rabGTPases," Electrophoresis 18:2694-2698.
Non-Final Office Action for U.S. Appl. No. 12/944,586, mailed Nov. 25, 2011, 17 pages.
Non-Final Office Action mailed on Aug. 4, 2010, for U.S. Appl. No. 12/120,122, filed May 13, 2008, 12 pages.
Non-Final Office Action mailed on Jul. 22, 2005, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 15 pages.
Non-Final Office Action mailed on May 15, 2009, for U.S. Appl. No. 11/595,209, filed Nov. 8, 2006, 12 pages.
Non-Final Office Action mailed on May 27, 2010, or U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 13 pages.
Non-Final Office Action mailed on Nov. 19, 2009, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 16 pages.
Notice of Allowance and Examiner's Amendment mailed on Aug. 10, 2006, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 8 pages.
Notice of Allowance for U.S. Appl. No. 12/944,586, mailed Mar. 9, 2012, 8 pages.
Notice of Allowance for U.S. Appl. No. 12/944,586, mailed Oct. 1, 2012, 5 pages.
Notice of Allowance for U.S. Appl. No. 13/083,357, mailed Oct. 9, 2012, 5 pages.
Notice of Allowance for U.S. Appl. No. 13/673,932, mailed Jun. 6, 2013.
Notice of Allowance mailed on Aug. 11, 2010, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 4 pages.
Notice of Grant of Invention (with translation) for CN 200780023123.5, issued Aug. 20, 2013, 4 pages.
Notice of Reasons for Rejection (translation) for JP 2009-521827, mailed Mar. 15, 2013.
Office Action for U.S. Appl. No. 13/673,932, mailed Jan. 9, 2013.
Oláh, Z. et al. (1994). "A Cloning and epsilon-Epitope-Tagging Insert for the Expression of Polymerase Chain Reaction-Generated cDNA Fragments in Escherichia coli and Mammalian Cells," Analyt. Biochem. 221:94-102.
Oláh, Z. et al. (1994). "A Cloning and ε-Epitope-Tagging Insert for the Expression of Polymerase Chain Reaction-Generated cDNA Fragments in Escherichia coli and Mammalian Cells," Analyt. Biochem. 221:94-102.
Peakman, T.C. et al. (1992). "Enhanced Expression of Recombinant Proteins in Insect Cells Using a Baculovirus Vector Containing a Bacterial Leader Sequence," Nucleic Acids Res. 20(22):6111-6112.
Phillipou , G. et al. (1988). "Re-Evaluation of the Fructosamine Reaction," Clin. Chem. 34(8):1561-164.
Prickett, K.S. et al. (1989). "A Calcium-Dependent Antibody for Identification and Purification of Recombinant Proteins," BioTechniques 7(6):580-584.
Response to European Office Action, filed Mar. 7, 2007, for EP Application No. 04 778 420.2-1222, filed on Jul. 16, 2004, 36 pages.
Response to Non-Final Office Action for U.S. Appl. No. 12/944,586, filed Feb. 27, 2012, 17 pages.
Response to Non-Final Office Action for U.S. Appl. No. 13/673,932, filed May 9, 2013, 11 pages.
Response to Office Action for CN 200980123476.1, filed Sep. 23, 2013, 3 pages.
Response to Restriction Requirement mailed on May 18, 2005, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 2 pages.
Response to Restriction Requirement submitted on Jul. 10, 2009, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 7 pages.
Response to Restriction Requirement submitted on Jul. 15, 2010, for U.S. Appl. No. 12/120,122, filed May 13, 2008, 6 pages.
Restriction Requirement mailed on Apr. 14, 2005, for U.S. Appl. No. 10/622,893, filed Jul. 17, 2003, 4 pages.
Restriction Requirement mailed on Jun. 12, 2009, for U.S. Appl. No. 11/881,179, filed Jul. 25, 2007, 7 pages.
Restriction Requirement mailed on Jun. 18, 2010, for U.S. Appl. No. 12/120,122, filed May 13, 2008, 7 pages.
Roesser, J.R. et al. (1991). "The Effects of Leader Peptide Sequence and Length on Attenuation Control of the trp Operon of E. coli," Nucleic Acids Res. 19(4):795-800.
Rosen-Margalit, I. et al. (1993). "Novel Approaches for the Use of Mediators in Enzyme Electrodes," Biosens. Bioelectron. 8(6):315-323.
Rüdiger, M. et al. (Jul. 1997). "Epitope Tag-Antibody Combination Useful for the Detection of Protein Expression in Prokaryotic and Eukaryotic Cells," BioTechniques 23(1):96-97.
Saier, M.H. et al. (1988). "Sugar Premeases of the Bacterial Phophoenolpyruvate-Dependent Phosphotransferase System: Sequence Comparisons," FASEB J. 2(3):199-208.
Sakaguchi, A. et al. (Jun. 1, 2003). "Development of Highly-Sensitive Fructosyl-Valine Enzyme Sensor Employing Recombinant Fructosyl Amine Oxidase," Electrochemisty 71(6):442-445.
Sakai, Y. et al. (1995). "Purification and Properties of Fructsyl Lysince Oxidase from Fusarium oxysporum S-1F4," Biosci. Biotech. Biochem. 59(3):487-491.
Sakurabayashi, I. et al. (2003). "New Enzymatic Assay for Glycohemoglobin," Clinical Chemistry 49(2):269-274.
Schleicher, E.D. et al. (1988). "Is Serum Fructosamine Assay Specific for Determination of Glycated Serum Protein?" Clin. Chem. 34(2):320-323.
