US20240010703A1 - Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases - Google Patents
Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases Download PDFInfo
- Publication number
- US20240010703A1 US20240010703A1 US18/453,985 US202318453985A US2024010703A1 US 20240010703 A1 US20240010703 A1 US 20240010703A1 US 202318453985 A US202318453985 A US 202318453985A US 2024010703 A1 US2024010703 A1 US 2024010703A1
- Authority
- US
- United States
- Prior art keywords
- seq
- domain
- amino acid
- acid sequence
- car
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims abstract description 156
- 210000003289 regulatory T cell Anatomy 0.000 title claims abstract description 129
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 title description 5
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 title description 5
- 210000002744 extracellular matrix Anatomy 0.000 title description 5
- 230000008685 targeting Effects 0.000 title description 5
- 208000023275 Autoimmune disease Diseases 0.000 title description 4
- 210000004027 cell Anatomy 0.000 claims abstract description 158
- 230000027455 binding Effects 0.000 claims abstract description 114
- 239000000427 antigen Substances 0.000 claims abstract description 105
- 108091007433 antigens Proteins 0.000 claims abstract description 105
- 102000036639 antigens Human genes 0.000 claims abstract description 105
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 70
- 206010039073 rheumatoid arthritis Diseases 0.000 claims abstract description 54
- 102000013127 Vimentin Human genes 0.000 claims abstract description 26
- 108010065472 Vimentin Proteins 0.000 claims abstract description 26
- 210000005048 vimentin Anatomy 0.000 claims abstract description 26
- 102000008946 Fibrinogen Human genes 0.000 claims abstract description 20
- 108010049003 Fibrinogen Proteins 0.000 claims abstract description 20
- 229940012952 fibrinogen Drugs 0.000 claims abstract description 20
- 102100028314 Filaggrin Human genes 0.000 claims abstract description 12
- 101710088660 Filaggrin Proteins 0.000 claims abstract description 12
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 112
- 238000000034 method Methods 0.000 claims description 54
- 239000012634 fragment Substances 0.000 claims description 26
- 239000008194 pharmaceutical composition Substances 0.000 claims description 23
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 19
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 19
- 239000011324 bead Substances 0.000 claims description 17
- 238000001990 intravenous administration Methods 0.000 claims description 13
- 239000013604 expression vector Substances 0.000 claims description 11
- 239000003814 drug Substances 0.000 claims description 8
- 239000003937 drug carrier Substances 0.000 claims description 8
- 239000013603 viral vector Substances 0.000 claims description 8
- 229940121363 anti-inflammatory agent Drugs 0.000 claims description 7
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 7
- 230000004068 intracellular signaling Effects 0.000 claims description 7
- 229940124597 therapeutic agent Drugs 0.000 claims description 6
- 239000012472 biological sample Substances 0.000 claims description 5
- 238000001890 transfection Methods 0.000 claims description 4
- 241001515965 unidentified phage Species 0.000 claims description 4
- 230000003110 anti-inflammatory effect Effects 0.000 claims description 3
- 239000001506 calcium phosphate Substances 0.000 claims description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 claims description 2
- 235000011010 calcium phosphates Nutrition 0.000 claims description 2
- 238000004520 electroporation Methods 0.000 claims description 2
- 230000035939 shock Effects 0.000 claims description 2
- 238000000527 sonication Methods 0.000 claims description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 claims description 2
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 73
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 63
- 229920001184 polypeptide Polymers 0.000 abstract description 56
- 238000011282 treatment Methods 0.000 abstract description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 9
- 201000010099 disease Diseases 0.000 abstract description 7
- 210000001258 synovial membrane Anatomy 0.000 abstract description 6
- 150000007523 nucleic acids Chemical class 0.000 description 83
- 102000039446 nucleic acids Human genes 0.000 description 71
- 108020004707 nucleic acids Proteins 0.000 description 71
- 239000000203 mixture Substances 0.000 description 43
- 210000001179 synovial fluid Anatomy 0.000 description 31
- 150000001413 amino acids Chemical class 0.000 description 28
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 26
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 26
- 108090000623 proteins and genes Proteins 0.000 description 26
- 230000004044 response Effects 0.000 description 25
- 239000002773 nucleotide Substances 0.000 description 24
- 125000003729 nucleotide group Chemical group 0.000 description 24
- 102000004169 proteins and genes Human genes 0.000 description 23
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 22
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 22
- 230000004913 activation Effects 0.000 description 21
- 230000019491 signal transduction Effects 0.000 description 20
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 19
- 235000018102 proteins Nutrition 0.000 description 19
- 235000014966 Eragrostis abyssinica Nutrition 0.000 description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 description 15
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 15
- 108091033319 polynucleotide Proteins 0.000 description 15
- 102000040430 polynucleotide Human genes 0.000 description 15
- 239000002157 polynucleotide Substances 0.000 description 15
- 239000013598 vector Substances 0.000 description 15
- 230000035755 proliferation Effects 0.000 description 14
- 241000894007 species Species 0.000 description 14
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 13
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 13
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 13
- 239000000872 buffer Substances 0.000 description 13
- 238000000684 flow cytometry Methods 0.000 description 13
- 108010076504 Protein Sorting Signals Proteins 0.000 description 12
- 239000002158 endotoxin Substances 0.000 description 12
- 229920006008 lipopolysaccharide Polymers 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 241000699670 Mus sp. Species 0.000 description 11
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 11
- 230000000694 effects Effects 0.000 description 11
- 210000002540 macrophage Anatomy 0.000 description 11
- 239000002953 phosphate buffered saline Substances 0.000 description 11
- 210000000130 stem cell Anatomy 0.000 description 11
- 101710117290 Aldo-keto reductase family 1 member C4 Proteins 0.000 description 10
- 239000005089 Luciferase Substances 0.000 description 10
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 10
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 10
- 210000004443 dendritic cell Anatomy 0.000 description 10
- 210000001616 monocyte Anatomy 0.000 description 10
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 10
- 230000011664 signaling Effects 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- 101000835093 Homo sapiens Transferrin receptor protein 1 Proteins 0.000 description 9
- 206010035664 Pneumonia Diseases 0.000 description 9
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 9
- 210000003651 basophil Anatomy 0.000 description 9
- 210000003979 eosinophil Anatomy 0.000 description 9
- 210000003714 granulocyte Anatomy 0.000 description 9
- 210000002443 helper t lymphocyte Anatomy 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 210000003593 megakaryocyte Anatomy 0.000 description 9
- 210000000440 neutrophil Anatomy 0.000 description 9
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 8
- 102000001301 EGF receptor Human genes 0.000 description 8
- 108060006698 EGF receptor Proteins 0.000 description 8
- 206010034016 Paronychia Diseases 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 238000009396 hybridization Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 238000002955 isolation Methods 0.000 description 8
- 210000004072 lung Anatomy 0.000 description 8
- 235000002639 sodium chloride Nutrition 0.000 description 8
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 8
- -1 5 or 6 Chemical class 0.000 description 7
- 108060003951 Immunoglobulin Proteins 0.000 description 7
- 108091006007 citrullinated proteins Proteins 0.000 description 7
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 7
- 102000018358 immunoglobulin Human genes 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 238000010361 transduction Methods 0.000 description 7
- 230000026683 transduction Effects 0.000 description 7
- 108060001084 Luciferase Proteins 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 108010087819 Fc receptors Proteins 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 5
- 101000735558 Homo sapiens Protein-arginine deiminase type-2 Proteins 0.000 description 5
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 5
- 108010073807 IgG Receptors Proteins 0.000 description 5
- 102000007327 Protamines Human genes 0.000 description 5
- 108010007568 Protamines Proteins 0.000 description 5
- 102100035735 Protein-arginine deiminase type-2 Human genes 0.000 description 5
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 238000010172 mouse model Methods 0.000 description 5
- 229950008679 protamine sulfate Drugs 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 230000035899 viability Effects 0.000 description 5
- VDABVNMGKGUPEY-UHFFFAOYSA-N 6-carboxyfluorescein succinimidyl ester Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O VDABVNMGKGUPEY-UHFFFAOYSA-N 0.000 description 4
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 4
- 239000012979 RPMI medium Substances 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 4
- 230000004075 alteration Effects 0.000 description 4
- 239000005557 antagonist Substances 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 150000005829 chemical entities Chemical class 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 4
- 238000000432 density-gradient centrifugation Methods 0.000 description 4
- 239000003797 essential amino acid Substances 0.000 description 4
- 235000020776 essential amino acid Nutrition 0.000 description 4
- 239000012997 ficoll-paque Substances 0.000 description 4
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000002062 proliferating effect Effects 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 229940054269 sodium pyruvate Drugs 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 102100027207 CD27 antigen Human genes 0.000 description 3
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 3
- 229940045513 CTLA4 antagonist Drugs 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 3
- 102000009490 IgG Receptors Human genes 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108010033276 Peptide Fragments Proteins 0.000 description 3
- 102000007079 Peptide Fragments Human genes 0.000 description 3
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 3
- 102000007000 Tenascin Human genes 0.000 description 3
- 108010008125 Tenascin Proteins 0.000 description 3
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 3
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 238000011467 adoptive cell therapy Methods 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 239000008297 liquid dosage form Substances 0.000 description 3
- 238000004020 luminiscence type Methods 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 230000000770 proinflammatory effect Effects 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 229910001415 sodium ion Inorganic materials 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 230000001629 suppression Effects 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 3
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 229930024421 Adenine Natural products 0.000 description 2
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 206010051728 Bone erosion Diseases 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 206010007710 Cartilage injury Diseases 0.000 description 2
- 102100030801 Elongation factor 1-alpha 1 Human genes 0.000 description 2
- 108010089524 Fc(delta) receptor Proteins 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 101000920078 Homo sapiens Elongation factor 1-alpha 1 Proteins 0.000 description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 2
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 2
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 2
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 108010073816 IgE Receptors Proteins 0.000 description 2
- 102000003777 Interleukin-1 beta Human genes 0.000 description 2
- 108090000193 Interleukin-1 beta Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 2
- 102000002689 Toll-like receptor Human genes 0.000 description 2
- 108020000411 Toll-like receptor Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 241000711975 Vesicular stomatitis virus Species 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 229960000643 adenine Drugs 0.000 description 2
- 230000000735 allogeneic effect Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000008365 aqueous carrier Substances 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000005138 cryopreservation Methods 0.000 description 2
- 229940104302 cytosine Drugs 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 108010075597 immunoglobulin M receptor Proteins 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000003607 modifier Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000003643 myeloid progenitor cell Anatomy 0.000 description 2
- 230000036963 noncompetitive effect Effects 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 108091005626 post-translationally modified proteins Proteins 0.000 description 2
- 102000035123 post-translationally modified proteins Human genes 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 230000000284 resting effect Effects 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- IOSNMHVIOAOZTL-UHFFFAOYSA-N 2-[[4-carboxy-4-[[4-[(2,4-diaminopteridin-6-yl)methyl-methylamino]benzoyl]amino]-2-fluorobutanoyl]amino]pentanedioic acid Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)NC(CC(F)C(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C=C1 IOSNMHVIOAOZTL-UHFFFAOYSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 101100450694 Arabidopsis thaliana HFR1 gene Proteins 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108020004638 Circular DNA Proteins 0.000 description 1
- 108091033380 Coding strand Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102400001368 Epidermal growth factor Human genes 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101000988802 Homo sapiens Hematopoietic prostaglandin D synthase Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 description 1
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010029379 Neutrophilia Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010038036 Receptor Activator of Nuclear Factor-kappa B Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000239226 Scorpiones Species 0.000 description 1
- 241000713877 Simian sarcoma-associated virus Species 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 1
- 102100028787 Tumor necrosis factor receptor superfamily member 11A Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102000007624 ZAP-70 Protein-Tyrosine Kinase Human genes 0.000 description 1
- 108010046882 ZAP-70 Protein-Tyrosine Kinase Proteins 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- SAZUGELZHZOXHB-UHFFFAOYSA-N acecarbromal Chemical group CCC(Br)(CC)C(=O)NC(=O)NC(C)=O SAZUGELZHZOXHB-UHFFFAOYSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000010398 acute inflammatory response Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000012631 diagnostic technique Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000008151 electrolyte solution Substances 0.000 description 1
- 229940021013 electrolyte solution Drugs 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 210000002360 granulocyte-macrophage progenitor cell Anatomy 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 102000054751 human RUNX1T1 Human genes 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 229940100601 interleukin-6 Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 239000013038 irreversible inhibitor Substances 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 210000000135 megakaryocyte-erythroid progenitor cell Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000037230 mobility Effects 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000003887 myelocyte Anatomy 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 239000013631 noncovalent dimer Substances 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000008196 pharmacological composition Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 210000004986 primary T-cell Anatomy 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 229920002477 rna polymer Polymers 0.000 description 1
- 238000011808 rodent model Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- 229960002668 sodium chloride Drugs 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 210000002437 synoviocyte Anatomy 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229940126622 therapeutic monoclonal antibody Drugs 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
- A61K39/4621—Cellular immunotherapy characterized by the effect or the function of the cells immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/46433—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464411—Immunoglobulin superfamily
- A61K39/464412—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/36—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
- C12N15/625—DNA sequences coding for fusion proteins containing a sequence coding for a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/577—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
- A61K2239/13—Antibody-based
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/21—Transmembrane domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/22—Intracellular domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2302—Interleukin-2 (IL-2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/998—Proteins not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the present disclosure relates to chimeric antigen receptors reactive with citrullinated antigens and regulatory T cells expressing the receptors for treating autoimmune disease.
- RA Rheumatoid Arthritis
- T cells T cells
- B cells B cells
- macrophages dendritic cells
- fibroblast-like synoviocytes present in the sublining layer of the synovium proliferate and contribute to cartilage damage.
- Synovial hyperplasia in rheumatoid arthritis results in infiltration of the synovium by immune cells, and subsequent cartilage damage and bone erosion.
- FIG. 4 MND-SBT01G shows a stronger response to plate-bound, antibody captured CV, but not soluble CV than MND-BVCA1.
- FIG. 5 Testing of an initial batch of synovial fluid from innovative Research showed SBT01G gave stronger responses than BVCA1.
- FIG. 6 Further testing of 15 synovial fluid samples from Swedish patients showed that, for samples that gave a response, SBT01G was stronger than BVCA1.
- FIG. 7 Primary Treg responses to synovial fluid (SF) demonstrate SBT01G is more sensitive than BVCA1 to SF from RA patients.
- FIG. 8 SBT01G, but not BVCA1, is also able to respond to plate-bound full-length PAD2 citrullinated fibrinogen.
- FIG. 9 SBT01G CAR as effectors and Tregs respond to Citrullinated Fibrinogen but BVCA1 does not.
- FIG. 10 A- 10 B Both EF1A and MND promoters demonstrate functional responses by CV CARs to soluble bead-bound-peptide. Thus, the CAR promoter does not influence Treg phenotype.
- FIG. 11 scFv linker has little to no impact on SBT01G CAR-based function.
- FIG. 12 A- 12 B SBT01G is expressed by a higher percentage of cells than BVCA1, but BVCA1 and SBT01G CAR-T cells have similar FoxP3 and Helios profiles.
- FIG. 13 CV-CAR Treg cells (SBT01G) but not untransduced Treg cells are activated by citrullinated vimentin (CV). Activation was demonstrated by target antigen-specific increases in proliferation, CD71 expression and IL-10 secretion.
- FIG. 14 CV-CAR Treg cells respond to citrullinated proteins in the synovial fluid from the majority of RA patients. In contrast, CV-CAR Treg cells do not respond to synovial fluid from normal controls (subjects without RA).
- FIG. 15 CV-CAR Treg cells (SBT01G) but not untransduced Treg cells from two donors are specifically activated by synovial fluid from RA patients.
- FIG. 16 A- 16 B Assessment of the suppressive function of CV-CAR Treg cells.
- FIG. 16 A shows that CV-CAR Treg cells are able to suppress proliferation of CD3/CD28-preactivated Teff cells in the presence but not the absence of CV.
- FIG. 16 B shows that CV-CAR Treg cells are able to suppress proliferation of CD19-CAR Teff cells in the presence of CV, whereas untransduced Treg cells are not.
- FIG. 17 A timeline of human CV-CAR Treg cell activation in vivo in a lipopolysaccharide (LPS)-induced, murine model of pulmonary inflammation is shown.
- human CV-CAR Treg cells were administered intravenously (IV) on Day 0, human IL-2 was administered intraperitoneally (IP) twice daily, and LPS was administered intranasally (IN) on Days 0, 1, 6 and 12.
- IV intravenously
- IP intraperitoneally
- I intranasally
- FIG. 18 A- 18 B Flow cytometry dot plots comparing epidermal growth factor (EGFR) expression by human CV-CAR Treg cells versus of levels of Cell Trace Violet (CTV) are shown.
- FIG. 18 A shows how a proliferation ratio of the CV-CAR Tregs (EGFR+) was determined. Specifically, the proliferation ratio equals the % of EGFR+, CTV ⁇ cells divided by the % of EGFR+, CTV ⁇ cells.
- FIG. 18 B shows how a fold change in EGFR ratio was determined.
- FIG. 19 A- 19 B CV-CAR Tregs proliferate in a LPS-induced, murine model of pulmonary inflammation but not in control recipients of PBS.
- FIG. 19 A shows the absolute number of CD45+, CD3+ Tregs in the lungs of various study groups
- FIG. 19 B shows the proliferation ratio of the Tregs in the lungs of various study groups.
- Treg-based adoptive cell therapy represents a promising approach in RA.
- Treg-based ACT reverses disease in animal models of RA.
- an antibody isolated from a RA patient was used to engineer a CAR specific for citrullinated vimentin (CV) and other posttranslational modified proteins found abundantly and almost exclusively in the synovial extracellular matrix (ECM) of affected joints.
- CV citrullinated vimentin
- ECM synovial extracellular matrix
- CAR chimeric antigen receptors
- the CARs can be specific for post-translationally modified antigens.
- the CARs can be specific for binding to citrullinated polypeptides, including vimentin, citrullinated filaggrin and citrullinated fibrinogen.
- Chimeric antigen receptors were engineered to specifically target post-translationally modified proteins, namely citrullinated vimentin, citrullinated filaggrin and citrullinated fibrinogen, that are expressed in the extracellular matrix of inflamed joints in patients with Rheumatoid Arthritis (RA).
- the single chain fragment variable (scFv) part of the CAR is obtained from an antibody highly specific for citrullinated proteins isolated from the peripheral blood of an RA patient.
- specific scFv chains were inserted into a second-generation CAR construct.
- the scFv chains were inserted into a CAR construct cloned in a lentiviral vector.
- the terms “antigen,” “immunogen,” and “antibody target,” refer to a molecule, compound, or complex that is recognized by an antibody, i.e., can be bound by the antibody.
- the term can refer to any molecule that can be recognized by an antibody, e.g., a polypeptide, polynucleotide, carbohydrate, lipid, chemical moiety, or combinations thereof (e.g., phosphorylated or glycosylated polypeptides, etc.).
- a polypeptide, polynucleotide e.g., a polypeptide, polynucleotide, carbohydrate, lipid, chemical moiety, or combinations thereof (e.g., phosphorylated or glycosylated polypeptides, etc.).
- phosphorylated or glycosylated polypeptides etc.
- epitope refers to the localized site on an antigen that is recognized and bound by an antibody.
- Epitopes can include a few amino acids or portions of a few amino acids, e.g., 5 or 6, or more, e.g., 20 or more amino acids, or portions of those amino acids.
- the epitope includes non-protein components, e.g., from a carbohydrate, nucleic acid, or lipid.
- the epitope is a three-dimensional moiety.
- the epitope can be comprised of consecutive amino acids, or amino acids from different parts of the protein that are brought into proximity by protein folding (e.g., a discontinuous epitope).
- the term “antibody” refers to a polypeptide comprising a framework region from an immunoglobulin gene, that specifically bind and recognize an antigen.
- the “variable region” contains the antigen-binding region of the antibody (or its functional equivalent) and is most critical in specificity and affinity of binding.
- An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kD) and one “heavy” chain (about 50-70 kD).
- Antibodies can be of (i) any of the five major classes of immunoglobulins, based on the identity of their heavy-chain constant domains—alpha (IgA), delta (IgD), epsilon (IgE), gamma (IgG) and mu (IgM), or (ii) subclasses (isotypes) thereof (E.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2).
- the light chains can be either lambda or kappa.