Second Office Action (with English translation) for CN 200780023123.5, issued Oct. 19, 2012, 14 pages.
Seffernick, J.L. et al. (Apr. 2001). "Melamine Deaminase and Atrazine Chlorohydrolase: 98 Percent Identical but Functionally Different," J. Bacteriol. 183(8):2405-2410.
Shaklai, N. et al. (Mar. 25, 1984). "Noenzymatic Glycosylation of Human Serum Albumin Alters Its Conformation and Function," The Journal of Biological Chemistry 259(6):3812-3817.
Sigma-Aldrich (2002). "Product No. 82452," located at , last visited on Mar. 2, 2004, 1 page.
Sigma-Aldrich (2002). "Product No. 82452," located at <https://www.sigmaaldrich.com/cgi-bin/hsrun/Suite7/Suite/HAHTpage/Suite.HsViewHierarc . . . >, last visited on Mar. 2, 2004, 1 page.
Takahashi, M. et al. (Feb. 7, 1997). "Isolation, Purification, and Characterization of Amadoriase Isoenzymes (Fructosyl Amine-Oxygen Oxidoreductase EC 1.5.3) from Aspergillus sp.," J. Biol. Chem. 272(6):3437-3443.
Takahashi, M. et al. (May 9, 1997). "Molecular Cloning and Expression of Amadoriase Isoenzyme (Fructosyl Amine:Oxygen Oxidoreductase, EC 1.5.3) from Aspergillus fumigatus," J. Biol. Chem. 272(19):12505-12507.
The 3rd Office Action (translation) for CN 200780023123.5, mailed Feb. 28, 2013.
The Fourth Office Action (including translation) for CN 200780023123.5, mailed Jun. 18, 2013, 6 pages.
The Second Office Action (including translation) for CN 200980123476.1, mailed Jul. 9, 2013, 13 pages.
Tolbert, L.M. et al. (1998). "Antibody to Eptiope Tag Induces Internalization of Human Muscarinic Subtype 1 Receptor," J. Neurochem. 70(1):113-119.
Tseng, C-P. et al. (1996). "Functional Expression and Characerization of the Mouse Epitope Tag-Protein Kinase C Isoforms, alpha,betaI, betaII, gamma, delta, and epsilon," Gene 169:287-288.
Tseng, C-P. et al. (1996). "Functional Expression and Characerization of the Mouse Epitope Tag-Protein Kinase C Isoforms, α,βI, βII, γ, δ, and ε," Gene 169:287-288.
Tsugawa, W. et al. (Dec. 1, 2001). "Fructosyl Amine Sensing Based on Prussian Blue Modified Enzyme Electrode," Electrochemistry 69(12):973-975.
Wang, J. (2008, e-pub Dec. 23, 2007). "Electrochemical Glucose Biosensors," Chem. Rev. 108(2):814-825.
Wang, J. et al. (Nov. 1, 1994). "Highly Selective Membrane-Free, Mediator-Free Glucose Biosensor," Anal. Chem. 66(21):3600-3603.
Wang, L-F. et al. (1996). "BTag: A Novel Six-Residue Epitope Tag for Surveillance and Purification of Recombinant Proteins," Gene 169(1):53-58.
Watson, J.D. et al. (1987). Molecular Biology of the Gene, 4th Edition, The Benjamin/Cummings Publishing Company, Inc. pp. 224-225.
Witkowski, A. et al. (1999, e-pub. Aug. 18, 1999). "Conversion of a beta-Ketoacyl Snythase to a Malonyl Decarboxylase by Replacement of the Active-Site Cysteine with Glutamine," Biochemistry 38(36):11643-11650.
Witkowski, A. et al. (1999, e-pub. Aug. 18, 1999). "Conversion of a β-Ketoacyl Snythase to a Malonyl Decarboxylase by Replacement of the Active-Site Cysteine with Glutamine," Biochemistry 38(36):11643-11650.
Worthington-Biochem. (Date Unknown). "Proteinase K," located at , last visited on Mar. 2, 2004, 4 pages.
Worthington-Biochem. (Date Unknown). "Proteinase K," located at <http://worthington-biochem.com/PROK.html>, last visited on Mar. 2, 2004, 4 pages.
Written Opinion of the International Searching Authority mailed on Jan. 23, 2006, for PCT Patent Application No. PCT/US2004/022908, filed on Jul. 16, 2004, 5 pages.
Written Opinion of the International Searching Authority mailed on Nov. 20, 2007, for PCT Application No. PCT/US2007/016774, filed Jul. 25, 2007, 6 pages.
Written Opinion of the International Searching Authority mailed on Nov. 4, 2009, for PCT Patent Application No. PCT/US2009/043725, filed on May 13, 2009, 6 pages.
Wu, X. (2000, e-pub. Jan. 19, 2000). "Cloning of Amadoriase I Isoenzyme from Aspergillus sp.: Evidence of FAD Covalently Linked to Cys342," Biochemistry 39(6):1515-1521.
Wu, X. et al. (2003). "Enzymatic Deglycation of Proteins," Archives of Biochemistry and Biophysics 419:16-24.
Xie, L.Y. et al. (1998). "Epitope Tag Mapping of the Extracellular and Cytoplasmic Domains of the Rat Parathyroid Hormone (PTH)/PTH-Related Peptide Receptor," Endocrinology 139(11):4563-4567.
Yoshida, N. et al. (1996). "Primary Structure of Fungal Fructosyl Amino Acids Oxidaeses and their Application to the Measurement of Glycated Proteins," European Journal of Biochemistry 242(3):499-505.
Yoshida, N. et al. (Dec. 1995). "Distribution and Properties of Fructosyl Amino Acid Oxidase in Fungi," Applied and Environmental Microbiology 61(12):4487-4489.