- CDR sequence set refers to the 3 heavy chain and/or 3 light chain CDRs of a particular antibody described herein.
- a “light chain” CDR sequence set refers to the light chain CDR sequences.
- a “heavy chain” CDR sequence set refers to the heavy chain CDR sequences.
- a “full” CDR sequence set refers to both heavy chain and light chain CDR sequences. CDRs are predicted based on IMGT sequence alignment.
- chimeric antibody refers to an antibody having amino acid sequences derived from two or more species.
- the variable region of both light and heavy chains correspond to the variable region of antibodies derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity and capability, while the constant region are homologous the sequence derived from another species (typically in the subject receiving the therapy, e.g., human) to avoid eliciting an immune response.
- humanized antibody refers to a chimeric antibody in which the CDRs, obtained from the VH and VL regions of a non-human antibody having the desired specificity, affinity and capability are grafted to a human framework sequence.
- the framework residues of the humanized antibody are modified to refine and optimize the antibody specificity, affinity and capability.
- Humanization i.e., substitution of non-human CDR sequences for the corresponding sequences of a human antibody, can be performed following the methods described in, e.g., U.S. Pat. Nos.
- human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding thereto made by any technique known in the art.
- the specificity of the binding can be defined in terms of the comparative dissociation constants (Kd) of the antibody (or other targeting moiety) for target, as compared to the dissociation constant with respect to the antibody and other materials in the environment or unrelated molecules in general.
- Kd comparative dissociation constants
- a larger (higher) Kd is a Kd that describes a lower affinity interaction.
- a smaller (lower) Kd is a Kd that describes a higher affinity interaction or tighter binding.
- the Kd for an antibody specifically binding to a target may be femtomolar, picomolar, nanomolar, or micromolar and the Kd for the antibody binding to unrelated material may be millimolar or higher.
- an antibody “binds” or “recognizes” an antigen or epitope if it binds the antigen or epitope with a Kd of less than 10 ⁇ 4 M (i.e., in the micromolar range).
- the term “binds” with respect to a cell type typically indicates that an agent binds a majority of the cells in a pure population of those cells.
- an antibody that binds a given cell type typically binds to at least 2 ⁇ 3 of the cells in a population of the indicated cells (e.g., 67, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%).
- binding to a polypeptide can be assayed by comparing binding of the antibody to a cell that presents the polypeptide to binding (or lack thereof) of the antibody to a cell that does not express the polypeptide.
- One of skill will recognize that some variability will arise depending on the method and/or threshold of determining binding.
- Affinity of an antibody for a target can be determined according to methods known in the art, e.g., as reviewed in Ernst et al. Determination of Equilibrium Dissociation Constants, Therapeutic Monoclonal Antibodies (Wiley & Sons ed. 2009).
- the term “greater affinity” as used herein refers to a relative degree of antibody binding where an antibody X binds to target Y more strongly (Kon) and/or with a smaller dissociation constant (Koff) than to target Z, and in this context antibody X has a greater affinity for target Y than for Z.
- the term “lesser affinity” herein refers to a degree of antibody binding where an antibody X binds to target Y less strongly and/or with a larger dissociation constant than to target Z, and in this context antibody X has a lesser affinity for target Y than for Z.
- the affinity of binding between an antibody and its target antigen can be expressed as KA equal to 1/KD where KD is equal to kon/koff.
- the kon and koff values can be measured using surface plasmon resonance technology, for example, using a Molecular Affinity Screening System (MASS-1) (Sierra Sensors GmbH, Hamburg, Germany).
- An antagonist or blocking antibody is an antibody that partially or fully blocks inhibits or neutralizes a biological activity related to the target antigen relative to the activity under similar physiological conditions when the antibody is not present.
- Antagonists can be competitive, non-competitive or irreversible.
- a competitive antagonist is a substance that binds to a natural ligand or receptor at the same site as the natural ligand-receptor interaction or binds allosterically in a manner that induces a change to prevent normal binding.
- a non-competitive antagonist binds at a different site than the natural ligand-receptor interaction, but lower the KD or signal resulting from the interaction.
- An irreversible inhibitor causes covalent modifications to the receptor preventing any subsequent binding.
- the term “avidity” refers to the overall stability of the binding complex between the antibody and the target antigen. It is governed by three factors, (i) the intrinsic affinity of the antibody for the antigen, (2) the valency of the antibody, and (3) the geometric arrangement of the interacting components. Affinity is the strength of the interaction between the antibody and a single target, whereas avidity is an accumulated strength of multiple affinities.
- the antibodies provided herein are divalent.
- an antibody “preferentially binds” binds a first antigen relative to a second antigen if it binds the first antigen with greater affinity than it does the second antigen.
- Preferential binding can be at least any of 2-fold, 5-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 100-fold, 500-fold or 1000-fold greater affinity.
- an antibody “specifically binds” or is “specific for” a target antigen or target group of antigens if it binds the target antigen or each member of the target group of antigens with an affinity of at least any of 1 ⁇ 10 ⁇ 6 M, 1 ⁇ 10 ⁇ 7 M, 1 ⁇ 10 ⁇ 8 M, 1 ⁇ 10 ⁇ 9 M, 1 ⁇ 10 ⁇ 10 M, 1 ⁇ 10 ⁇ 11 M, 1 ⁇ 10 ⁇ 12 M, and, for example, binds to the target antigen or each member of the target group of antigens with an affinity that is at least two-fold greater than its affinity for non-target antigens to which it is being compared.
- specific binding is characterized by binding the antigen with sufficient affinity that the antibody is useful as a diagnostic to detect the antigen or epitope and/or as a therapeutic agent in targeting the antigen or epitope.
- polypeptide refers to a molecule having a sequence of natural and/or unnatural amino acids connected through peptide bonds.
- peptide refers to a short polypeptide, typically no more than 30 amino acids long.
- the amino acid sequence of a polypeptide is referred to as its “primary structure.”
- protein refers to a polypeptide having a secondary, tertiary and/or quaternary structure, e.g., structures stabilized by hydrogen bonds, relationships between secondary structures and structures formed of more than one protein. Proteins can be further modified by other attached moieties such as carbohydrate (glycoproteins), lipids (lipoproteins) phosphate groups (phosphoproteins) and the like.
- amino acid sequence “consists of” only the amino acids in that sequence.
- a first amino acid sequence “consists essentially of” a second amino acid sequence if the first amino acid sequence (1) comprises the second amino sequence and (2) is no more than 1, no more than 2 or no more than 3 amino acids longer than the second amino acid sequence.
- a first amino acid sequence is a “fragment” of a second amino acid sequence if the second amino acid sequence comprises the first amino acid sequence.
- a first amino acid sequence that is a fragment of a second amino acid sequence may have no more than any of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 fewer amino acids than the second amino acid sequence.
- a “functional equivalent” of a reference amino acid sequence is a sequence that is not identical to the reference sequence, but that contains minor alterations such as, for example, insertion, deletion or substitution of one or a few amino acids.
- a functionally equivalent sequence retains the function (e.g., immunogenicity) of the reference sequence to which it is equivalent. If a functionally equivalent amino acid sequence contains substitution of one or more amino acids with respect to the reference sequence, these will generally be conservative amino acid substitutions.
- a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue without abolishing the protein's desired properties.
- Suitable conservative amino acid substitutions can be made by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another. See, e.g., Watson, et al., “Molecular Biology of the Gene,” 4th Edition, 1987, The Benjamin/Cummings Pub. Co., Menlo Park, CA, p. 224.
- Examples of conservative amino acid substitution include the following (Note, some categories are not mutually exclusive):
- substantially identical refers to identity between a first amino acid sequence that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity and/or common immunogenicity.
- amino acid sequences that contain a common structural or antigenic domain having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity are termed sufficiently or substantially identical.
- nucleotide sequence the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity, or encode polypeptides having the same immunogenic properties.
- a chemical entity such as a polypeptide
- a substantially purified fraction is a composition wherein the object species comprises at least about 50% (on a molar basis) of all macromolecular species present.
- a substantially pure composition means that about 80% to 90% or more of the macromolecular species present in the composition is the purified species of interest.
- the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) if the composition consists essentially of a single macromolecular species.
- Solvent species, small molecules, stabilizers (e.g., BSA), and elemental ion species are not considered macromolecular species for purposes of this definition.
- isolated antibody refers to antibody produced in vivo or in vitro that has been removed from the source that produced the antibody, for example, an animal, hybridoma or other cell line (such as recombinant insect, yeast or bacterial cells that produce antibody).
- sequence identity refers to the percentage of sequence identity between two polypeptide sequences or two nucleic acid sequences. To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino acid or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- the determination of percent identity between two sequences can also be accomplished using a mathematical algorithm.
- a preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873-5877.
- Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402.
- PSI-BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.).
- the default parameters of the respective programs e.g., of XBLAST and NBLAST
- Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4:11-17.
- ALIGN program version 2.0 which is part of the GCG sequence alignment software package.
- a PAM120 weight residue table a gap length penalty of 12
- a gap penalty of 4 a gap penalty of 4.
- the percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
- percentage sequence identities can be determined when antibody sequences maximally aligned by IMGT. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, multiplied by 100 to convert to percentage.
- a subject antibody region e.g., the entire mature variable region of a heavy or light chain
- Percent amino acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).
- NCBI-BLAST2 sequence comparison program may be obtained from the National Institute of Health, Bethesda, Md.
- the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
- nucleic acid sequence refers to a sequence of nucleoside or nucleotide monomers consisting of naturally occurring bases, sugars and intersugar (backbone) linkages and includes cDNA. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof.
- the nucleic acid sequences of the present application may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil.
- the sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil; and xanthine and hypoxanthine. It is understood that polynucleotides comprising non-transcribable nucleotide bases may be useful as probes in, for example, hybridization assays.
- nucleic acid can be either double stranded or single stranded, and represents the sense or antisense strand. Further, the term “nucleic acid” includes the complementary nucleic acid sequences as well as codon optimized or synonymous codon equivalents.
- isolated nucleic acid refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized.
- An isolated nucleic acid is also substantially free of sequences that naturally flank the nucleic acid (i.e. sequences located at the 5′ and 3′ ends of the nucleic acid) from which the nucleic acid is derived.
- Hybridization may occur to all or a portion of a nucleic acid sequence molecule.
- the hybridizing portion is typically at least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length.
- stringent hybridization conditions are selected. By way of example the following conditions may be employed to achieve stringent hybridization: hybridization at 5 ⁇ sodium chloride/sodium citrate (SSC)/5 ⁇ Denhardt's solution/1.0% SDS at Tm ⁇ 5° C.
- Moderately stringent hybridization conditions include a washing step in 3 ⁇ SSC at 42° C. It is understood, however, that equivalent stringencies may be achieved using alternative buffers, salts and temperatures. Additional guidance regarding hybridization conditions may be found in: Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 2002, and in: Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001.
- expression construct refers to a polynucleotide comprising an expression control sequence operatively linked with a heterologous nucleotide sequence (i.e., a sequence to which the expression control sequence is not normally connected to in nature) that is to be the subject of expression.
- expression vector refers to a polynucleotide comprising an expression construct and sequences sufficient for replication in a host cell or insertion into a host chromosome. Plasmids and viruses are examples of expression vectors.
- expression control sequence refers to a nucleotide sequence that regulates transcription and/or translation of a nucleotide sequence operatively linked thereto. Expression control sequences include promoters, enhancers, repressors (transcription regulatory sequences) and ribosome binding sites (translation regulatory sequences).
- a nucleotide sequence is “operatively linked” with an expression control sequence when the expression control sequence functions in a cell to regulate transcription of the nucleotide sequence. This includes promoting transcription of the nucleotide sequence through an interaction between a polymerase and a promoter.
- vector comprises any intermediary vehicle for a nucleic acid molecule which enables said nucleic acid molecule, for example, to be introduced into prokaryotic and/or eukaryotic cells and/or integrated into a genome, and include plasmids, phagemids, bacteriophages or viral vectors such as retroviral based vectors, lentiviral vectors, Adeno Associated viral vectors and the like.
- plasmid as used herein generally refers to a construct of extrachromosomal genetic material, usually a circular DNA duplex, which can replicate independently of chromosomal DNA.
- Transfection refers to the introduction of new genetic material into a cell. It includes transformation (the direct uptake and incorporation of exogenous genetic material from its surroundings through the cell membrane), transduction (the introduction of foreign DNA by a bacteriophage virus into a host cell) and conjugation.
- a “host cell” refers to a recombinant cell comprising an expression construct.
- biological sample refers to a sample containing cells (e.g., tumor cells) or biological molecules derived from cells.
- the term terms “therapy,” “treatment,” “therapeutic intervention” and “amelioration” refer to any activity resulting in a reduction in the severity of symptoms.
- the terms “treat” and “prevent” are not intended to be absolute terms.
- Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc.
- Treatment and prevention can be complete or partial.
- the effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment.
- the severity of disease is reduced by at least 10%, as compared, e.g., to the individual before administration or to a control individual not undergoing treatment.
- the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques. “Treating” and “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. “Treating” and “treatment” as used herein also include prophylactic treatment.
- compositions or methods “comprising” or “including” one or more recited elements may include other elements not specifically recited (e.g., open-ended terms meaning including but not limited to).
- a composition that “comprises” or “includes” an antibody may contain the antibody alone or in combination with other ingredients.
- the phrase “consisting of” is closed, indicating that such embodiments do not include additional elements.
- the term “consisting essentially of” refers to the inclusion of recited elements and other elements that do not materially affect the basic and novel characteristics of a claimed combination (e.g., partially closed term). It is understood that aspects and embodiments described herein as “comprising” include “consisting of” and “consisting essentially of” embodiments.
- CARs Chimeric antigen receptors
- a target binding domain or “CARs” are engineered molecules comprising an optional signal peptide, a target binding domain, an optional hinge region, a transmembrane domain, an intracellular signaling domain and an optional co-stimulatory domain. CARs are based on the structure of T cell receptors, which are expressed on T cells and which are involved in the cell-mediated immune response.
- the “target binding domain” is also referred to herein as an “antigen binding domain”, and as such the term “target” encompasses an “antigen.”
- So-called “first-generation” CARs had a targeting domain and a CD3 ⁇ signal transduction domain.
- So-called “second generation” CARs further included a co-stimulatory domain, such as a CD28 or 4-1BB domain.
- So-called “third generation” CARs comprise multiple co-stimulatory domains.
- So-called “fourth generation” CARs also referred to as “TRUCKS” are engineered to release a transgenic cytokine upon CAR signaling.
- Chimeric antigen receptors include the following elements: (1) an optional signal peptide, (2) a target binding domain, (3) an optional hinge region; (4) a transmembrane region; (5) an intracellular domain comprising a signal transduction domain.
- the CAR can include any of: a CD3 ⁇ signal transduction domain, an Fc receptor signal transduction domain, a co-stimulatory (signal transduction) domain. That is, these optional elements can be included in addition to or instead of other optional elements.
- the target binding domain is heterologous to at least one of the other domains. That is, the target binding domain does not naturally occur on a T cell receptor, or is not in the same protein as at least one of the other domains.
- the “target binding domain” provides binding specificity to the CAR.
- the “signal peptide” guides the polypeptide through the cell membrane.
- the target binding domain can bind to a domain of an antibody that binds to the target antigen for a so-called “Universal CAR”.
- the “hinge region” is a flexible connector region, e.g., a natural or synthetic polypeptide, or any other type of molecule, providing structural flexibility and spacing to flanking polypeptide regions.
- the “transmembrane domain” is a membrane-spanning protein domain, typically hydrophobic.
- the “signal transduction domain” or “signaling domain” transmits a signal through a signal transduction pathway into the cell upon binding. Such signaling activates an activity of the cell.
- “Co-stimulatory domains” are accessory signaling domains that further transmit signals.
- the CAR comprises:
- the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:15, SEQ ID:17, SEQ ID NO:28, and SEQ ID:19. In other embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:28, and SEQ ID:19. In some embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:29, and SEQ ID:19. In other embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:29, and SEQ ID:19.
- a signal peptide can be any peptide having the function of allowing a polypeptide to traverse a cell membrane.
- the signal peptide can be derived from CD4, CD8, CD28, TLR or immunoglobulin family of receptors.
- the signal peptide can comprise the sequence:
- the target binding domain can include any polypeptide comprising a target binding function, e.g., an antibody as defined herein.
- the target binding domain can comprise an antibody form retaining antigen binding activity as defined herein.
- the target binding domain can comprise a single chain antibody (scFV).
- the scFv can be connected to the transmembrane domain via a hinge domain whose length, flexibility and origin provides variability in the CAR's design, and can, along with the transmembrane domain, contribute to the interaction with antigen, building of the immunologic synapse and impact the CAR's association with additional proteins needed to impart a robust activation signal.
- Chimeric antigen receptors disclosed herein comprise a target binding domain (also referred to herein as an antigen-binding domain) that binds to citrullinated antigens, e.g., those found in the synovium of subjects with rheumatoid arthritis.
- the target binding domain can bind to one or more of (i) citrullinated vimentin, (ii) citrullinated filaggrin, (iii) citrullinated fibrinogen and (iv) citrullinated peptides thereof.
- the target binding domain can bind to a citrullinated peptide fragment of (i)-(iii), wherein the peptide fragment is at least of 10 amino acids in length, e.g.
- the target binding domain further binds to tenascin C.
- the target binding domain can bind to two or more of (i) citrullinated vimentin, (ii) citrullinated filaggrin, (iii) citrullinated fibrinogen, and (iv) tenascin C, or citrullinated peptide fragments thereof.
- the target domain is one or more citrullinated peptides selected from the following sequences:
- the antigen binding domain binds to one or more citrullinated peptides, but does not bind to non-citrullinated counterparts. In some embodiments, the antigen binding domain binds to a citrullinated vimentin peptide set forth as SEQ ID NO:24, but not STRSVSSSSYRRMFGG (SEQ ID NO:45). In some embodiments, the antigen binding domain binds to a citrullinated vimentin peptide set forth as SEQ ID NO:25, but not VYATRSSAVRLRSSV (SEQ ID NO:46).
- the antigen binding domain binds to a citrullinated fibrinogen peptide set forth as SEQ ID NO:26, but not RPAPPPISGGGYRAR (SEQ ID NO:47). In some embodiments, the antigen binding domain binds to a citrullinated filaggrin peptide set forth as SEQ ID NO:27, but not SHQESTRGRSRGRSGRSGS (SEQ ID NO:48).
- the target binding domain can comprise sequences from an antibody VH and VL domain. In some embodiments, the target binding domain can comprise sequences from heavy chain only antibody or antibody fragment having only two VH domains. This includes particular CDR sets from VH and VL domains. In some embodiments the target binding domain comprises the CDRs from the VH domains of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments the target binding domain comprises the CDRs from the VL domains of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3, respectively.
- the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4, respectively. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:3, respectively. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4, respectively.
- the target binding domain comprises the complementarity-determining regions (CDRs) from VH and VL domains of SEQ ID NO:1 (SBT01 VH (M)) and SEQ ID NO:4 (SBT01 VL (G)).
- the VH domain of the target-binding domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36
- the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
- the target binding domain comprises VH sequences selected from:
- SBT01 VH (M) (SEQ ID NO: 1) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIR QPPGKGLEWIGSIYYRGNTHYNSSLRSRVTMSVDTSKNRF SLKVTSVTAADTAVYYCARLDPFDYWGRGTLVTVSS; (2) SBT01 VH (G) (SEQ ID NO: 2) QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIR QPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCARLDPFDYWGRGTLVTVSS; or
- the target binding region can comprise VL sequences selected from:
- SBT01 VL (M) (SEQ ID NO: 3) SYVLTQPPSVSLAPGETATITCGGDDIENQNVNWYQQKSG QAPMLLIFFDTRRPSGIPERFSGSRSEDTANLTITRVEAG DDADYFCQVYDRKTDHQVFGPGTTVTVL; (2) SBT01 VL (G) (SEQ ID NO: 4) SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPG QAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHQVFGTGTKVTVL; or
- the antigen binding region comprises an scFV comprising one or more VH domains comprising an amino acid sequence of VH domains of SEQ ID NO:1 or SEQ ID NO:2.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:1 or SEQ ID NO:2, provided the scFV domain binds to a citrullinated antigen as described herein.
- the scFV comprises the VL domains of SEQ ID NO:3 or SEQ ID NO:4.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 3 or SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein.