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019103948A1 (en) 2017-11-22 2019-05-31 Jim Connolly Method of analysis of undiluted whole blood samples with an electrochemical biosensor
US11079351B2 (en) 2017-11-22 2021-08-03 Jim Connolly Active enzyme protection system for an electrochemical biosensor
US11199551B1 (en) 2017-11-22 2021-12-14 Jim Connolly Test sensors, systems, and analysis techniques for measuring glycated hemoglobin in undiluted blood samples
US12044649B2 (en) 2017-11-22 2024-07-23 Jim Connolly Multi-zone, fixed potential test sensor heating system method
US12196764B2 (en) 2017-11-22 2025-01-14 Jim Connolly Analysis techniques for measuring glycated hemoglobin in undiluted blood samples
EP3887398A4 (en) * 2018-11-29 2022-10-19 Polymer Technology Systems, Inc. SYSTEMS AND METHODS OF ELECTROCHEMICAL POINT OF HEMOGLOBIN DETECTION
US11693016B2 (en) 2018-11-29 2023-07-04 Polymer Technology Systems, Inc. Systems and methods for electrochemical point-of-care detection of hemoglobin
US12174202B2 (en) 2018-11-29 2024-12-24 Polymer Technology Systems, Inc. Systems and methods for electrochemical point-of-care detection of hemoglobin
KR20220006979A (en) * 2020-07-09 2022-01-18 동우 화인켐 주식회사 Biosensor
KR102481839B1 (en) 2020-07-09 2022-12-28 동우 화인켐 주식회사 Biosensor
EP4459273A1 (en) * 2023-05-03 2024-11-06 Vilnius University A method for obtaining an enzyme electrode with a membrane for detection and quantification of l-amino acids and enzyme electrode with a membrane for detection and quantification of l-amino acids