- the scFV domain comprises the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3, respectively.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 or SEQ ID NO:3, provided the scFV domain binds to a citrullinated antigen as described herein.
- a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- the scFV domain comprises the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4, respectively.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 and SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein.
- a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- the scFV domain comprises the VH and VL domains of SEQ ID NO: 2 and SEQ ID NO:3, respectively.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 3, provided the scFV domain binds to a citrullinated antigen as described herein.
- a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- the scFV domain comprises the VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4, respectively.
- the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 4, provided the scFV domain binds to a citrullinated antigen as described herein.
- a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- the antigen binding region comprises an scFV comprising an amino acid sequence selected from:
- the linker can comprise the sequence:
- any of the foregoing sequences can include the CDR sets from the VH and VL domains described above.
- the hinge region of the disclosed CARs can be selected from the CD8, CD4, or CD28 extracellular domain, the Fc region of an IgG1 antibody, or the extracellular domain of any of the TLR receptors as is known to one of skill in the art and can be found in the GenBank database.
- the transmembrane domain can comprise a transmembrane domain of an immunoglobulin family receptor, such as CD8.
- the intracellular domain can be selected from any membrane-spanning molecule on a T cell.
- the transmembrane (TM) domain of the disclosed CAR can comprise the TM domain of CD2, CD3, CD16, CD32, CD64, CD28, CD247, 4-1BBL, CD4, or CD8.
- the transmembrane domain can comprise the sequence:
- the signal transduction domain comprises a CD3 ⁇ signaling domain.
- the CD3 ⁇ signaling domain of the disclosed CAR molecule can comprise a CD3 ⁇ amino acid sequence, e.g., a signal transduction domain of CD3 zeta.
- the CD3 ⁇ signal transduction domain can comprise the sequence:
- the CD3 zeta signal transduction domain can include amino acids 21-163, 31-142, 68-89 and/or 138-158 of the sequence shown in SEQ ID NO:19, or functional variants thereof (e.g., with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 10-20 amino acid substitutions, deletions, or additions).
- the signal transduction domain comprises an Fc signaling domain.
- the Fc signaling domain can be any one of the Fc-alpha, Fc-gamma, Fc-epsilon, Fc-mu, and Fc-delta receptors.
- the Fc receptor signaling domain can comprise amino acids involved in interaction with Src (e.g., Fgr, Fyn, Hck, Lyn, Yes, and Src) and ZAP-70 family kinases, e.g., one or more ITAM domains (see, e.g., Sanchez-Mejorada et al. (1998) J. Leukocyte Biol. 63:531; Garcia-Garcia et al. (2002) J.
- nucleic acid molecules comprising a nucleotide sequence that encodes a CAR of this disclosure.
- the nucleic acid of the disclosed CAR can be in the form of DNA or in the form of RNA.
- DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
- RNA includes mRNA, siRNA, sRNA, ssRNA and so on.
- nucleic acids can comprise nucleotide sequences that encode the polypeptides of any of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4.
- nucleotide sequences encoding VH domains comprise:
- SBT01 VH (M) (SEQ ID NO: 8) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC, (2) SBT01 VH (G) (SEQ ID NO: 9) CAGCTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTAGTAG TT
- nucleotide sequences encoding VL domains comprise:
- nucleic acid molecule encoding VH domains comprise SEQ ID NO: 8 or SEQ ID NO:9. In some embodiments, the nucleic acid molecule encoding VH domains comprise a nucleic sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:8 or SEQ ID NO:9, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encoding VL domains comprise SEQ ID NO: 10 or SEQ ID NO: 11. In some embodiments, the nucleic acid molecule encoding VL domains comprise a nucleic sequence having at least any 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 10 or SEQ ID NO: 11, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO:8 and SEQ ID NO:10. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 8 or SEQ ID NO:10, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 8 and SEQ ID NO: 11. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 8 or SEQ ID NO:11, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 9 and SEQ ID NO:10. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 9 or SEQ ID NO: 10, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 9 and SEQ ID NO:11. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 9 or SEQ ID NO: 11, provided the scFV domain binds to a citrullinated antigen as described herein.
- the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
- the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
- Linker-pSB_0158 (SEQ ID NO: 13) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC GGAAGCACGAGTGGTTCAGGCAAACCGGGTTCCGGTGAAGGTTC AACAAAAGGT TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCC CCAGGAAAGACG
- the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
- these can include sequences encoding the CDR sets from the VH and VL domains described herein.
- the polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In some embodiments, the polynucleotide variants contain alterations that produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded CAR polypeptide. In some embodiments, the polynucleotide variants contain alterations that do not produce any changes in the amino acid sequence. In some embodiments, polynucleotide variants contain “silent” substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, for example, to optimize codon expression for a particular host.
- the polynucleotides as described herein are isolated.
- Polynucleotides encoding CARs be isolated molecules, or can be included within a vector, such as a plasmid, a cosmid, an artificial chromosome or a virus. Such vectors can be used to transfect target cells.
- Polynucleotides encoding CARs of this disclosure can include regulatory elements operatively linked with a nucleotide sequence encoding the CAR.
- a polynucleotide can include one or more transcription regulatory elements, such as promoters or enhancers, which, when the polynucleotide is present in a cell, cause the sequence encoding the CAR to be expressed within the cell.
- Nucleic acids disclosed herein can be incorporated into vectors capable of transfecting cells.
- Such vectors include, without limitation, viral vectors plasmids and microvesicles, e.g., liposomes.
- Exemplary viral vectors adenoviral vectors Ad, AAV, lentivirus, and vesicular stomatitis virus (VSV) and retroviruses.
- Lentiviruses are a genus of the Retroviridae family and include HIV, SIV, and FIV. Lentiviruses can deliver a large quantities of genetic material into the DNA of the host cell. They are able to infect non-dividing cells.
- This disclosure also provides cells (e.g., recombinant cells) comprising nucleic acid molecules encoding CARs and/or expressing CARs.
- the cells expressing the CARs of this disclosure are Treg cells.
- Regulatory T cells or “T reg cells,” are cells belonging to a specialized subpopulation of T cells that act to suppress immune response, thereby maintaining homeostasis and self-tolerance.
- T reg s are able to inhibit T cell proliferation and cytokine production and play a critical role in preventing autoimmunity.
- T reg s are characterized by expression of FoxP3. Surface markers for T reg s include CD4, CD25high (high molecular density) and CD127low (low molecular density).
- Mouse and human Tregs express GITR/AITR, and CTLA-4.
- the cells to be transformed with the nucleic acids disclosed herein can be cells taken from a subject into whom the recombinant cells are to be administered. In this way, issues of an allogeneic immune response can be mitigated.
- Treg cells into which nucleic acids expressing the CARs of this disclosure have been incorporated can express these CARs and be used in the methods described herein to treat rheumatoid arthritis.
- composition refers to a composition comprising a pharmaceutical compound (e.g., a drug or a recombinant Treg cell as described herein) and a pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers will generally be sterile, at least for human use.
- a pharmaceutical composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration.
- Examples of pharmaceutically acceptable carriers include, without limitation, normal (0.9%) saline, phosphate-buffered saline (PBS) Hank's balanced salt solution (HBSS) and multiple electrolyte solutions such as PlasmaLyte ATM (Baxter).
- Injectable (e.g., intravenous) compositions can comprise a solution of the composition suspended in an acceptable carrier, such as an aqueous carrier.
- an acceptable carrier such as an aqueous carrier.
- aqueous carriers e.g., water, buffered water, 0.4% saline, 0.9% isotonic saline, 0.3% glycine, 5% dextrose, and the like, and may include glycoproteins for enhanced stability, such as albumin, lipoprotein, globulin, etc.
- normal buffered saline (135-150 mM NaCl) will be used.
- compositions can contain pharmaceutically acceptable auxiliary substances to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
- auxiliary substances such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
- wetting agents e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
- the composition can be formulated in a kit for intravenous administration.
- compositions can be administered, for example, by intravenous infusion, topically, intraperitoneally, intravesically, or intrathecally.
- the formulations of compositions can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- dose refers to the amount of active ingredient given to an individual at each administration.
- the dose will vary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable label (if present).
- frequency of administration including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable label (if present).
- dose can be modified depending on the above factors or based on therapeutic progress.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the complementarity-determining regions (CDRs) from the VH domains of SEQ ID NO:1 or SEQ ID NO:2.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from the VL domains of SEQ ID NO:3 or SEQ ID NO:4.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- the VH domain of the CAR polypeptide comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36
- the VL domain of CAR polypeptide comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising one or more VH domains comprising the amino acid sequence of VH domains of SEQ ID NO:1 or SEQ ID NO:2.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:1 or SEQ ID NO:2, provided the scFV domain binds to a citrullinated antigen as described herein.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VL domains of SEQ ID NO:3 or SEQ ID NO:4.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 3 or SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 or SEQ ID NO:3, provided the scFV domain binds to a citrullinated antigen as described herein.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 and SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO: 2 and SEQ ID NO:3.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 3, provided the scFV domain binds to a citrullinated antigen as described herein.
- the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell.
- the cell is a Treg cell.
- compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4.
- the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 4, provided the scFV domain binds to a citrullinated antigen as described herein.
- the term “subject” refers to an individual animal.
- the term “patient” as used herein refers to a subject under the care or supervision of a health care provider such as a doctor or nurse.
- Subjects include mammals, such as humans and non-human primates, such as monkeys, as well as dogs, cats, horses, bovines, rabbits, rats, mice, goats, pigs, and other mammalian species.
- Subjects can also include avians.
- a patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc.
- the term “rheumatoid arthritis subject” refers to an individual that has been diagnosed with rheumatoid arthritis. Rheumatoid arthritis patients can include individuals that have not received treatment, are currently receiving treatment, have had treatment, and those that have discontinued treatment.
- an “effective amount” refers to an amount of an agent that is sufficient to generate a desired response, such as reduce or eliminate a sign or symptom of a condition or ameliorate a disorder.
- an “effective amount” is one that treats (including prophylaxis) one or more symptoms and/or underlying causes of any of a disorder or disease and/or prevents progression of a disease.
- a therapeutically effective amount will show an increase or decrease of therapeutic effect at least any of 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%.
- Therapeutic efficacy can also be expressed as “-fold” increase or decrease.
- a therapeutically effective amount can have at least any of a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
- the pharmaceutical composition can be administered by any suitable route, including but not limited to intravenous, subcutaneous, intramuscular or intraperitoneal routes.
- An example of administration of a pharmaceutical composition includes storing the composition at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4° C., and diluting it in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient.
- the pharmaceutical composition is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg.
- the pharmaceutical composition is administered by intravenous infusion over a period of between 15 minutes and 2 hours.
- the administration procedure is via sub-cutaneous bolus injection.
- the dose of the composition is chosen in order to provide effective therapy for the patient and is in the range of less than 0.1 mg/kg body weight to about 25 mg/kg body weight or in the range 1 mg-2 g per patient. In some cases, the dose is in the range 1-100 mg/kg, or approximately 50 mg-8000 mg/patient.
- the dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, depending on the pharmacokinetics of the composition (e.g., half-life of the composition in the circulation) and the pharmacodynamic response (e.g., the duration of the therapeutic effect of the composition). In some embodiments, the in vivo half-life of between about 7 and about 25 days and composition dosing is repeated between once per week and once every 3 months.
- Administration can be periodic. Depending on the route of administration, the dose can be administered, e.g., once every 1, 3, 5, 7, 10, 14, 21, or 28 days or longer (e.g., once every 2, 3, 4, or 6 months). In some cases, administration is more frequent, e.g., 2 or 3 times per day.
- the patient can be monitored to adjust the dosage and frequency of administration depending on therapeutic progress and any adverse side effects, as will be recognized by one of skill in the art.
- additional administration is dependent on patient progress, e.g., the patient is monitored between administrations.
- the patient can be monitored for rate of tumor growth, recurrence (e.g., in the case of a post-surgical patient), or general disease-related symptoms such as weakness, pain, nausea, etc.
- the T cells described herein are administered to the synovia of the joints of subjects having rheumatoid arthritis. Such administration can be by injection directly into the joint.
- kit refers to a collection of items intended for use together.
- the kit can optionally include a reference agent and/or instructions for use thereof.
- a kit can further include a shipping container adapted to hold a container, such as a vial, that contains a composition as disclosed herein.
- a kit can include a container that contains within it the collection of items.
- Kits of this disclosure can comprise a pharmaceutical composition as described herein, contained in a container, such as a bag or bottle for intravenous administration. Also included in the kit can be a fluidic conduit, such as a plastic tube, with a drip chamber. The drip chamber can communicate through a fluidic conduit with an intravenous needle.
- the fluidic conduit also can comprise one or more Y-sites and a roller clamp.
- CAR chimeric antigen receptor
- CF citrullinated fibrinogen
- CFSE carboxyfluorescein succinimidyl ester
- CV cirtullinated vimentin
- EGFR epidermal growth factor receptor
- IN intranasal
- IV intravenous
- LPS lipopolysaccharide
- PAD2 peptidylarginine deiminase 2
- PBMC peripheral blood mononuclear cells
- PBS phosphate buffered saline
- RA rheumatoid arthritis
- scFv single-chain variable fragment
- SF synovial fluid
- Teff effector T cell
- Treg regulatory T cell
- UTD untransduced
- Example 1 SBT01G Consistently Performed as well as, or Superior to BVCA1 in a Luciferase System
- Jurkat-FF-Luciferase Transduction ⁇ 50,000 cells per well were plated in each of 2 flat-bottom 96-well plates in RPMI with 2 ⁇ protamine sulfate. Viruses were diluted in RPMI such that 100 ⁇ l is approx. an MOI of 1. Then 100 ⁇ l was added to one column on each 96-well plate. Plates were then spun and placed in an incubator. Samples were pooled the next day. Transduced cells were resuspended in media and transferred 100 ⁇ l to a U-bottom plate in duplicate. The cells were stained with CV-AF488 and CV-AF647 with 1:100 anti-EGFR-PE at 4° C. for 20 mins, washed once, then analyzed by Novocyte. Samples were then scaled up into 6-well plates by adding 3 ml fresh media
- Luciferase Assay Normalized transduced cells were pelleted and resuspended in 1 ml RPMI. The CV-coated plates were washed three times with PBS. 50 ⁇ l of cells were added to the plates. 25 ⁇ l of 3 ⁇ PMA/Iono were added, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, the luciferase plates were read by adding 75 ⁇ l BioGlo reagent, incubating 2-3 mins in the dark and reading the plate.
- FIG. 1 shows the response of virus transduced Jurkat-FF-Luciferase cells to different concentrations of full CV coated plates. The results show that BVCA1and STB01 had the strongest response to plate-bound, full-length CV.
- FIG. 2 shows the response of virus transduced Jurkat-FF-Luciferase cells to different concentrations of soluble CV. The results show that only BVCA1 and SBT01G-HL had a dose-dependent response to soluble, full-length CV.
- FIG. 3 shows that in an assay with soluble bead-bound-peptide, BVCA1 and SBT01 demonstrated binding specificity to CV.
- FIG. 4 shows the response of BVCA1 and SBT01G to plate-bound CV, antibody (V9) captured CV, and soluble CV at different protein concentrations.
- SBT01G has a stronger response to plate-bound CV and antibody (V9) captured CV, but not soluble CV, than BVCA1.
- Example 2 SBT01 and BVCA1 Respond to Synovial Fluids from Rheumatoid Arthritis Patients
- Jurkat-FF-Luciferase transduction 24 ⁇ 10 6 Jurkat-FF-luc cells were pelleted and resuspended in 24 ml RPMI containing protamine sulfate and virus at a MOI of 3, to express CARs of pSB_0147, pSB-0149 and pSB0139. Cells were mixed and 4 ml were aliquoted into each well of a 6-well plate. Plates were then spun and placed in an incubator overnight. Cells were pelleted and reseeded in 25 ml RPMT in T75 flasks.
- Synovial Fluid Stimulus Transduced cells were pelleted and resuspended in RPMI and placed in wells of black/white plates. Synovial fluid (SF) samples from RA patients were thawed, vortexed, and diluted in RPMI before being added to plates containing transduced cells. Cells were cultured with SF at 37° C.
- Treg isolation and Tissue Culture Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells.
- PBMC Peripheral blood mononuclear cells
- CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and beta-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL.
- CTS Dynabeads Treg Xpander Gibco
- Primary Tregs were transduced with CV-CAR constructs on day 2 of expansion via spin-occulation in the presence of protamine sulfate.
- Treg activation was assessed by measurement of CD71 expression.
- Flow Cytometry and FACS Analysis Activation cultures were collected and centrifuged at 300 ⁇ g for 5 min and then resuspended in 1 ⁇ Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen), anti-EGFR and CD71 surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1 ⁇ Flow stain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
- FIG. 5 shows the response of SBT01G and BVCA1 to synovial fluids from RA patients.
- the data shows that SBT01G gave stronger responses than BVCA1 to synovial fluids from several RA patients.
- FIG. 6 shows for synovial fluid samples from Swedish RA patients that triggered a response, that SBT01G was again stronger than BVCA1.
- FIG. 7 shows responses of primary Treg cells transduced with CV-CARs to synovial fluid from multiple RA patients.
- the primary Treg cells expressing the SBT01G CAR are more sensitive to synovial fluid from RA patients than primary Treg cells expressing the BVCA1 CAR.
- Luciferase Assay Stably-transduced and untransduced (UTD) Jurkat-FF-luc cell lines were pelleted and resuspended in RPMI containing 10% FBS. The citrullinated protein-coated plates were washed three times with PBS. 50,000 cells per well in 75 ⁇ l were added the coated plates. 5 ⁇ l of 15 ⁇ PMA/Iono in RPMI were added to each well, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, 75 ⁇ l BioGlo reagent was added to each well, and the plates were incubated 2-3 mins in the dark. Luminescence was then read on a plate reader.
- Treg Isolation and Tissue Culture Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells and Teff were isolated using FACS gating for CD4+CD25loCD127pos.
- PBMC Peripheral blood mononuclear cells
- CD25+ cells were enriched by positive selection.
- Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells and Teff were isolated using FACS gating for CD4+CD25loCD127pos.
- CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and b-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL.
- CTS Dynabeads Treg Xpander Gibco
- Primary Tregs and Teffs were transduced with CD19-CAR or CV-CAR constructs on day 2 of expansion via spin-occulation in the presence of protamine sulfate.
- Tregs Activation of Tregs—Before start of activation cultures CAR expressing Tregs and Teff were labelled with a proliferation dye, CFSE. CD19-CAR and CV-CAR-expressing Treg cells were cultured in vitro with plate-coated citrullinated vimentin (CV) or citrullinated fibrinogen (CF) ranging in dose from 30 ng/ml to 10 ⁇ g/ml. Treg activation was assessed by measurement of percentages of proliferating cells and by CD71 expression.
- CV citrullinated vimentin
- CF citrullinated fibrinogen
- Flow Cytometry and FACS Analysis Activation cultures were collected and centrifuged at 300 ⁇ g for 5 min and then resuspended in 1 ⁇ Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen), anti-EGFR and CD71 surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1 ⁇ Flowstain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
- FIG. 9 shows that SBT01G CAR expressed on Teff cells and Treg cells respond to citrullinated vimentin (CV) and citrullinated fibrinogen (CF).
- CV citrullinated vimentin
- CF citrullinated fibrinogen
- CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and b-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL.
- CTS Dynabeads Treg Xpander Gibco
- Primary Tregs were transduced with CV-CAR constructs on day 2 of expansion via spin-occulation in the presence of protamine sulfate.
- CAR expressing Tregs were labelled with a proliferation dye, CFSE.
- CV-CAR-expressing Treg cells were cultured in vitro with bead captured CV peptide. Treg activation was assessed by measurement of percentages of proliferating cells.
- Activation cultures were collected and centrifuged at 300 ⁇ g for 5 min and then resuspended in 1 ⁇ Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen) and anti-EGFR surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1 ⁇ Flowstain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
- Treg phenotype On Day 14 of expansion untransduced (UTD), CD19-CAR and CV-CAR expressing Tregs were stained for transcription factors FoxP3 and Helios. Cells were fixed and permeabilized using eBiosciences FoxP3 transcription factor buffer set (eBiosciences).
- Treg Cultures On day 14 of expansion CD19-CAR and CV-CAR expressing Tregs were harvested, de-beaded using a magnet and put in culture with 300 IU/ml IL-2 only at 0.5 million cells/ml
- Luciferase Assay Stably-transduced and untransduced (UTD) Jurkat-FF-luc cell lines were pelleted and resuspended in RPMI containing 10% FBS. The citrullinated protein-coated plates were washed three times with PBS. 50,000 cells per well in 75 ⁇ l were added the coated plates. 5 ⁇ l of 15 ⁇ PMA/Iono in RPMI were added to each well, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, 75 ⁇ l BioGlo reagent was added to each well, and the plates were incubated 2-3 mins in the dark. Luminescence was then read on a plate reader.
- FIG. 10 A shows that both EF1A and MND promoters drive expression and functional responses by CV-CAR T cells to soluble bead-bound citrullinated peptide (pCV).
- FIG. 10 B shows that the use of different promoters does not change the phenotype of CV-CAR Treg cells.
- FIG. 11 shows that the choice of scFv linker has little to no impact on SBT01G CAR T cell responses to full length CV.
- FIG. 12 A shows that transduction with the SBT01G CAR vector resulted in CV-CAR expression in a higher percentage of cells than did transduction with the BVCA1 CAR vector.
- FIG. 12 B shows that SBT01G CAR and BVCA1 CAR Treg cells have similar FoxP3 and Helios profiles.
- FIGS. 10 - 12 show that SBT01G showed higher percentage of CAR-positive Tregs, and SBT01G showed higher levels of CAR expression.
- Treg Isolation and Tissue Culture Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells.
- PBMC peripheral blood mononuclear cells
- Treg activation was assessed by measurement of percentages of proliferating cells, and levels of CD71 expression and IL-10 secretion.
- FIG. 13 shows a dose-dependent, CV-induced activation of CV-CAR Treg cells, as demonstrated by increases in proliferating cells, CD71 expression and IL-10 secretion. In contrast, untransduced Treg cells were not activated by CV.
- FIG. 14 shows that Jurkat reporter cells expressing one of three different CV-CARs or a control CD19-CAR were incubated with increasing amounts of synovial fluid and responses were measured as an indicator of CV-CAR binding and signal transduction for T cell activation.
- FIG. 14 shows that Jurkat cells (immortalized, human T lymphocytes) expressing CV-CAR1 (BVCA1) and CV-CAR2 (SBT01G), but not CV-CAR3 (C03) or CD19-CAR, showed an increase in response to synovial fluid (SF).
- FIG. 14 also shows that CV-CAR2 (SBT01G) T cells were activated by SF samples from more RA patients than CV-CAR1 (BVCA1) T cells.
- FIG. 15 shows that CV-CAR2 Treg cells from two donors were activated in a RA synovial fluid-specific manner.
- CV-CAR Treg cells are able to bind to a citrullinated antigen, which is present in RA synovial fluid, resulting in activation necessary for suppressive functions.
- FIG. 16 A shows that CV-CAR Tregs stimulated with CV were able to suppress proliferation of CD3/CD28 activated Teff cells at a low Treg:Teff ratio.
- FIG. 16 B shows that CV-CAR Tregs stimulated with CV were also able to suppress proliferation of CD19-CAR Teff cells at a low Treg:Teff ratio.
- Example 7 Analysis of CV-CAR Tregs in a Rodent Model of CV-Associated Pulmonary Inflammation
- the model is characterized by an acute inflammatory response including pulmonary neutrophilia and increased secretion of the pro-inflammatory cytokines interleukin-6 (IL-6), interleukin-1beta (IL-1b) and tumor-necrosis factor-alpha (TNF-alpha), as well as an accumulation of CV in lung tissue within days after intranasal LPS challenge.
- IL-6 interleukin-6
- IL-1b interleukin-1beta
- TNF-alpha tumor-necrosis factor-alpha
- NCG mice Six-to-eight week old immunocompromised NCG mice were obtained from Charles River Laboratories. Mice were randomized by body weight and divided into groups of 5-10 animals. Mice were subjected to intranasal (IN) treatment with LPS (5 mg/kg) on days 0, 1, 6, and 12 to induce pulmonary inflammation, and release and accumulation of citrullinated vimentin (CV) in the affected tissues. On day 0, CV-CAR Treg cells were harvested from actively growing cultures, the stimulation beads were removed magnetically, and the Tregs were subsequently labeled with Cell Trace Violet (CTV) (Invitrogen).
- CTV Cell Trace Violet
- the CTV-labeled Tregs were adjusted to 25 ⁇ 10 6 cells/mL in 0.9% sterile saline solution (NaCl) and a 200 ⁇ l dose was injected intravenously (IV) such that each mouse received a total of 5 ⁇ 10 6 cells.
- IV intravenously
- all mice received intraperitoneal (IP) injections of IL-2 (160,000 IU) on days 1, 2, 5, 6, 7, 8, 9, and 12. Mice were monitored daily for any clinical signs of distress, and body weight was measured twice per week. Mice were euthanized on day 13, and the spleen and lungs were harvested and processed into single cell suspensions for flow cytometric analysis of the human CV-CAR and CD19-CAR Tregs.
- FIG. 17 shows an exemplary timeline for inducing CV-associated, pulmonary inflammation in mice and the activation of CV-CAR Treg cells in vivo.
- FIG. 18 A shows how a proliferation ratio was calculated from flow cytometry data
- FIG. 18 B show how a fold change in EGFR ratio (CAR marker) was calculated from the same data.
- FIG. 19 A shows that the absolute number of CV-CAR Tregs were significantly enriched in lung tissue from mice with LPS-induced pulmonary inflammation.
- FIG. 19 B shows that the proliferation ratio of CV-CAR Tregs was significantly increased in lung tissue from mice with LPS-induced pulmonary inflammation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Rheumatology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Transplantation (AREA)
- Physical Education & Sports Medicine (AREA)
- Oncology (AREA)
Abstract
Disclosed herein are chimeric antigen receptors (“CARs”) comprising an antigen binding site that recognizes citrullinated polypeptides. Citrullinated polypeptides, such as citrullinated vimentin, fibrinogen, and filaggrin, are expressed in the synovium of subjects with rheumatoid arthritis. Further disclosed are T cells, and in particular, Treg cells, that express these CARs. Administration of these CAR-T cells is useful in the treatment of rheumatoid arthritis as well as other diseases associated with citrullinated peptides.
Description
- This application claims the benefit of U.S. Provisional Application No. 63/227,320, filed Jul. 29, 2021, and U.S. Provisional Application No. 63/339,361, filed May 6, 2022, each of which is hereby incorporated by reference in its entirety.
- The contents of the electronic sequence listing (237752000340SEQLIST.xml; Size: 50,843 bytes; and Date of Creation: Jul. 28, 2022) is herein incorporated by reference in its entirety.
- The present disclosure relates to chimeric antigen receptors reactive with citrullinated antigens and regulatory T cells expressing the receptors for treating autoimmune disease.
- Autoimmune diseases affect a significant number of people. For example. Rheumatoid Arthritis (RA) is a chronic inflammatory disease targeting peripheral joints leading to bone erosion, impairment of mobility, and decreased quality of life. It is affecting 0.5-1% of the population worldwide and the incidence rate keeps rising. The pathogenesis of RA is mainly localized in the synovial joint where immune cells composed of T cells, B cells, macrophages, and dendritic cells infiltrate the synovium. Moreover, fibroblast-like synoviocytes present in the sublining layer of the synovium proliferate and contribute to cartilage damage.
- Synovial hyperplasia in rheumatoid arthritis results in infiltration of the synovium by immune cells, and subsequent cartilage damage and bone erosion.
- Currently there is no cure for RA as well as for many other autoimmune conditions. Lifelong treatment is usually required for patients with RA, which in addition of being extremely expensive, may cause severe side effects in the long term such as infections and rheumatoid arthritis risk.
- The accompanying drawings, which are incorporated herein and form a part of the specification, illustrate exemplary embodiments and, together with the description, further serve to enable a person skilled in the pertinent art to make and use these embodiments and others that will be apparent to those skilled in the art. The invention will be more particularly described in conjunction with the following drawings wherein:
-
FIG. 1 : Initial data comprising an MND promoter and EGFRt backbone showed that CV CARs BVCA1 and SBT01G had strongest response to plate-bound full-length CV (n=2). -
FIG. 2 : Assay with soluble full-length CV showed a dose response only for CV CARs BVCA1 and SBT01G-HL (n=1). -
FIG. 3 : Assay with soluble bead-bound-peptide demonstrated binding specificity (n=1). -
FIG. 4 : MND-SBT01G shows a stronger response to plate-bound, antibody captured CV, but not soluble CV than MND-BVCA1. -
FIG. 5 : Testing of an initial batch of synovial fluid from Innovative Research showed SBT01G gave stronger responses than BVCA1. -
FIG. 6 : Further testing of 15 synovial fluid samples from Swedish patients showed that, for samples that gave a response, SBT01G was stronger than BVCA1. -
FIG. 7 : Primary Treg responses to synovial fluid (SF) demonstrate SBT01G is more sensitive than BVCA1 to SF from RA patients. -
FIG. 8 : SBT01G, but not BVCA1, is also able to respond to plate-bound full-length PAD2 citrullinated fibrinogen. -
FIG. 9 SBT01G CAR as effectors and Tregs respond to Citrullinated Fibrinogen but BVCA1 does not. -
FIG. 10A-10B : Both EF1A and MND promoters demonstrate functional responses by CV CARs to soluble bead-bound-peptide. Thus, the CAR promoter does not influence Treg phenotype. -
FIG. 11 : scFv linker has little to no impact on SBT01G CAR-based function. -
FIG. 12A-12B : SBT01G is expressed by a higher percentage of cells than BVCA1, but BVCA1 and SBT01G CAR-T cells have similar FoxP3 and Helios profiles. -
FIG. 13 : CV-CAR Treg cells (SBT01G) but not untransduced Treg cells are activated by citrullinated vimentin (CV). Activation was demonstrated by target antigen-specific increases in proliferation, CD71 expression and IL-10 secretion. -
FIG. 14 : CV-CAR Treg cells respond to citrullinated proteins in the synovial fluid from the majority of RA patients. In contrast, CV-CAR Treg cells do not respond to synovial fluid from normal controls (subjects without RA). -
FIG. 15 : CV-CAR Treg cells (SBT01G) but not untransduced Treg cells from two donors are specifically activated by synovial fluid from RA patients. -
FIG. 16A-16B : Assessment of the suppressive function of CV-CAR Treg cells.FIG. 16A shows that CV-CAR Treg cells are able to suppress proliferation of CD3/CD28-preactivated Teff cells in the presence but not the absence of CV.FIG. 16B shows that CV-CAR Treg cells are able to suppress proliferation of CD19-CAR Teff cells in the presence of CV, whereas untransduced Treg cells are not. -
FIG. 17 : A timeline of human CV-CAR Treg cell activation in vivo in a lipopolysaccharide (LPS)-induced, murine model of pulmonary inflammation is shown. In brief, human CV-CAR Treg cells were administered intravenously (IV) onDay 0, human IL-2 was administered intraperitoneally (IP) twice daily, and LPS was administered intranasally (IN) onDays Day 13, mice were sacrificed and organs were harvested to facilitate analysis of Treg cells. -
FIG. 18A-18B : Flow cytometry dot plots comparing epidermal growth factor (EGFR) expression by human CV-CAR Treg cells versus of levels of Cell Trace Violet (CTV) are shown.FIG. 18A shows how a proliferation ratio of the CV-CAR Tregs (EGFR+) was determined. Specifically, the proliferation ratio equals the % of EGFR+, CTV− cells divided by the % of EGFR+, CTV− cells.FIG. 18B shows how a fold change in EGFR ratio was determined. -
FIG. 19A-19B : CV-CAR Tregs proliferate in a LPS-induced, murine model of pulmonary inflammation but not in control recipients of PBS.FIG. 19A shows the absolute number of CD45+, CD3+ Tregs in the lungs of various study groups, whileFIG. 19B shows the proliferation ratio of the Tregs in the lungs of various study groups. - Regulatory T cells (Tregs) are defective in patients and mouse models of RA. Therefore, Treg-based adoptive cell therapy (ACT) represents a promising approach in RA. In fact, Treg-based ACT reverses disease in animal models of RA. In this study, an antibody isolated from a RA patient was used to engineer a CAR specific for citrullinated vimentin (CV) and other posttranslational modified proteins found abundantly and almost exclusively in the synovial extracellular matrix (ECM) of affected joints.
- Disclosed herein are chimeric antigen receptors (CAR) which specifically recognize antigens associated with autoimmune diseases. In particular, the CARs can be specific for post-translationally modified antigens. In particular, the CARs can be specific for binding to citrullinated polypeptides, including vimentin, citrullinated filaggrin and citrullinated fibrinogen.
- Chimeric antigen receptors (CAR) were engineered to specifically target post-translationally modified proteins, namely citrullinated vimentin, citrullinated filaggrin and citrullinated fibrinogen, that are expressed in the extracellular matrix of inflamed joints in patients with Rheumatoid Arthritis (RA). In some embodiments, the single chain fragment variable (scFv) part of the CAR is obtained from an antibody highly specific for citrullinated proteins isolated from the peripheral blood of an RA patient. In one embodiment, specific scFv chains were inserted into a second-generation CAR construct. In some embodiments, the scFv chains were inserted into a CAR construct cloned in a lentiviral vector. In the detailed description, references to antibodies are applicable to antigen-binding domains of the CARs of the present disclosure unless the context indicates otherwise.
- Unless otherwise specified, terms and symbols of biochemistry, nucleic acid chemistry, molecular biology, developmental biology and molecular genetics follow those of standard treaties and texts in the field, for example, Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Edition (Cold Spring Harbor Press, 1989); Alberts and Singer, Developmental Biology, Eighth Edition (Sinauer Associates Inc., Sunderland, MA, 2006); Kornberg and Baker, DNA Replication, Second Edition (W.H. Freeman, New York, 1992); Gaits, ed., Oligonucleotide Synthesis: A Practical Approach (IRL Press, Oxford, 1984); Lehninger, Biochemistry, Second Edition (Worth Publishers, New York, 1975); Eckstein, ed., Oligonucleotides and Analogs: A Practical Approach (Oxford University Press, New York, 1991); and the like.
- As used herein, the terms “antigen,” “immunogen,” and “antibody target,” refer to a molecule, compound, or complex that is recognized by an antibody, i.e., can be bound by the antibody. The term can refer to any molecule that can be recognized by an antibody, e.g., a polypeptide, polynucleotide, carbohydrate, lipid, chemical moiety, or combinations thereof (e.g., phosphorylated or glycosylated polypeptides, etc.). One of skill will understand that the term does not indicate that the molecule is immunogenic in every context, but simply indicates that it can be targeted by an antibody.
- As used herein, the term “epitope” refers to the localized site on an antigen that is recognized and bound by an antibody. Epitopes can include a few amino acids or portions of a few amino acids, e.g., 5 or 6, or more, e.g., 20 or more amino acids, or portions of those amino acids. In some cases, the epitope includes non-protein components, e.g., from a carbohydrate, nucleic acid, or lipid. In some cases, the epitope is a three-dimensional moiety. Thus, for example, where the target is a protein, the epitope can be comprised of consecutive amino acids, or amino acids from different parts of the protein that are brought into proximity by protein folding (e.g., a discontinuous epitope).
- As used herein, the term “antibody” refers to a polypeptide comprising a framework region from an immunoglobulin gene, that specifically bind and recognize an antigen. Typically, the “variable region” contains the antigen-binding region of the antibody (or its functional equivalent) and is most critical in specificity and affinity of binding. An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kD) and one “heavy” chain (about 50-70 kD).
- Antibodies can be of (i) any of the five major classes of immunoglobulins, based on the identity of their heavy-chain constant domains—alpha (IgA), delta (IgD), epsilon (IgE), gamma (IgG) and mu (IgM), or (ii) subclasses (isotypes) thereof (E.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2). The light chains can be either lambda or kappa.
- The following are a non-exhaustive list of different antibody forms, all retaining antigen binding activity:
-
- (1) whole immunoglobulins (also referred to as “intact” antibodies) (two light chains and two heavy chains, e.g., a tetramer);
- (2) an immunoglobulin polypeptide (a light chain or a heavy chain);
- (3) an antibody fragment, such as Fv (a monovalent or bi-valent variable region fragment, and can encompass only the variable regions (e.g., VL and/or VH), Fab (VLCL VHCH), F(ab′)2, Fv (VLVH), scFv (single chain Fv) (a polypeptide comprising a VL and VH joined by a linker, e.g., a peptide linker), (scFv)2, sc(Fv)2, bispecific sc(Fv)2, bispecific (scFv)2, minibody (sc(FV)2 fused to CH3 domain), diabody (noncovalent dimer of single-chain Fv (scFv) fragment that consists of the heavy chain variable (VH) and light chain variable (VL) regions connected by a small peptide linker), triabody is trivalent sc(Fv)3 or trispecific sc(Fv)3;
- (4) a multivalent antibody (an antibody comprising binding regions that bind two different epitopes or proteins, e.g., “scorpion” antibody;
- (5) a fusion protein comprising a binding portion of an immunoglobulin fused to another amino acid sequence (such as a fluorescent protein); and
- (6) heavy chain only antibody or antibody fragment having only two heavy chains and lacking the two light chains usually found in antibodies.
- Production and properties of tandem scFvs and diabodies are described, e.g., in Asano et al. (2011) J Biol. Chem. 286:1812; Kenanova et al. (2010) Prot Eng Design Sel 23:789; Asano et al. (2008) Prot Eng Design Sel 21:597.
- The phrase “CDR sequence set” as used herein refers to the 3 heavy chain and/or 3 light chain CDRs of a particular antibody described herein. A “light chain” CDR sequence set refers to the light chain CDR sequences. A “heavy chain” CDR sequence set refers to the heavy chain CDR sequences. A “full” CDR sequence set refers to both heavy chain and light chain CDR sequences. CDRs are predicted based on IMGT sequence alignment.
- As used herein, the term “chimeric antibody” refers to an antibody having amino acid sequences derived from two or more species. In one embodiment, the variable region of both light and heavy chains correspond to the variable region of antibodies derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity and capability, while the constant region are homologous the sequence derived from another species (typically in the subject receiving the therapy, e.g., human) to avoid eliciting an immune response.
- As used herein, the term “humanized antibody” refers to a chimeric antibody in which the CDRs, obtained from the VH and VL regions of a non-human antibody having the desired specificity, affinity and capability are grafted to a human framework sequence. In one embodiment, the framework residues of the humanized antibody are modified to refine and optimize the antibody specificity, affinity and capability. Humanization, i.e., substitution of non-human CDR sequences for the corresponding sequences of a human antibody, can be performed following the methods described in, e.g., U.S. Pat. Nos. 5,545,806; 5,569,825; 5,633,425; 5,661,016; Riechmann et al., Nature 332:323-327 (1988); Marks et al., Bio/Technology 10:779-783 (1992); Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14:845-51 (1996).
- As used herein, the term “human antibody” refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding thereto made by any technique known in the art.
- The specificity of the binding can be defined in terms of the comparative dissociation constants (Kd) of the antibody (or other targeting moiety) for target, as compared to the dissociation constant with respect to the antibody and other materials in the environment or unrelated molecules in general. A larger (higher) Kd is a Kd that describes a lower affinity interaction. Conversely a smaller (lower) Kd is a Kd that describes a higher affinity interaction or tighter binding. By way of example only, the Kd for an antibody specifically binding to a target may be femtomolar, picomolar, nanomolar, or micromolar and the Kd for the antibody binding to unrelated material may be millimolar or higher. Binding affinity can be in the micromolar range (kD=10−4 to 10−6), nanomole range (kD=10−7 M to 10−9 M), picomole range (kD=10−10 M to 10−12 M), or femtomole range (kD=10−13 M to 10−15 M).
- As used herein, an antibody “binds” or “recognizes” an antigen or epitope if it binds the antigen or epitope with a Kd of less than 10−4 M (i.e., in the micromolar range). The term “binds” with respect to a cell type (e.g., an antibody that binds cancer cells), typically indicates that an agent binds a majority of the cells in a pure population of those cells. For example, an antibody that binds a given cell type typically binds to at least ⅔ of the cells in a population of the indicated cells (e.g., 67, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%). In some cases, binding to a polypeptide can be assayed by comparing binding of the antibody to a cell that presents the polypeptide to binding (or lack thereof) of the antibody to a cell that does not express the polypeptide. One of skill will recognize that some variability will arise depending on the method and/or threshold of determining binding. Affinity of an antibody for a target can be determined according to methods known in the art, e.g., as reviewed in Ernst et al. Determination of Equilibrium Dissociation Constants, Therapeutic Monoclonal Antibodies (Wiley & Sons ed. 2009).