Also Published As

Publication number Publication date
EP2283149A1 (en) 2011-02-16
US20100025264A1 (en) 2010-02-04
CN102076867A (en) 2011-05-25
WO2009140343A1 (en) 2009-11-19

Similar Documents

Publication Publication Date Title
US20100025264A1 (en) Electrochemical biosensor for direct determination of percentage of glycated hemoglobin
US8721853B2 (en) Fructosyl peptidyl oxidase
EP2044444B1 (en) Methods for assaying percentage of glycated hemoglobin
EP2462223B1 (en) Fructosyl amino acid oxidase
JP5927771B2 (en) Method for measuring hemoglobin A1c
US7943385B2 (en) Methods for assaying percentage of glycated hemoglobin
US20240035065A1 (en) Method for measurement in biosensors
EP1542015A1 (en) Electrochemical determination of fructosamine
JPWO2007094354A1 (en) Hemoglobin A1c sensor
JP2011224025A (en) Method and composition for determination of glycated protein
Takamatsu et al. Transient potentiometry based d-serine sensor using engineered d-amino acid oxidase showing quasi-direct electron transfer property
EP3786291B1 (en) Amadoriase having enhanced dehydrogenase activity
EP3447132B1 (en) Hba1c dehydrogenase
HK1172930B (en) Fructosyl peptidyl oxidase and sensor for assaying a glycated protein

Legal Events

Date Code Title Description
AS Assignment

Owner name: GENERAL ATOMICS,CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:YUAN, CHONG-SHENG;DATTA, ABHIJIT;LIU, LIMIN;AND OTHERS;SIGNING DATES FROM 20100104 TO 20100303;REEL/FRAME:024133/0100

Owner name: GENERAL ATOMICS, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:YUAN, CHONG-SHENG;DATTA, ABHIJIT;LIU, LIMIN;AND OTHERS;SIGNING DATES FROM 20100104 TO 20100303;REEL/FRAME:024133/0100

AS Assignment

Owner name: GENERAL ATOMICS, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:BLUE, NEAL K.;REEL/FRAME:025590/0329

Effective date: 20101012

AS Assignment

Owner name: DIAZYME LABORATORIES, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:GENERAL ATOMICS;REEL/FRAME:041921/0822

Effective date: 20170101

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.)

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.)

STCH Information on status: patent discontinuation

Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362

FP Lapsed due to failure to pay maintenance fee

Effective date: 20180318