- As used herein, the term “greater affinity” as used herein refers to a relative degree of antibody binding where an antibody X binds to target Y more strongly (Kon) and/or with a smaller dissociation constant (Koff) than to target Z, and in this context antibody X has a greater affinity for target Y than for Z. Likewise, the term “lesser affinity” herein refers to a degree of antibody binding where an antibody X binds to target Y less strongly and/or with a larger dissociation constant than to target Z, and in this context antibody X has a lesser affinity for target Y than for Z. The affinity of binding between an antibody and its target antigen, can be expressed as KA equal to 1/KD where KD is equal to kon/koff. The kon and koff values can be measured using surface plasmon resonance technology, for example, using a Molecular Affinity Screening System (MASS-1) (Sierra Sensors GmbH, Hamburg, Germany). An antagonist or blocking antibody is an antibody that partially or fully blocks inhibits or neutralizes a biological activity related to the target antigen relative to the activity under similar physiological conditions when the antibody is not present. Antagonists can be competitive, non-competitive or irreversible. A competitive antagonist is a substance that binds to a natural ligand or receptor at the same site as the natural ligand-receptor interaction or binds allosterically in a manner that induces a change to prevent normal binding. A non-competitive antagonist binds at a different site than the natural ligand-receptor interaction, but lower the KD or signal resulting from the interaction. An irreversible inhibitor causes covalent modifications to the receptor preventing any subsequent binding.
- As used herein, the term “avidity” refers to the overall stability of the binding complex between the antibody and the target antigen. It is governed by three factors, (i) the intrinsic affinity of the antibody for the antigen, (2) the valency of the antibody, and (3) the geometric arrangement of the interacting components. Affinity is the strength of the interaction between the antibody and a single target, whereas avidity is an accumulated strength of multiple affinities. In one embodiment, the antibodies provided herein are divalent.
- As used herein, an antibody “preferentially binds” binds a first antigen relative to a second antigen if it binds the first antigen with greater affinity than it does the second antigen. Preferential binding can be at least any of 2-fold, 5-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 100-fold, 500-fold or 1000-fold greater affinity.
- As used herein, an antibody “specifically binds” or is “specific for” a target antigen or target group of antigens if it binds the target antigen or each member of the target group of antigens with an affinity of at least any of 1×10−6 M, 1×10−7 M, 1×10−8 M, 1×10−9 M, 1×10−10 M, 1×10−11 M, 1×10−12 M, and, for example, binds to the target antigen or each member of the target group of antigens with an affinity that is at least two-fold greater than its affinity for non-target antigens to which it is being compared. Typically, specific binding is characterized by binding the antigen with sufficient affinity that the antibody is useful as a diagnostic to detect the antigen or epitope and/or as a therapeutic agent in targeting the antigen or epitope.
- As used herein, the term “polypeptide” refers to a molecule having a sequence of natural and/or unnatural amino acids connected through peptide bonds. The term “peptide” refers to a short polypeptide, typically no more than 30 amino acids long. The amino acid sequence of a polypeptide is referred to as its “primary structure.” The term “protein” refers to a polypeptide having a secondary, tertiary and/or quaternary structure, e.g., structures stabilized by hydrogen bonds, relationships between secondary structures and structures formed of more than one protein. Proteins can be further modified by other attached moieties such as carbohydrate (glycoproteins), lipids (lipoproteins) phosphate groups (phosphoproteins) and the like.
- As used herein, an amino acid sequence “consists of” only the amino acids in that sequence.
- As used herein, a first amino acid sequence “consists essentially of” a second amino acid sequence if the first amino acid sequence (1) comprises the second amino sequence and (2) is no more than 1, no more than 2 or no more than 3 amino acids longer than the second amino acid sequence.
- As used herein, a first amino acid sequence is a “fragment” of a second amino acid sequence if the second amino acid sequence comprises the first amino acid sequence. In certain embodiments, a first amino acid sequence that is a fragment of a second amino acid sequence may have no more than any of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 fewer amino acids than the second amino acid sequence.
- As used herein, a “functional equivalent” of a reference amino acid sequence is a sequence that is not identical to the reference sequence, but that contains minor alterations such as, for example, insertion, deletion or substitution of one or a few amino acids. A functionally equivalent sequence retains the function (e.g., immunogenicity) of the reference sequence to which it is equivalent. If a functionally equivalent amino acid sequence contains substitution of one or more amino acids with respect to the reference sequence, these will generally be conservative amino acid substitutions.
- As used herein, a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue without abolishing the protein's desired properties. Suitable conservative amino acid substitutions can be made by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another. See, e.g., Watson, et al., “Molecular Biology of the Gene,” 4th Edition, 1987, The Benjamin/Cummings Pub. Co., Menlo Park, CA, p. 224. Examples of conservative amino acid substitution include the following (Note, some categories are not mutually exclusive):
-
Conservative Substitutions Type of Amino Acid Substitutable Amino Acids Hydrophilic Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr Sulphydryl Cys Aliphatic Ala, Val, Ile, Leu, Met, Gly, Pro (non-polar, hydrophobic) Basic Lys, Arg, His Aromatic Phe, Tyr, Trp - As used herein, the term “substantially identical” refers to identity between a first amino acid sequence that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity and/or common immunogenicity. For example, amino acid sequences that contain a common structural or antigenic domain having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity are termed sufficiently or substantially identical. In the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity, or encode polypeptides having the same immunogenic properties.
- As used herein, a chemical entity, such as a polypeptide, is “substantially pure” or “isolated” if it is the predominant chemical entity of its kind (e.g., of polypeptides) in a composition. This includes the chemical entity representing more than 50%, more than 80%, more than 90%, more than 95%, more than 98%, more than 99%, more than 99.5%, more than 99.9%, or more than 99.99% of the chemical entities of its kind in the composition. A substantially purified fraction is a composition wherein the object species comprises at least about 50% (on a molar basis) of all macromolecular species present. Generally, a substantially pure composition means that about 80% to 90% or more of the macromolecular species present in the composition is the purified species of interest. The object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) if the composition consists essentially of a single macromolecular species. Solvent species, small molecules, stabilizers (e.g., BSA), and elemental ion species are not considered macromolecular species for purposes of this definition.
- The phrase “isolated antibody” refers to antibody produced in vivo or in vitro that has been removed from the source that produced the antibody, for example, an animal, hybridoma or other cell line (such as recombinant insect, yeast or bacterial cells that produce antibody).
- The term “sequence identity” as used herein refers to the percentage of sequence identity between two polypeptide sequences or two nucleic acid sequences. To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino acid or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=number of identical overlapping positions/total number of positions.times.100%). In one embodiment, the two sequences are the same length. The determination of percent identity between two sequences can also be accomplished using a mathematical algorithm. A preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873-5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al., 1990, J. Mol. Biol. 215:403. BLAST nucleotide searches can be performed with the NBLAST nucleotide program parameters set, e.g., for score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecules of the present application. BLAST protein searches can be performed with the XBLAST program parameters set, e.g., to score—50, wordlength=3 to obtain amino acid sequences homologous to a protein molecule described herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402. Alternatively, PSI-BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g., of XBLAST and NBLAST) can be used (see, e.g., the NCBI website). Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4:11-17. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. The percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
- For antibodies, percentage sequence identities can be determined when antibody sequences maximally aligned by IMGT. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, multiplied by 100 to convert to percentage.
- Percent amino acid sequence identity may also be determined using the sequence comparison program NCBI-BLAST2 (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)). The NCBI-BLAST2 sequence comparison program may be obtained from the National Institute of Health, Bethesda, Md. NCBI-BLAST2 uses several search parameters, wherein all of those search parameters are set to default values including, for example, unmask=yes, strand=all, expected occurrences=10, minimum low complexity length=15/5, multi-pass e-value=0.01, constant for multi-pass=25, dropoff for final gapped alignment=25 and scoring matrix=BLOSUM62.
- In situations where NCBI-BLAST2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. The term “nucleic acid sequence” as used herein refers to a sequence of nucleoside or nucleotide monomers consisting of naturally occurring bases, sugars and intersugar (backbone) linkages and includes cDNA. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof. The nucleic acid sequences of the present application may be deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil. The sequences may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil; and xanthine and hypoxanthine. It is understood that polynucleotides comprising non-transcribable nucleotide bases may be useful as probes in, for example, hybridization assays. The nucleic acid can be either double stranded or single stranded, and represents the sense or antisense strand. Further, the term “nucleic acid” includes the complementary nucleic acid sequences as well as codon optimized or synonymous codon equivalents.
- The term “isolated nucleic acid” as used herein refers to a nucleic acid substantially free of cellular material or culture medium when produced by recombinant DNA techniques, or chemical precursors, or other chemicals when chemically synthesized. An isolated nucleic acid is also substantially free of sequences that naturally flank the nucleic acid (i.e. sequences located at the 5′ and 3′ ends of the nucleic acid) from which the nucleic acid is derived.
- Hybridization may occur to all or a portion of a nucleic acid sequence molecule. The hybridizing portion is typically at least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length. Those skilled in the art will recognize that the stability of a nucleic acid duplex, or hybrids, is determined by the Tm, which in sodium containing buffers is a function of the sodium ion concentration and temperature (Tm=81.5° C.−16.6 (Log 10[Na+])+0.41(%(G+C)−600/I), or similar equation). Accordingly, the parameters in the wash conditions that determine hybrid stability are sodium ion concentration and temperature. In order to identify molecules that are similar, but not identical, to a known nucleic acid molecule a 1% mismatch may be assumed to result in about a 1° C. decrease in Tm, for example, if nucleic acid molecules are sought that have a >95% identity, the final wash temperature will be reduced by about 5° C. Based on these considerations those skilled in the art will be able to readily select appropriate hybridization conditions. In preferred embodiments, stringent hybridization conditions are selected. By way of example the following conditions may be employed to achieve stringent hybridization: hybridization at 5× sodium chloride/sodium citrate (SSC)/5× Denhardt's solution/1.0% SDS at Tm−5° C. based on the above equation, followed by a wash of 0.2×SSC/0.1% SDS at 60° C. Moderately stringent hybridization conditions include a washing step in 3×SSC at 42° C. It is understood, however, that equivalent stringencies may be achieved using alternative buffers, salts and temperatures. Additional guidance regarding hybridization conditions may be found in: Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 2002, and in: Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001.
- As used herein, the term “expression construct” refers to a polynucleotide comprising an expression control sequence operatively linked with a heterologous nucleotide sequence (i.e., a sequence to which the expression control sequence is not normally connected to in nature) that is to be the subject of expression. As used herein, the term “expression vector” refers to a polynucleotide comprising an expression construct and sequences sufficient for replication in a host cell or insertion into a host chromosome. Plasmids and viruses are examples of expression vectors. As used herein, the term “expression control sequence” refers to a nucleotide sequence that regulates transcription and/or translation of a nucleotide sequence operatively linked thereto. Expression control sequences include promoters, enhancers, repressors (transcription regulatory sequences) and ribosome binding sites (translation regulatory sequences).
- As used herein, a nucleotide sequence is “operatively linked” with an expression control sequence when the expression control sequence functions in a cell to regulate transcription of the nucleotide sequence. This includes promoting transcription of the nucleotide sequence through an interaction between a polymerase and a promoter.
- The term “vector” as used herein comprises any intermediary vehicle for a nucleic acid molecule which enables said nucleic acid molecule, for example, to be introduced into prokaryotic and/or eukaryotic cells and/or integrated into a genome, and include plasmids, phagemids, bacteriophages or viral vectors such as retroviral based vectors, lentiviral vectors, Adeno Associated viral vectors and the like. The term “plasmid” as used herein generally refers to a construct of extrachromosomal genetic material, usually a circular DNA duplex, which can replicate independently of chromosomal DNA.
- “Transfection” refers to the introduction of new genetic material into a cell. It includes transformation (the direct uptake and incorporation of exogenous genetic material from its surroundings through the cell membrane), transduction (the introduction of foreign DNA by a bacteriophage virus into a host cell) and conjugation.
- As used herein, a “host cell” refers to a recombinant cell comprising an expression construct.
- As used herein, the term “biological sample” refers to a sample containing cells (e.g., tumor cells) or biological molecules derived from cells.
- As used herein, the term terms “therapy,” “treatment,” “therapeutic intervention” and “amelioration” refer to any activity resulting in a reduction in the severity of symptoms. The terms “treat” and “prevent” are not intended to be absolute terms. Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc. Treatment and prevention can be complete or partial. The effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment. In some aspects, the severity of disease is reduced by at least 10%, as compared, e.g., to the individual before administration or to a control individual not undergoing treatment. In some aspects, the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques. “Treating” and “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. “Treating” and “treatment” as used herein also include prophylactic treatment.
- Compositions or methods “comprising” or “including” one or more recited elements may include other elements not specifically recited (e.g., open-ended terms meaning including but not limited to). For example, a composition that “comprises” or “includes” an antibody may contain the antibody alone or in combination with other ingredients. In contrast, the phrase “consisting of” is closed, indicating that such embodiments do not include additional elements. The term “consisting essentially of” refers to the inclusion of recited elements and other elements that do not materially affect the basic and novel characteristics of a claimed combination (e.g., partially closed term). It is understood that aspects and embodiments described herein as “comprising” include “consisting of” and “consisting essentially of” embodiments.
- As used herein, the following meanings apply unless otherwise specified. The word “may” is used in a permissive sense (i.e., meaning having the potential to), rather than the mandatory sense (i.e., meaning must). The singular forms “a,” “an,” and “the” include plural referents. Thus, for example, reference to “an element” includes a combination of two or more elements, notwithstanding use of other terms and phrases for one or more elements, such as “one or more.” The phrase “at least one” includes “one”, “one or more”, “one or a plurality” and “a plurality”. The term “or” is, unless indicated otherwise, non-exclusive, i.e., encompassing both “and” and “or.” The term “any of” between a modifier and a sequence means that the modifier modifies each member of the sequence. So, for example, the phrase “at least any of 1, 2 or 3” means “at least 1, at least 2 or at least 3”.
- “Chimeric antigen receptors” or “CARs” are engineered molecules comprising an optional signal peptide, a target binding domain, an optional hinge region, a transmembrane domain, an intracellular signaling domain and an optional co-stimulatory domain. CARs are based on the structure of T cell receptors, which are expressed on T cells and which are involved in the cell-mediated immune response. The “target binding domain” is also referred to herein as an “antigen binding domain”, and as such the term “target” encompasses an “antigen.”
- So-called “first-generation” CARs had a targeting domain and a CD3ξ signal transduction domain. So-called “second generation” CARs further included a co-stimulatory domain, such as a CD28 or 4-1BB domain. So-called “third generation” CARs comprise multiple co-stimulatory domains. So-called “fourth generation” CARs, also referred to as “TRUCKS” are engineered to release a transgenic cytokine upon CAR signaling.
- Chimeric antigen receptors (“CARs”) include the following elements: (1) an optional signal peptide, (2) a target binding domain, (3) an optional hinge region; (4) a transmembrane region; (5) an intracellular domain comprising a signal transduction domain. Optionally, the CAR can include any of: a CD3ζ signal transduction domain, an Fc receptor signal transduction domain, a co-stimulatory (signal transduction) domain. That is, these optional elements can be included in addition to or instead of other optional elements. The target binding domain is heterologous to at least one of the other domains. That is, the target binding domain does not naturally occur on a T cell receptor, or is not in the same protein as at least one of the other domains.
- The “target binding domain” provides binding specificity to the CAR. The “signal peptide” guides the polypeptide through the cell membrane. The target binding domain can bind to a domain of an antibody that binds to the target antigen for a so-called “Universal CAR”. The “hinge region” is a flexible connector region, e.g., a natural or synthetic polypeptide, or any other type of molecule, providing structural flexibility and spacing to flanking polypeptide regions. The “transmembrane domain” is a membrane-spanning protein domain, typically hydrophobic. The “signal transduction domain” or “signaling domain” transmits a signal through a signal transduction pathway into the cell upon binding. Such signaling activates an activity of the cell. “Co-stimulatory domains” are accessory signaling domains that further transmit signals.
- In some embodiments, the CAR comprises:
-
- (i) an target-binding domain (also referred to herein as an antigen binding domain) reactive with a citrullinated protein or citrullinated fragment thereof, such as a VH-VL or VL-VH, wherein the two variable domains are separated by a flexible linker of from 15-25 amino acids in length;
- (ii) a hinge domain;
- (iii) a co-stimulatory domain; and
- (iv) an intracellular signaling domain (also referred to herein as an activation domain). That is, in some embodiments the CAR comprises an antigen-binding domain fused to a CAR platform comprising a hinge domain, a transmembrane domain, and an intracellular domain comprising a costimulatory domain and an activation domain. The CAR may further include a signal peptide (also referred to herein as a leader sequence) to direct expression of the CAR to the surface of a cell, such as a Treg.
- In some embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:15, SEQ ID:17, SEQ ID NO:28, and SEQ ID:19. In other embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:28, and SEQ ID:19. In some embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:29, and SEQ ID:19. In other embodiments, the CAR comprises an antigen-binding domain fused in frame to a CAR platform comprising the amino acid sequences of SEQ ID NO:30, SEQ ID:16, SEQ ID NO:29, and SEQ ID:19.
- A signal peptide can be any peptide having the function of allowing a polypeptide to traverse a cell membrane. The signal peptide can be derived from CD4, CD8, CD28, TLR or immunoglobulin family of receptors.
- For example, the signal peptide can comprise the sequence:
-
(SEQ ID NO: 18) MLLLVTSLLLCELPHPAFLLIP; or (SEQ ID NO: 23) MALPVTALLLPLALLLHAAR - The target binding domain can include any polypeptide comprising a target binding function, e.g., an antibody as defined herein. In one embodiment, the target binding domain can comprise an antibody form retaining antigen binding activity as defined herein. In one embodiment, the target binding domain can comprise a single chain antibody (scFV). The scFv can be connected to the transmembrane domain via a hinge domain whose length, flexibility and origin provides variability in the CAR's design, and can, along with the transmembrane domain, contribute to the interaction with antigen, building of the immunologic synapse and impact the CAR's association with additional proteins needed to impart a robust activation signal.
- Chimeric antigen receptors disclosed herein comprise a target binding domain (also referred to herein as an antigen-binding domain) that binds to citrullinated antigens, e.g., those found in the synovium of subjects with rheumatoid arthritis. In particular, the target binding domain can bind to one or more of (i) citrullinated vimentin, (ii) citrullinated filaggrin, (iii) citrullinated fibrinogen and (iv) citrullinated peptides thereof. In some embodiments, the target binding domain can bind to a citrullinated peptide fragment of (i)-(iii), wherein the peptide fragment is at least of 10 amino acids in length, e.g. of at least 12 amino acids, at least 14 amino acids or at least 16 amino acids in length. In some embodiments, the target binding domain further binds to tenascin C. In some embodiments, the target binding domain can bind to two or more of (i) citrullinated vimentin, (ii) citrullinated filaggrin, (iii) citrullinated fibrinogen, and (iv) tenascin C, or citrullinated peptide fragments thereof.
- In some embodiments, the target domain is one or more citrullinated peptides selected from the following sequences:
-
(SEQ ID NO: 24) ST(Cit)SVSSSSY(Cit)(Cit)MFGG; (SEQ ID NO: 25) VYAT(Cit)SSAV(Cit)L(Cit)SSV; (SEQ ID NO: 26) (Cit)PAPPPISGGGY(Cit)A(Cit); (SEQ ID NO: 27) SHQEST(Cit)GRSRGRSGRSGS - In some embodiments, the antigen binding domain binds to one or more citrullinated peptides, but does not bind to non-citrullinated counterparts. In some embodiments, the antigen binding domain binds to a citrullinated vimentin peptide set forth as SEQ ID NO:24, but not STRSVSSSSYRRMFGG (SEQ ID NO:45). In some embodiments, the antigen binding domain binds to a citrullinated vimentin peptide set forth as SEQ ID NO:25, but not VYATRSSAVRLRSSV (SEQ ID NO:46). In some embodiments, the antigen binding domain binds to a citrullinated fibrinogen peptide set forth as SEQ ID NO:26, but not RPAPPPISGGGYRAR (SEQ ID NO:47). In some embodiments, the antigen binding domain binds to a citrullinated filaggrin peptide set forth as SEQ ID NO:27, but not SHQESTRGRSRGRSGRSGS (SEQ ID NO:48).
- The target binding domain can comprise sequences from an antibody VH and VL domain. In some embodiments, the target binding domain can comprise sequences from heavy chain only antibody or antibody fragment having only two VH domains. This includes particular CDR sets from VH and VL domains. In some embodiments the target binding domain comprises the CDRs from the VH domains of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments the target binding domain comprises the CDRs from the VL domains of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3, respectively. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4, respectively. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:3, respectively. In some embodiments the target binding domain comprises the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4, respectively.
- In some embodiments the target binding domain comprises the complementarity-determining regions (CDRs) from VH and VL domains of SEQ ID NO:1 (SBT01 VH (M)) and SEQ ID NO:4 (SBT01 VL (G)). In some embodiments, the VH domain of the target-binding domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
-
Sequence Region SEQ ID Fragment Residues Length HFR1 NO: 31 HLHLQESGPGLVKPS 1-30 30 ETLSLTCTVSGGSIN CDR-H1 NO: 32 DTTYYWG 31-37 7 HFR2 NO: 33 WIRQPPGKGLEWIG 38-51 14 CDR-H2 NO: 34 SIYYRGNTHYNSSL 52-67 16 RS HFR3 NO: 35 RVTMSVDTSKNRFS 68-99 32 LKVTSVTAADTAVY YCAR CDR-H3 NO: 36 LDPFDY 100-105 6 HFR4 NO: 37 WGRGTLVTVSS 106-116 11 -
Sequence Region SEQ ID Fragment Residues Length LFR1 NO: 38 SYVLTQPPSVSVA 1-22 22 PGKTARITC CDR-L1 NO: 39 GGNNIGSKSVH 23-33 11 LFR2 NO: 40 WYQQKPGQAPVL 34-48 15 VIY CDR-L2 NO: 41 YDSDRPS 49-55 7 LFR3 NO: 42 GIPERFSGSNSGNT 56-87 32 ATLTISRVEAGDEA DYYC CDR-L3 NO: 43 QVWDSSSDHQV 88-98 11 LFR4 NO: 44 FGTGTKVTV 99-108 11 - In certain embodiments, the target binding domain comprises VH sequences selected from:
-
(1) SBT01 VH (M) (SEQ ID NO: 1) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIR QPPGKGLEWIGSIYYRGNTHYNSSLRSRVTMSVDTSKNRF SLKVTSVTAADTAVYYCARLDPFDYWGRGTLVTVSS; (2) SBT01 VH (G) (SEQ ID NO: 2) QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIR QPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCARLDPFDYWGRGTLVTVSS;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences, provided target binding domain binds to a citrullinated antigen as described herein.
- The target binding region can comprise VL sequences selected from:
-
(1) SBT01 VL (M) (SEQ ID NO: 3) SYVLTQPPSVSLAPGETATITCGGDDIENQNVNWYQQKSG QAPMLLIFFDTRRPSGIPERFSGSRSEDTANLTITRVEAG DDADYFCQVYDRKTDHQVFGPGTTVTVL; (2) SBT01 VL (G) (SEQ ID NO: 4) SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPG QAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHQVFGTGTKVTVL;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences, provided target binding domain binds to a citrullinated antigen as described herein.
- In another embodiment, the antigen binding region comprises an scFV comprising one or more VH domains comprising an amino acid sequence of VH domains of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:1 or SEQ ID NO:2, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the scFV comprises the VL domains of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 3 or SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the scFV domain comprises the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3, respectively. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 or SEQ ID NO:3, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- In some embodiments, the scFV domain comprises the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4, respectively. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 and SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- In some embodiments, the scFV domain comprises the VH and VL domains of SEQ ID NO: 2 and SEQ ID NO:3, respectively. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 3, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- In some embodiments, the scFV domain comprises the VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4, respectively. In some embodiments, the antigen binding region comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 4, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, a linker selected from SEQ ID NO: 20, SEQ ID NO: 21 or SEQ ID NO: 22 is placed between the VH and VL domains.
- In another embodiment, the antigen binding region comprises an scFV comprising an amino acid sequence selected from:
-
SBT01G-VHVL-GGGSx3 Linker-pSB_0149 (SEQ ID NO: 5) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIR QPPGKGLEWIGSIYYRGNTHYNSSLRSRVTMSVDTSKNRF SLKVTSVTAADTAVYYCARLDPFDYWGRGTLVTVSS GGGG SGGGGSGGGGS SYVLTQPPSVSVAPGKTARITCGGNNIGS KSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNT ATLTISRVEAGDEADYYCQVWDSSSDHQVFGTGTKVTVLR (GGGSx3 linker underlined); SBT01G-VHVL-Whitlow 218 Linker-pSB_0158 (SEQ ID NO: 6) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIR QPPGKGLEWIGSIYYRGNTHYNSSLRSRVTMSVDTSKNRF SLKVTSVTAADTAVYYCARLDPFDYWGRGTLVTVSS GSTS GSGKPGSGEGSTKG SYVLTQPPSVSVAPGKTARITCGGNN IGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNS GNTATLTISRVEAGDEADYYCQVWDSSSDHQVFGTGTKVT VLR (Whitlow 218 Linker underlined); SBT01G-VHVL-AB pur Linker-pSB_0159 (SEQ ID NO: 7) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIR QPPGKGLEWIGSIYYRGNTHYNSSLRSRVTMSVDTSKNRF SLKVTSVTAADTAVYYCARLDPFDYWGRGTLVTVSS ASSG GSTSGSGKPGSGEGSSGSAR SYVLTQPPSVSVAPGKTARI TCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPER FSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHQVFG TGTKVTVLR (AB pur Linker underlined);
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences, provided target binding domain binds to a citrullinated antigen as described herein.
- For example, the linker can comprise the sequence:
-
(SEQ ID NO: 20) GGGGSGGGGSGGGGS GGGSx3 Linker; or (SEQ ID NO: 21) GSTSGSGKPGSGEGSTKG Whitlow 218 Linker; or (SEQ ID NO: 22) ASSGGSTSGSGKPGSGEGSSGSAR AB pur Linker. - Optionally, any of the foregoing sequences can include the CDR sets from the VH and VL domains described above.
- In some embodiments, the hinge region of the disclosed CARs can be selected from the CD8, CD4, or CD28 extracellular domain, the Fc region of an IgG1 antibody, or the extracellular domain of any of the TLR receptors as is known to one of skill in the art and can be found in the GenBank database.
- For example, the hinge region can comprise the sequence:
-
(SEQ ID NO: 30) IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (CD28); or (SEQ ID NO: 15) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIW APLAGTCGVLLLSLVITLYC (CD8);
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned hinge region sequences.
- The transmembrane domain can comprise a transmembrane domain of an immunoglobulin family receptor, such as CD8. The intracellular domain can be selected from any membrane-spanning molecule on a T cell. For example, the transmembrane (TM) domain of the disclosed CAR can comprise the TM domain of CD2, CD3, CD16, CD32, CD64, CD28, CD247, 4-1BBL, CD4, or CD8.
- For example, the transmembrane domain can comprise the sequence:
-
(SEQ ID NO: 16) FWVLVVVGGVLACYSLLVTVAFIIFWV; or (SEQ ID NO: 17) IYIWAPLAGTCGVLLLSLVITLYC;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned hinge region sequences.
- In some embodiments, the signal transduction domain comprises a CD3ζ signaling domain. The CD3ζ signaling domain of the disclosed CAR molecule can comprise a CD3ζ amino acid sequence, e.g., a signal transduction domain of CD3 zeta.
- For example, the CD3ζ signal transduction domain can comprise the sequence:
-
(SEQ ID NO: 19) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned CD3 zeta signal transduction domain sequence.
- For example, the CD3 zeta signal transduction domain can include amino acids 21-163, 31-142, 68-89 and/or 138-158 of the sequence shown in SEQ ID NO:19, or functional variants thereof (e.g., with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 10-20 amino acid substitutions, deletions, or additions).
- In some embodiments, the signal transduction domain comprises an Fc signaling domain. The Fc signaling domain can be any one of the Fc-alpha, Fc-gamma, Fc-epsilon, Fc-mu, and Fc-delta receptors. For example, the Fc receptor signaling domain can comprise amino acids involved in interaction with Src (e.g., Fgr, Fyn, Hck, Lyn, Yes, and Src) and ZAP-70 family kinases, e.g., one or more ITAM domains (see, e.g., Sanchez-Mejorada et al. (1998) J. Leukocyte Biol. 63:531; Garcia-Garcia et al. (2002) J. Leukocyte Biol. 72:1092). In some embodiments, the Fc receptor signal transduction domain includes at least one ITAM domain, e.g., from any one of the Fc-alpha, Fc-gamma, Fc-epsilon, Fc-mu, and Fc-delta receptors, or substantially identical thereto.
- Sequences also can be found as follows:
-
Molecule GenBank No. CD3ζ NP_000725.1 Fc gamma receptor family (CD16) NP_000560.5 NP_001231682.1 Fc gamma receptor family (CD32) AAH20823.1 AAH19931.1 AAI48274.1 AAI37398.1 Fc gamma receptor family (CD64) AAI60240.1 AAH32634.1 AAI56865.1 - The CARs of this disclosure can include one or more co-stimulatory domains in addition to a signal transduction domain of CD3ζ or an Fc receptor. Co-stimulatory domains can be derived from, for example, CD28, 4-1BB, CD2, CD27, CD30, OX40, CD40, PD-1, PD-Li, PD-L2, ICOS, LFA-1, CD7, LIGHT, NKG2C, B7-H3, CD83L, B7-1 (CO80), B7-2 (CD86), B7-H3, B7-H4 and others. The CAR constructs can contain two or more co-stimulatory signaling domains (e.g., CD28 and 4-1BB).
- The co-stimulatory domain or domains can be positioned between the signal transduction domain and the transmembrane region.
- In certain embodiments, a CD28 co-stimulatory domain can comprise the sequence:
-
(SEQ ID NO: 29) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequence.
- In certain embodiments, a 41BB co-stimulatory domain can comprise the sequence:
-
(SEQ ID NO: 28) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequence.
- Disclosed herein are nucleic acid molecules (polynucleotides) comprising a nucleotide sequence that encodes a CAR of this disclosure. The nucleic acid of the disclosed CAR can be in the form of DNA or in the form of RNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand. RNA includes mRNA, siRNA, sRNA, ssRNA and so on.
- For example, nucleic acids can comprise nucleotide sequences that encode the polypeptides of any of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4. In certain embodiments, the nucleotide sequences encoding VH domains comprise:
-
(1) SBT01 VH (M) (SEQ ID NO: 8) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC, (2) SBT01 VH (G) (SEQ ID NO: 9) CAGCTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTAGTAG TTACTACTGGGGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGG ATTGGGAGTATCTATTATAGTGGGAGCACCTACTACAACCCGTCCCTCA AGAGTCGAGTCACCATATCCGTAGACACGTCCAAGAACCAGTTCTCCCT GAAGCTGAGCTCTGTGACCGCCGCAGACACGGCTGTGTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences.
- In certain embodiments, the nucleotide sequences encoding VL domains comprise:
-
(1) SBT01 VL (M) (SEQ ID NO: 10) TCCTATGTCCTGACTCAGCCACCCTCAGTGTCGCTGGCCCCGGGAGAGA CGGCCACAATTACTTGTGGTGGAGACGACATTGAAAATCAAAATGTCAA CTGGTATCAGCAGAAGTCAGGTCAGGCCCCTATGCTGCTCATCTTCTTT GATACCAGACGGCCCTCAGGGATCCCGGAGCGATTCTCTGGCTCCAGGT CTGAGGACACGGCCAACCTGACCATCACCAGGGTCGAGGCCGGGGATGA CGCCGACTATTTCTGTCAGGTGTATGATAGGAAGACTGATCACCAAGTC TTCGGACCTGGGACCACGGTCACCGTCCTA; (2) SBT01 VL (G) (SEQ ID NO: 11) TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGA CGGCCAGGATTACCTGTGGGGGAAACAACATTGGAAGTAAAAGTGTGCA CTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTAT GATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACT CTGGGAACACGGCCACCCTGACCATCAGCAGGGTCGAAGCCGGGGATGA GGCCGACTATTACTGTCAGGTGTGGGACAGTAGTAGTGATCACCAAGTC TTCGGAACTGGGACCAAGGTCACCGTCCTA;
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences.
- In another embodiment, the nucleic acid molecule encoding VH domains comprise SEQ ID NO: 8 or SEQ ID NO:9. In some embodiments, the nucleic acid molecule encoding VH domains comprise a nucleic sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:8 or SEQ ID NO:9, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the nucleic acid molecule encoding VL domains comprise SEQ ID NO: 10 or SEQ ID NO: 11. In some embodiments, the nucleic acid molecule encoding VL domains comprise a nucleic sequence having at least any 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 10 or SEQ ID NO: 11, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO:8 and SEQ ID NO:10. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 8 or SEQ ID NO:10, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 8 and SEQ ID NO: 11. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 8 or SEQ ID NO:11, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 9 and SEQ ID NO:10. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 9 or SEQ ID NO: 10, provided the scFV domain binds to a citrullinated antigen as described herein.
- In some embodiments, the nucleic acid molecule encoding an scFV domain comprise SEQ ID NO: 9 and SEQ ID NO:11. In some embodiments, the nucleic acid molecule encoding the scFV comprises an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 9 or SEQ ID NO: 11, provided the scFV domain binds to a citrullinated antigen as described herein.
- In another embodiment, the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
-
SBT01G-VHVL-GGGSx3 Linker-pSB_0149 (SEQ ID NO: 12) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC GGTGGCGGTGGCTCGGGCGGTGGTGGGTCGGGTGGCGGCGGATC T TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAG ACGGCCAGGATTACCTGTGGGGGAAACAACATTGGAAGTAAAAGTGTGC ACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTA TGATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAAC TCTGGGAACACGGCCACCCTGACCATCAGCAGGGTCGAAGCCGGGGATG AGGCCGACTATTACTGTCAGGTGTGGGACAGTAGTAGTGATCACCAAGT CTTCGGAACTGGGACCAAGGTCACCGTCCTACGC (GGGSx3 linker underlined);
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequence.
- In another embodiment, the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
-
SBT01G-VHVL-Whitlow 218 Linker-pSB_0158 (SEQ ID NO: 13) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC GGAAGCACGAGTGGTTCAGGCAAACCGGGTTCCGGTGAAGGTTC AACAAAAGGT TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCC CCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACAACATTGGAAGTA AAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGT CATCTATTATGATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCT GGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGGTCGAAG CCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGACAGTAGTAGTGA TCACCAAGTCTTCGGAACTGGGACCAAGGTCACCGTCCTACGC (Whitlow 218 Linker underlined);
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequence.
- In another embodiment, the nucleic acid molecule encodes an scFv molecule and has a nucleotide sequence:
-
SBT01G-VHVL-AB pur Linker-pSB_0159 (SEQ ID NO: 14) CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC GCCTCTAGCGGGGGGAGCACATCAGGAAGCGGCAAGCCCGGTAG CGGCGAAGGCTCCTCTGGCAGCGCCCGC TCCTATGTGCTGACTCAGCCA CCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGG GAAACAACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGG CCAGGCCCCTGTGCTGGTCATCTATTATGATAGCGACCGGCCCTCAGGG ATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGA CCATCAGCAGGGTCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGT GTGGGACAGTAGTAGTGATCACCAAGTCTTCGGAACTGGGACCAAGGTC ACCGTCCTACGC (AB pur Linker underlined);
or -
- a sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% sequence identify with the aforementioned sequences.
- Optionally, these can include sequences encoding the CDR sets from the VH and VL domains described herein.
- The polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In some embodiments, the polynucleotide variants contain alterations that produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded CAR polypeptide. In some embodiments, the polynucleotide variants contain alterations that do not produce any changes in the amino acid sequence. In some embodiments, polynucleotide variants contain “silent” substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, for example, to optimize codon expression for a particular host.
- In some embodiments, the polynucleotides as described herein are isolated.
- Polynucleotides encoding CARs be isolated molecules, or can be included within a vector, such as a plasmid, a cosmid, an artificial chromosome or a virus. Such vectors can be used to transfect target cells.
- Polynucleotides encoding CARs of this disclosure can include regulatory elements operatively linked with a nucleotide sequence encoding the CAR. For example, a polynucleotide can include one or more transcription regulatory elements, such as promoters or enhancers, which, when the polynucleotide is present in a cell, cause the sequence encoding the CAR to be expressed within the cell.
- Nucleic acids disclosed herein can be incorporated into vectors capable of transfecting cells. Such vectors include, without limitation, viral vectors plasmids and microvesicles, e.g., liposomes. Exemplary viral vectors adenoviral vectors Ad, AAV, lentivirus, and vesicular stomatitis virus (VSV) and retroviruses. Lentiviruses are a genus of the Retroviridae family and include HIV, SIV, and FIV. Lentiviruses can deliver a large quantities of genetic material into the DNA of the host cell. They are able to infect non-dividing cells.
- In some embodiments, the recombinant (host) cell having the nucleic acid molecule encoding the disclosed CAR wherein the nucleic acid molecule can further comprises an expression control sequence operatively linked with the nucleotide sequence encoding the CAR. The assembled CAR (by synthesis, site-directed mutagenesis or another method, as is known to one of skill in the art), the nucleic acid molecule encoding the disclosed CAR can be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the disclosed CAR in a desired host. Correct assembly can be confirmed by nucleotide sequencing, restriction mapping, and/or expression of the CAR polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
- This disclosure also provides cells (e.g., recombinant cells) comprising nucleic acid molecules encoding CARs and/or expressing CARs.
- The nucleic acid molecule encoding the disclosed CAR can be delivered to a host cell, including but not limited to a T cell, B cell, myeloid progenitor, macrophage, and so on, by a plasmid or a viral vector as is known to one of skill in the art. The resulting recombinant (host) cell can include but is not limited to a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, a T memory stem cell as well as cells expressing MHC class I or class II as is known to one of skill in the art. In some embodiments, the recombinant (host) cell having the nucleic acid molecule encoding the disclosed CAR can be a myeloid progenitor cell selected from the group consisting of a common myeloid progenitor, a granulocyte macrophage progenitor, a megakaryocyte erythrocyte progenitor, a granulocyte progenitor and a monocyte progenitor as is known to one of skill in the art. In some embodiments, the myeloid cell is an autologous or allogeneic cell.
- In some embodiments, the cells expressing the CARs of this disclosure are Treg cells. “Regulatory T cells,” or “Treg cells,” are cells belonging to a specialized subpopulation of T cells that act to suppress immune response, thereby maintaining homeostasis and self-tolerance. Tregs are able to inhibit T cell proliferation and cytokine production and play a critical role in preventing autoimmunity. Tregs are characterized by expression of FoxP3. Surface markers for Tregs include CD4, CD25high (high molecular density) and CD127low (low molecular density). Mouse and human Tregs express GITR/AITR, and CTLA-4. Human CD4+FoxP3+ Treg cells can be divided into three sub-populations: (1) CD45RA+CD25+FoxP3l0w resting Treg cells, (2) CD45RO+CD25highFoxP3high activated Treg cells, and (3) proinflammatory cytokine-producing CD45RO+CD25+FoxP3low nonsuppressive effector T cells (Teffs).
- The cells to be transformed with the nucleic acids disclosed herein can be cells taken from a subject into whom the recombinant cells are to be administered. In this way, issues of an allogeneic immune response can be mitigated.
- Cells can be expanded ex vivo before administration to a subject.
- Treg cells into which nucleic acids expressing the CARs of this disclosure have been incorporated can express these CARs and be used in the methods described herein to treat rheumatoid arthritis.
- Also, the proteins produced by a transformed/recombinant host can be purified according to any suitable method. Such methods include chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column. In some embodiments, proteins can also be physically characterized using such techniques as proteolysis, high performance liquid chromatography (HPLC), nuclear magnetic resonance and x-ray crystallography.
- Also disclosed are pharmaceutical compositions comprising a recombinant cell having a nucleic acid molecule encoding the disclosed CAR polypeptide and/or expressing the disclosed CAR polypeptide, and a pharmaceutically acceptable carrier, as well as methods of use in the treatment rheumatoid arthritis.
- As used herein, the term “pharmaceutical composition” refers to a composition comprising a pharmaceutical compound (e.g., a drug or a recombinant Treg cell as described herein) and a pharmaceutically acceptable carrier.
- As used herein, the term “pharmaceutically acceptable” refers to a carrier that is compatible with the other ingredients of a pharmaceutical composition and can be safely administered to a subject. The term is used synonymously with “physiologically acceptable” and “pharmacologically acceptable”. Pharmaceutical compositions and techniques for their preparation and use are known to those of skill in the art in light of the present disclosure. For a detailed listing of suitable pharmacological compositions and techniques for their administration one may refer to texts such as Remington's Pharmaceutical Sciences, 17th ed. 1985; Brunton et al., “Goodman and Gilman's The Pharmacological Basis of Therapeutics,” McGraw-Hill, 2005; University of the Sciences in Philadelphia (eds.), “Remington: The Science and Practice of Pharmacy,” Lippincott Williams & Wilkins, 2005; and University of the Sciences in Philadelphia (eds.), “Remington: The Principles of Pharmacy Practice,” Lippincott Williams & Wilkins, 2008.
- Pharmaceutically acceptable carriers will generally be sterile, at least for human use. A pharmaceutical composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration. Examples of pharmaceutically acceptable carriers include, without limitation, normal (0.9%) saline, phosphate-buffered saline (PBS) Hank's balanced salt solution (HBSS) and multiple electrolyte solutions such as PlasmaLyte ATM (Baxter).
- Pharmaceutical compositions can be formulated for any route of administration, including mucosal (e.g., nasal, sublingual, vaginal, buccal, or rectal), parenteral (e.g., subcutaneous, intravenous, intramuscular, or intraarterial injection, either bolus or infusion), oral, or transdermal.
- Injectable (e.g., intravenous) compositions can comprise a solution of the composition suspended in an acceptable carrier, such as an aqueous carrier. Any of a variety of aqueous carriers can be used, e.g., water, buffered water, 0.4% saline, 0.9% isotonic saline, 0.3% glycine, 5% dextrose, and the like, and may include glycoproteins for enhanced stability, such as albumin, lipoprotein, globulin, etc. Often, normal buffered saline (135-150 mM NaCl) will be used. The compositions can contain pharmaceutically acceptable auxiliary substances to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc. In some embodiments, the composition can be formulated in a kit for intravenous administration.
- Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intratumoral, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. Injection solutions and suspensions can also be prepared from sterile powders, granules, and tablets. In the practice of the present invention, compositions can be administered, for example, by intravenous infusion, topically, intraperitoneally, intravesically, or intrathecally. The formulations of compositions can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- Cells can be cryopreserved. Cryopreservation can include formulating cells with a cryopreservation agent, such as DMSO. Commercially available media include, for example, CryoStor® and pZerve®, available from Millipore Sigma.
- Compositions can be formulated as dosage forms for administration. The term “dosage form” refers to the particular format of the pharmaceutical, and depends on the route of administration. Examples of dosage forms include, but are not limited to: dispersions; suppositories; ointments; cataplasms (poultices); pastes; powders; dressings; creams; plasters; solutions; patches; aerosols (e.g., nasal sprays or inhalers); gels; liquid dosage forms suitable for oral or mucosal administration to a patient, including suspensions (e.g., aqueous or non-aqueous liquid suspensions, oil-in-water emulsions, or a water-in-oil liquid emulsions), solutions, and elixirs; liquid dosage forms suitable for parenteral administration to a patient; and sterile solids (e.g., crystalline or amorphous solids) that can be reconstituted to provide liquid dosage forms suitable for parenteral administration to a patient.
- The terms “dose” and “dosage” are used interchangeably herein. A dose refers to the amount of active ingredient given to an individual at each administration. The dose will vary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable label (if present). One of skill in the art will recognize that the dose can be modified depending on the above factors or based on therapeutic progress.
- The pharmaceutical preparation can be packaged or prepared in unit dosage form. In such form, the preparation is subdivided into unit doses containing appropriate quantities of the active component, e.g., according to the dose of the therapeutic agent or concentration of the composition. The unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation. The composition can, if desired, also contain other compatible therapeutic agents.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the complementarity-determining regions (CDRs) from the VH domains of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from the VL domains of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:3. In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising the CDRs from VH and VL domains of SEQ ID NO:1 (SBT01 VH (M)) and SEQ ID NO:4 (SBT01 VL (G)). In some embodiments, the VH domain of the CAR polypeptide comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and the VL domain of CAR polypeptide comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In another embodiment, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising one or more VH domains comprising the amino acid sequence of VH domains of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO:1 or SEQ ID NO:2, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VL domains of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 3 or SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:3. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 or SEQ ID NO:3, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:1 and SEQ ID NO:4. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 1 and SEQ ID NO:4, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO: 2 and SEQ ID NO:3. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 3, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- In some embodiments, the compositions of the invention comprise a recombinant cell having a nucleic acid molecule encoding a CAR polypeptide comprising an scFV comprising the VH and VL domains of SEQ ID NO:2 and SEQ ID NO:4. In some embodiments, the nucleic acid molecule encoding a CAR polypeptide comprises an scFV comprising an amino acid sequence having at least any of 80%, 85%, 90%, 95%, 97%, 98%, 99% or 99.5% of SEQ ID NO: 2 and SEQ ID NO: 4, provided the scFV domain binds to a citrullinated antigen as described herein. In some embodiments, the cell is a T-cell, a CD4 T-cell, a Treg cell, a CD8 alpha T-cell, CD8 beta T cell, T helper cell, granulocyte (neutrophils, basophils, eosinophils), megakaryocytes, monocyte, macrophage and a dendritic cell, or a T memory stem cell. In some embodiments, the cell is a Treg cell.
- T cells, and in particular, Treg cells, that express the CARs disclosed herein are useful in the treatment of rheumatoid arthritis. Methods of use comprise administering an effective amount a pharmaceutical composition of this disclosure to a subject in need thereof, e.g., a subject suffering from rheumatoid arthritis.
- As used herein, the term “subject” refers to an individual animal. The term “patient” as used herein refers to a subject under the care or supervision of a health care provider such as a doctor or nurse. Subjects include mammals, such as humans and non-human primates, such as monkeys, as well as dogs, cats, horses, bovines, rabbits, rats, mice, goats, pigs, and other mammalian species. Subjects can also include avians. A patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc. The term “rheumatoid arthritis subject” refers to an individual that has been diagnosed with rheumatoid arthritis. Rheumatoid arthritis patients can include individuals that have not received treatment, are currently receiving treatment, have had treatment, and those that have discontinued treatment.
- As used herein, the terms “effective amount,” “effective dose,” and “therapeutically effective amount,” refer to an amount of an agent that is sufficient to generate a desired response, such as reduce or eliminate a sign or symptom of a condition or ameliorate a disorder. In some examples, an “effective amount” is one that treats (including prophylaxis) one or more symptoms and/or underlying causes of any of a disorder or disease and/or prevents progression of a disease. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of therapeutic effect at least any of 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as “-fold” increase or decrease. For example, a therapeutically effective amount can have at least any of a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
- The pharmaceutical composition can be administered by any suitable route, including but not limited to intravenous, subcutaneous, intramuscular or intraperitoneal routes. An example of administration of a pharmaceutical composition includes storing the composition at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4° C., and diluting it in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient. The pharmaceutical composition is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg. In other embodiments, the pharmaceutical composition is administered by intravenous infusion over a period of between 15 minutes and 2 hours. In still other embodiments, the administration procedure is via sub-cutaneous bolus injection.
- The dose of the composition is chosen in order to provide effective therapy for the patient and is in the range of less than 0.1 mg/kg body weight to about 25 mg/kg body weight or in the
range 1 mg-2 g per patient. In some cases, the dose is in the range 1-100 mg/kg, or approximately 50 mg-8000 mg/patient. The dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, depending on the pharmacokinetics of the composition (e.g., half-life of the composition in the circulation) and the pharmacodynamic response (e.g., the duration of the therapeutic effect of the composition). In some embodiments, the in vivo half-life of between about 7 and about 25 days and composition dosing is repeated between once per week and once every 3 months. - Administration can be periodic. Depending on the route of administration, the dose can be administered, e.g., once every 1, 3, 5, 7, 10, 14, 21, or 28 days or longer (e.g., once every 2, 3, 4, or 6 months). In some cases, administration is more frequent, e.g., 2 or 3 times per day. The patient can be monitored to adjust the dosage and frequency of administration depending on therapeutic progress and any adverse side effects, as will be recognized by one of skill in the art.
- Thus, in some embodiments, additional administration is dependent on patient progress, e.g., the patient is monitored between administrations. For example, after the first administration or round of administrations, the patient can be monitored for rate of tumor growth, recurrence (e.g., in the case of a post-surgical patient), or general disease-related symptoms such as weakness, pain, nausea, etc.
- In certain embodiments, the T cells described herein are administered to the synovia of the joints of subjects having rheumatoid arthritis. Such administration can be by injection directly into the joint.
- An exemplary method of this disclosure includes isolating T lymphocytes from a biological sample obtained from the subject. Such T cell can be isolated by immunoaffinity, for example, using solid supports derivatized and anti-CD4 antibodies. CD4+ T regulatory cells (Treg) can be separated from non-Treg cells based on their marker profile. Treg cells are CD4+, CD25+, CD127lo. Non Treg cells are: CD4+, CD25+ and CD127+. The isolated Treg cells are then transfected with an expression vector encoding a chimeric antigen receptor (CAR) of this disclosure. The transfected cells are expanded. The expanded cells are administered to the subject.
- As used herein, the term “kit” refers to a collection of items intended for use together. The kit can optionally include a reference agent and/or instructions for use thereof. A kit can further include a shipping container adapted to hold a container, such as a vial, that contains a composition as disclosed herein. A kit can include a container that contains within it the collection of items.
- Kits of this disclosure can comprise a pharmaceutical composition as described herein, contained in a container, such as a bag or bottle for intravenous administration. Also included in the kit can be a fluidic conduit, such as a plastic tube, with a drip chamber. The drip chamber can communicate through a fluidic conduit with an intravenous needle. The fluidic conduit also can comprise one or more Y-sites and a roller clamp.
- Abbreviations: CAR (chimeric antigen receptor); CF (citrullinated fibrinogen); CFSE (carboxyfluorescein succinimidyl ester); CV (cirtullinated vimentin); EGFR (epidermal growth factor receptor); IN (intranasal); IV (intravenous); LPS (lipopolysaccharide); PAD2 (peptidylarginine deiminase 2); PBMC (peripheral blood mononuclear cells); PBS (phosphate buffered saline); RA (rheumatoid arthritis); scFv (single-chain variable fragment); SF (synovial fluid); Teff (effector T cell); Treg (regulatory T cell); and UTD (untransduced).
- Jurkat-FF-Luciferase Transduction×50,000 cells per well were plated in each of 2 flat-bottom 96-well plates in RPMI with 2× protamine sulfate. Viruses were diluted in RPMI such that 100 μl is approx. an MOI of 1. Then 100 μl was added to one column on each 96-well plate. Plates were then spun and placed in an incubator. Samples were pooled the next day. Transduced cells were resuspended in media and transferred 100 μl to a U-bottom plate in duplicate. The cells were stained with CV-AF488 and CV-AF647 with 1:100 anti-EGFR-PE at 4° C. for 20 mins, washed once, then analyzed by Novocyte. Samples were then scaled up into 6-well plates by adding 3 ml fresh media
- Plate Coating—Citrullinated vimentin (CV) was first diluted 1:100 into 4 ml PBS. 5 serial 4-dilutions were made by transferring 1 ml into 3 ml. 100 μl was then added to 96-well plates. Plates were placed at 4° C. to coat overnight.
- Luciferase Assay—Normalized transduced cells were pelleted and resuspended in 1 ml RPMI. The CV-coated plates were washed three times with PBS. 50 μl of cells were added to the plates. 25 μl of 3× PMA/Iono were added, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, the luciferase plates were read by adding 75 μl BioGlo reagent, incubating 2-3 mins in the dark and reading the plate.
-
FIG. 1 shows the response of virus transduced Jurkat-FF-Luciferase cells to different concentrations of full CV coated plates. The results show that BVCA1and STB01 had the strongest response to plate-bound, full-length CV. -
FIG. 2 shows the response of virus transduced Jurkat-FF-Luciferase cells to different concentrations of soluble CV. The results show that only BVCA1 and SBT01G-HL had a dose-dependent response to soluble, full-length CV. -
FIG. 3 shows that in an assay with soluble bead-bound-peptide, BVCA1 and SBT01 demonstrated binding specificity to CV. -
FIG. 4 shows the response of BVCA1 and SBT01G to plate-bound CV, antibody (V9) captured CV, and soluble CV at different protein concentrations. The results show that SBT01G has a stronger response to plate-bound CV and antibody (V9) captured CV, but not soluble CV, than BVCA1. - Jurkat-FF-Luciferase transduction—24×106 Jurkat-FF-luc cells were pelleted and resuspended in 24 ml RPMI containing protamine sulfate and virus at a MOI of 3, to express CARs of pSB_0147, pSB-0149 and pSB0139. Cells were mixed and 4 ml were aliquoted into each well of a 6-well plate. Plates were then spun and placed in an incubator overnight. Cells were pelleted and reseeded in 25 ml RPMT in T75 flasks.
- Synovial Fluid Stimulus—Transduced cells were pelleted and resuspended in RPMI and placed in wells of black/white plates. Synovial fluid (SF) samples from RA patients were thawed, vortexed, and diluted in RPMI before being added to plates containing transduced cells. Cells were cultured with SF at 37° C.
- Luciferase Assay—Approximately 24 hours later, 75 μl BioGlo reagent was added to each well, and the plates were incubated 2-3 mins in the dark. Luminescence was then read on a plate reader.
- Treg isolation and Tissue Culture—Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells. After isolation, cells were stimulated with CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and beta-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL. On
day 9 of expansion, fresh CTS Dynabeads Treg Xpander were added at a 1:1 bead to cell ratio. - Transduction of Primary Tregs—Primary Tregs were transduced with CV-CAR constructs on
day 2 of expansion via spin-occulation in the presence of protamine sulfate. - Activation of Tregs—CV-CAR-expressing Treg cells were cultured in vitro with a dilution of synovial fluid samples ranging from 1:5 to 1:160. Treg activation was assessed by measurement of CD71 expression.
- Flow Cytometry and FACS Analysis—Activation cultures were collected and centrifuged at 300×g for 5 min and then resuspended in 1× Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen), anti-EGFR and CD71 surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1× Flow stain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
-
FIG. 5 shows the response of SBT01G and BVCA1 to synovial fluids from RA patients. The data shows that SBT01G gave stronger responses than BVCA1 to synovial fluids from several RA patients. -
FIG. 6 shows for synovial fluid samples from Swedish RA patients that triggered a response, that SBT01G was again stronger than BVCA1. -
FIG. 7 shows responses of primary Treg cells transduced with CV-CARs to synovial fluid from multiple RA patients. The primary Treg cells expressing the SBT01G CAR are more sensitive to synovial fluid from RA patients than primary Treg cells expressing the BVCA1 CAR. - Plate Coating—Citrullinated protein was diluted in PBS and added to wells of a black/white isoplate. Plates were placed at 4° C. overnight to coat the plate wells.
- Luciferase Assay—Stably-transduced and untransduced (UTD) Jurkat-FF-luc cell lines were pelleted and resuspended in RPMI containing 10% FBS. The citrullinated protein-coated plates were washed three times with PBS. 50,000 cells per well in 75 μl were added the coated plates. 5 μl of 15×PMA/Iono in RPMI were added to each well, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, 75 μl BioGlo reagent was added to each well, and the plates were incubated 2-3 mins in the dark. Luminescence was then read on a plate reader.
- Treg Isolation and Tissue Culture—Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells and Teff were isolated using FACS gating for CD4+CD25loCD127pos. After isolation, cells were stimulated with CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and b-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL. On
day 9 of expansion fresh CTS Dynabeads Treg Xpander were added at a 1:1 bead to cell ratio. - Transduction of Primary Tregs and Teffs—Primary Tregs and Teff were transduced with CD19-CAR or CV-CAR constructs on
day 2 of expansion via spin-occulation in the presence of protamine sulfate. - Activation of Tregs—Before start of activation cultures CAR expressing Tregs and Teff were labelled with a proliferation dye, CFSE. CD19-CAR and CV-CAR-expressing Treg cells were cultured in vitro with plate-coated citrullinated vimentin (CV) or citrullinated fibrinogen (CF) ranging in dose from 30 ng/ml to 10 μg/ml. Treg activation was assessed by measurement of percentages of proliferating cells and by CD71 expression.
- Flow Cytometry and FACS Analysis—Activation cultures were collected and centrifuged at 300×g for 5 min and then resuspended in 1× Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen), anti-EGFR and CD71 surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1× Flowstain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
-
FIG. 8 shows responses of SBT01G and BVCA1 to plate-bound, full-length peptidylarginine deiminase 2 (PAD2)-citrullinated fibrinogen. The results show that SBT01G, but not BVCA1, is also able to respond to plate-bound, full-length PAD2-citrullinated fibrinogen. -
FIG. 9 shows that SBT01G CAR expressed on Teff cells and Treg cells respond to citrullinated vimentin (CV) and citrullinated fibrinogen (CF). In contrast, BVCA1 CAR expressed on Teff cells and Treg cells respond to CV, but not to CF. - Thus,
FIGS. 1-9 show that SBT01G consistently performed as well as, or superior to BVCA1 in all assay systems. - Treg Isolation and Tissue Culture—Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells. After isolation, cells were stimulated with CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and b-mercaptoethanol with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL. On
day 9 of expansion fresh CTS Dynabeads Treg Xpander were added at a 1:1 bead to cell ratio. - Transduction of Primary Tregs—Primary Tregs were transduced with CV-CAR constructs on
day 2 of expansion via spin-occulation in the presence of protamine sulfate. - Activation of Tregs—Before start of activation cultures, CAR expressing Tregs were labelled with a proliferation dye, CFSE. CV-CAR-expressing Treg cells were cultured in vitro with bead captured CV peptide. Treg activation was assessed by measurement of percentages of proliferating cells.
- Flow Cytometry and FACS Analysis Activation Assay—Activation cultures were collected and centrifuged at 300×g for 5 min and then resuspended in 1× Flowstain Buffer (Invitrogen) with a viability dye (Invitrogen) and anti-EGFR surface staining antibody. Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1× Flowstain Buffer. Stained cells were fixed with CytoFix (BD Biosciences) then analyzed by flow cytometry.
- Flow Cytometry and FACS Analysis of Treg phenotype—On
Day 14 of expansion untransduced (UTD), CD19-CAR and CV-CAR expressing Tregs were stained for transcription factors FoxP3 and Helios. Cells were fixed and permeabilized using eBiosciences FoxP3 transcription factor buffer set (eBiosciences). - Resting of Treg Cultures—On
day 14 of expansion CD19-CAR and CV-CAR expressing Tregs were harvested, de-beaded using a magnet and put in culture with 300 IU/ml IL-2 only at 0.5 million cells/ml - Flow Cytometry and FACS Analysis of CAR Expression—CD19-CAR and CV-CAR expressing Tregs on
day 14 of expansion and after 2 or 5 days of rest were stained with viability dye (Invitrogen) and anti-EGFR surface staining antibody. CV-CAR expression was detected by incubating the cells with 1 μg/ml CV, followed by FITC-labelled anti-vimentin (clone V9, Invitrogen). - Plate Coating—Citrullinated vimentin (CV) was diluted in PBS and added to wells of a black/white isoplate. Plates were placed at 4° C. overnight to coat the plate wells.
- Luciferase Assay—Stably-transduced and untransduced (UTD) Jurkat-FF-luc cell lines were pelleted and resuspended in RPMI containing 10% FBS. The citrullinated protein-coated plates were washed three times with PBS. 50,000 cells per well in 75 μl were added the coated plates. 5 μl of 15×PMA/Iono in RPMI were added to each well, and the plates were placed in the 37° C. incubator. Approximately 24 hours later, 75 μl BioGlo reagent was added to each well, and the plates were incubated 2-3 mins in the dark. Luminescence was then read on a plate reader.
-
FIG. 10A shows that both EF1A and MND promoters drive expression and functional responses by CV-CAR T cells to soluble bead-bound citrullinated peptide (pCV).FIG. 10B shows that the use of different promoters does not change the phenotype of CV-CAR Treg cells. -
FIG. 11 shows that the choice of scFv linker has little to no impact on SBT01G CAR T cell responses to full length CV. -
FIG. 12A shows that transduction with the SBT01G CAR vector resulted in CV-CAR expression in a higher percentage of cells than did transduction with the BVCA1 CAR vector.FIG. 12B shows that SBT01G CAR and BVCA1 CAR Treg cells have similar FoxP3 and Helios profiles. - Thus,
FIGS. 10-12 show that SBT01G showed higher percentage of CAR-positive Tregs, and SBT01G showed higher levels of CAR expression. - Treg Isolation and Tissue Culture—Primary human Treg cells were sourced from healthy donors from leukoreduction chamber residuals or leukopaks. Peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation using Ficoll-Paque Plus. CD25+ cells were enriched by positive selection. Treg cells were next isolated using FACS by gating for CD4+CD25+CD127lo cells. After isolation, cells were stimulated with CTS Dynabeads Treg Xpander (Gibco) at a 1:1 bead to cell ratio and cultured in RPMI medium, supplemented with 10% FBS, non-essential amino acids, sodium pyruvate, and penicillin/streptomycin with recombinant human IL-2 at 300 IU/mL at a density of 0.25-0.3 million cells/mL.
- Activation of Tregs—Untransduced and CV-CAR-expressing Treg cells were cultured in vitro with the citrullinated vimentin antigen ranging in dose from 10 ng/mL to 10 μg/mL. Treg activation was assessed by measurement of percentages of proliferating cells, and levels of CD71 expression and IL-10 secretion.
- Flow cytometry and FACS analysis: Untransduced and CV-CAR-expressing Treg cells were collected and centrifuged at 300×g for 5 min and then resuspended in lx RoboSep Buffer (StemCell Technologies) with a CD71 surface staining antibody and Cell Trace Violet (CTV) viability dye cocktail (Invitrogen). Tregs were incubated for 30 min at 4° C., then centrifuged and washed with 1× RoboSep Buffer. Stained cells were then analyzed by flow cytometry.
- Treg activation in response to citrullinated vimentin (CV) was assessed in vitro.
FIG. 13 shows a dose-dependent, CV-induced activation of CV-CAR Treg cells, as demonstrated by increases in proliferating cells, CD71 expression and IL-10 secretion. In contrast, untransduced Treg cells were not activated by CV. These results demonstrate that Treg activation upon stimulation with CV is specific to Tregs expressing a CV-CAR. - The amount of CV present in the synovial fluid of healthy donors and rheumatoid arthritis (RA) patients was assessed by ELISA as shown in
FIG. 14 . Jurkat reporter cells expressing one of three different CV-CARs or a control CD19-CAR were incubated with increasing amounts of synovial fluid and responses were measured as an indicator of CV-CAR binding and signal transduction for T cell activation.FIG. 14 shows that Jurkat cells (immortalized, human T lymphocytes) expressing CV-CAR1 (BVCA1) and CV-CAR2 (SBT01G), but not CV-CAR3 (C03) or CD19-CAR, showed an increase in response to synovial fluid (SF).FIG. 14 also shows that CV-CAR2 (SBT01G) T cells were activated by SF samples from more RA patients than CV-CAR1 (BVCA1) T cells. - In order to demonstrate that Tregs expressing CV-CARs are activated by citrullinated antigen in the synovial fluid of RA patients, untransduced and CV-CAR2 Tregs were incubated with RA synovial fluid or vehicle and levels of proliferation and CD71 expression were measured.
FIG. 15 shows that CV-CAR2 Treg cells from two donors were activated in a RA synovial fluid-specific manner. - Taken together, these results establish that CV-CAR Treg cells are able to bind to a citrullinated antigen, which is present in RA synovial fluid, resulting in activation necessary for suppressive functions.
- Treg suppression assay—Treg cells expressing CV-CARs were prepared as described above from fresh human leukopaks in a 96-well U-bottom plate. Tregs were incubated with CV as antigenic stimulus or with a vehicle control. Tregs were co-cultured with either CD3/CD28-activated or CD19-CAR-specific Teff cells to assess Treg suppression of target cells. Teff cells were co-cultured at the following Treg:Teff ratios: (CD3/CD28-activation) 1:4=0.25, 1:2=0.5, 1:1=1, 2:1=2 and 4:1=4, or (CD19-specific) 1:4, 1:2, 1:1, 2:1 and 4:1.
-
FIG. 16A shows that CV-CAR Tregs stimulated with CV were able to suppress proliferation of CD3/CD28 activated Teff cells at a low Treg:Teff ratio.FIG. 16B shows that CV-CAR Tregs stimulated with CV were also able to suppress proliferation of CD19-CAR Teff cells at a low Treg:Teff ratio. - In human rheumatoid arthritis (RA) patients, consistently high concentrations of citrullinated vimentin (CV) in synovial fluid identify CV as a relevant biomarker for human RA. However, current mouse models of RA display inconsistent CV levels, which complicates the in vivo analysis of CV-CAR Tregs. To induce CV production and release into the extracellular matrix, a mouse model of LPS-induced lung inflammation was developed. The model is characterized by an acute inflammatory response including pulmonary neutrophilia and increased secretion of the pro-inflammatory cytokines interleukin-6 (IL-6), interleukin-1beta (IL-1b) and tumor-necrosis factor-alpha (TNF-alpha), as well as an accumulation of CV in lung tissue within days after intranasal LPS challenge. Chimeric antigen receptors (CAR) specific to CV have been shown to react to the accumulated CV protein in lung tissue, which results in survival, proliferation and increases in suppressive activity in an antigen-specific manner of the respective CV-CAR Treg cells.
- Six-to-eight week old immunocompromised NCG mice were obtained from Charles River Laboratories. Mice were randomized by body weight and divided into groups of 5-10 animals. Mice were subjected to intranasal (IN) treatment with LPS (5 mg/kg) on
days day 0, CV-CAR Treg cells were harvested from actively growing cultures, the stimulation beads were removed magnetically, and the Tregs were subsequently labeled with Cell Trace Violet (CTV) (Invitrogen). About 4 hours after the initial LPS challenge, the CTV-labeled Tregs were adjusted to 25×106 cells/mL in 0.9% sterile saline solution (NaCl) and a 200 μl dose was injected intravenously (IV) such that each mouse received a total of 5×106 cells. Following CV-CAR Treg or control CD19-CAR Treg adoptive cell transfer, all mice received intraperitoneal (IP) injections of IL-2 (160,000 IU) ondays day 13, and the spleen and lungs were harvested and processed into single cell suspensions for flow cytometric analysis of the human CV-CAR and CD19-CAR Tregs. -
FIG. 17 shows an exemplary timeline for inducing CV-associated, pulmonary inflammation in mice and the activation of CV-CAR Treg cells in vivo. -
FIG. 18A shows how a proliferation ratio was calculated from flow cytometry data, whileFIG. 18B show how a fold change in EGFR ratio (CAR marker) was calculated from the same data. -
FIG. 19A shows that the absolute number of CV-CAR Tregs were significantly enriched in lung tissue from mice with LPS-induced pulmonary inflammation.FIG. 19B shows that the proliferation ratio of CV-CAR Tregs was significantly increased in lung tissue from mice with LPS-induced pulmonary inflammation. These results demonstrate that CV-CAR Tregs have improved capacity compared to control Tregs to hone to and proliferate in inflamed lung tissues characterized by accumulation of citrullinated vimentin. As such, this murine pulmonary inflammation model permits the testing of human CV-CAR Tregs in vivo. -
-
- 1. A chimeric antigen receptor (CAR) comprising an antigen-binding domain, a hinge domain, a transmembrane domain, one or more co-stimulatory domains, and an intracellular signaling domain, wherein the antigen binding domain specifically binds to a citrullinated polypeptide, optionally wherein the antigen-binding domain specifically binds to three or more different citrullinated proteins or citrullinated fragments thereof.
- 2. The CAR of
Embodiment 1, wherein the antigen binding domain binds to a plurality of different citrullinated proteins or citrullinated fragments thereof. - 3. The CAR of
Embodiment 1, wherein the antigen binding domain binds to one or more of: (i) citrullinated vimentin, (ii) citrullinated filaggrin, (iii) citrullinated fibrinogen and (iv) citrullinated peptides fragments of these, e.g., of at least any of 10, 12 , 14 or 16 amino acids. - 4. The CAR of
Embodiment 1, wherein the antigen-binding domain binds to at least two of (i) citrullinated vimentin, (ii) citrullinated filaggrin, and (iii) citrullinated fibrinogen, or citrullinated peptides fragments thereof. - 5. The CAR of
Embodiment 1, wherein the antigen-binding domain binds to all three of (i) citrullinated vimentin, (ii) citrullinated filaggrin, and (iii) citrullinated fibrinogen, or citrullinated peptides fragments thereof. - 6. The CAR of
Embodiment 5, that binds further binds citrullinated tenascin C. - 7. The CAR of
Embodiment 1, wherein the antigen binding domain comprises a VH domain and a VL domain, wherein:
(i) the VH domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and
(ii) the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43. - 8. The CAR of
Embodiment 1, wherein the intracellular signaling domain is derived from CD3zeta. - 9. The CAR of
Embodiment 1, wherein the at least one co-stimulatory domain is derived from a member of the group consisting of: FceR1g, Fcg, CD28, 4-1BB, CTLA-4, CTLA-4/CD-28 hybrid, DAP10, CD27, and 2B4, optionally wherein the at least one co-stimulatory domain comprises a CD28 and/or a 4-1BB co-stimulatory domain. - 10. The CAR of
Embodiment 1, wherein the antigen binding domain comprises an antibody, antibody fragment, a camelid nanobody, a heavy chain only antibody or an aptamer. - 11. The CAR of any one of
Embodiments 1 to 10, wherein the transmembrane domain is a CD8 transmembrane domain or a CD28 transmembrane; and the hinge domain is a CD8 hinge domain or a CD28 hinge domain; and/or further comprising a signal peptide, optionally wherein the signal peptide is a CD8 signal peptide or a GM-CSF signal peptide. - 12. The CAR of
Embodiment 11, wherein the antigen-specific binding domain comprises a single chain fragment. - 13. The CAR of
Embodiment 12, wherein the single chain fragment comprises a single chain variable fragment (scFv), optionally wherein the scFv fragment comprises:
(a) a VH domain comprising the amino acid sequence of SEQ ID NO:1; and
(b) a VL domain comprising the amino acid sequence of SEQ ID NO:4. - 14. The CAR of
Embodiment 13, wherein the scFv fragment comprises:
-
(a) a VH selected from: (1) SBT01 VH (M) (SEQ ID NO: 1) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIRQPPGKGLEW IGSIYYRGNTHYNSSLRSRVTMSVDTSKNRFSLKVTSVTAADTAVYYCA RLDPFDYWGRGTLVTVSS; or (2) SBT01 VH (G) (SEQ ID NO: 2) QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEW IGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCA RLDPFDYWGRGTLVTVSS; and (b) a VL selected from: (1) SBT01 VL (M) (SEQ ID NO: 3) SYVLTQPPSVSLAPGETATITCGGDDIENQNVNWYQQKSGQAPMLLIFF DTRRPSGIPERFSGSRSEDTANLTITRVEAGDDADYFCQVYDRKTDHQV FGPGTTVTVL or (2) SBT01 VL (G) (SEQ ID NO: 4) SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYY DSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHQV FGTGTKVTVL. -
- 15. The CAR of
Embodiment 14, wherein the VH-VL fragments are joined by a linker selected from the group consisting of (i) GGGSx3 (SEQ ID NO:20), (ii) Whitlow 218 (SEQ ID NO:21), and (iii) AB Pur (SEQ ID NO:22). - 16. The CAR of
Embodiment 13, wherein the scFv comprises the amino acid sequence of:
- 15. The CAR of
-
(a) SBT01G-VHVL-GGGSx3 Linker-pSB_0149 (SEQ ID NO: 5) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIRQPPGKGLEW IGSIYYRGNTHYNSSLRSRVTMSVDTSKNRFSLKVTSVTAADTAVYYCA RLDPFDYWGRGTLVTVSS GGGGSGGGGSGGGGS SYVLTQPPSVSVAPGK TARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSN SGNTATLTISRVEAGDEADYYCQVWDSSSDHQVFGTGTKVTVLR (GGGSx3 linker underlined); or (b) SBT01G-VHVL-Whitlow 218 Linker-pSB_0158 (SEQ ID NO: 6) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIRQPPGKGLEW IGSIYYRGNTHYNSSLRSRVTMSVDTSKNRFSLKVTSVTAADTAVYYCA RLDPFDYWGRGTLVTVSS GSTSGSGKPGSGEGSTKG SYVLTQPPSVSVA PGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFS GSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHQVFGTGTKVTVLR (Whitlow 218 Linker underlined); or (c) SBT01G-VHVL-AB pur Linker-pSB_0159 (SEQ ID NO: 7) HLHLQESGPGLVKPSETLSLTCTVSGGSINDTTYYWGWIRQPPGKGLEW IGSIYYRGNTHYNSSLRSRVTMSVDTSKNRFSLKVTSVTAADTAVYYCA RLDPFDYWGRGTLVTVSS ASSGGSTSGSGKPGSGEGSSGSAR SYVLTQP PSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSG IPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHQVFGTGTKV TVLR (AB pur Linker underlined). -
- 17. The CAR of any of Embodiments 1-16, wherein the co-stimulatory domain comprises a CD28, 41BB, OX40, OX40, CD40L, MyD88, CD40, CD27, ICOS, or RANK/TRANCE-R co-stimulatory domain.
- 18. A nucleic acid encoding the CAR of any of Embodiments 1-17.
- 19. The nucleic acid of Embodiment 18, comprising DNA or RNA.
- 20. The nucleic acid of Embodiment 18, wherein:
the VH is encoded by the nucleic acid sequence comprising:
-
CACCTGCACTTGCAGGAGTCGGGCCCAGGACTTGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAACGATACCAC TTACTACTGGGGCTGGATTCGCCAGCCCCCCGGGAAGGGACTGGAGTGG ATTGGGAGTATCTATTACCGGGGGAACACCCACTACAATTCGTCCCTGA GGAGTCGCGTCACCATGTCTGTCGACACTTCCAAGAACCGATTCTCCCT GAAGGTCACTTCTGTGACTGCCGCAGACACGGCTGTCTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC, or CAGCTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTAGTAG TTACTACTGGGGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGG ATTGGGAGTATCTATTATAGTGGGAGCACCTACTACAACCCGTCCCTCA AGAGTCGAGTCACCATATCCGTAGACACGTCCAAGAACCAGTTCTCCCT GAAGCTGAGCTCTGTGACCGCCGCAGACACGGCTGTGTATTACTGTGCG AGACTCGACCCATTTGACTACTGGGGCCGTGGCACCCTGGTCACTGTCT CGAGC;
and
the VL is encoded by a nucleic acid sequence comprising; -
TCCTATGTCCTGACTCAGCCACCCTCAGTGTCGCTGGCCCCGGGAGAGA CGGCCACAATTACTTGTGGTGGAGACGACATTGAAAATCAAAATGTCAA CTGGTATCAGCAGAAGTCAGGTCAGGCCCCTATGCTGCTCATCTTCTTT GATACCAGACGGCCCTCAGGGATCCCGGAGCGATTCTCTGGCTCCAGGT CTGAGGACACGGCCAACCTGACCATCACCAGGGTCGAGGCCGGGGATGA CGCCGACTATTTCTGTCAGGTGTATGATAGGAAGACTGATCACCAAGTC TTCGGACCTGGGACCACGGTCACCGTCCTA, or TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGA CGGCCAGGATTACCTGTGGGGGAAACAACATTGGAAGTAAAAGTGTGCA CTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTAT GATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACT CTGGGAACACGGCCACCCTGACCATCAGCAGGGTCGAAGCCGGGGATGA GGCCGACTATTACTGTCAGGTGTGGGACAGTAGTAGTGATCACCAAGTC TTCGGAACTGGGACCAAGGTCACCGTCCTA. -
- 21. The nucleic acid of
Embodiment 20, wherein the VH and VL fragments are joined by linker and comprise the nucleic acid sequence of (i) SEQ ID NO:12, (ii) SEQ ID NO:13, or (iii) SEQ ID NO:14. - 22. An expression vector comprising an expression control sequence operatively linked to the nucleic acid sequence of any of Embodiments 16-21.
- 23. The expression vector of Embodiment 22, wherein the expression control sequence comprises a regulatory region, wherein the regulatory region is selected from the group consisting of: promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, protein binding sequences, 5′ and 3′ non-translated regions, transcriptional start sites, termination sequences, polyadenylation sequences, nuclear localization, signals, and introns.
- 24. The expression vector of Embodiment 23, wherein the vector is an adenoviral vector, a lentiviral vector or a plasmid.
- 25. A host cell comprising the expression vector of Embodiment 22, 23 or 24.
- 26. A modified T cell that has been modified to express the chimeric antigen receptor (CAR) of any of Embodiments 1-17.
- 27. The modified T cell of Embodiment 26, wherein the T cell is a mammalian T cell.
- 28. The modified T cell of Embodiment 27, wherein the T cell is a Treg cell.
- 29. The modified T cell of Embodiment 28, wherein the T-cell is a human T cell.
- 30. The modified T cell of Embodiment 29, wherein the T cell is a primary T cell.
- 31. The modified T cell of
Embodiment 30, wherein the T cell is CD4+, CD25+ and CD127lo. - 32. A pharmaceutical composition comprising a plurality of the modified T cell of any of Embodiments 26 to 31, and a pharmaceutically acceptable carrier.
- 33. A method of treating a subject suffering from rheumatoid arthritis, comprising administering to the subject an effective amount of a pharmaceutical composition of
Embodiment 32. - 34. The method of Embodiment 33, wherein the subject is a human.
- 35. The method of Embodiment 33 or 34, wherein the pharmaceutical composition is administered into a synovium of the subject.
- 36. The method of Embodiment 33 or 34, wherein the pharmaceutical composition is administered intravenously.
- 37A. The method of Embodiment 33, wherein administering comprises:
(a) isolating T cells from a biological sample obtained from the subject;
(b) enriching the T cells for T regulatory cells (Treg);
(c) transfecting the enriched Treg cells with an expression vector comprising an expression control sequence operatively linked to a nucleotide sequence encoding a chimeric antigen receptor (CAR) comprising an antigen binding domain that binds to a citrullinated polypeptide;
(d) expanding the transfected Treg cells; and (e) administering the expanded Treg cells to the subject. - 37B. A method of treating a subject suffering from rheumatoid arthritis, the method comprising:
(a) isolating T cells from a biological sample obtained from the subject;
(b) enriching the T cells for T regulatory cells (Treg);
(c) transfecting the enriched Treg cells with an expression vector encoding the CAR of any one of Embodiments 1-17;
(d) expanding the transfected Treg cells; and
(e) administering the expanded Treg cells to the subject. - 38. The method of Embodiment 37, wherein the expansion comprises using anti-CD3/CD28 coated beads.
- 39. The method of Embodiment 37, wherein the expansion is does not use anti-CD3/CD28 coasted beads.
- 40. The method of Embodiment 37, wherein the transfection occurs by use of a viral vector, electroporation, heat shock, bacteriophage, sonication, or calcium phosphate.
- 41. The method of any of Embodiments 37 to 40 further comprising administering one or more anti-inflammatory and/or therapeutic agents to the subject.
- 42. The method of Embodiment 41, wherein the anti-inflammatory agent comprises an antibody that inhibits a pro-inflammatory cytokine.
- 43. The method of Embodiment 42, wherein the anti-inflammatory agent is an anti-TNF-antibody, an anti-IL-6 antibody, or a combination thereof.
- 44. A kit comprising a container containing the pharmaceutical composition of
Embodiment 32, communicating through a fluidic conduit with a drip chamber, wherein the drip chamber communicates through a fluidic conduit with an intravenous needle. - 45. The kit of Embodiment 44, wherein the container comprises a bag.
- 46. The kit of Embodiment 44, wherein the fluidic conduit between the container and the needle comprises one or more Y-sites and a roller clamp.
- 21. The nucleic acid of
- It should be understood that the description and the drawings are not intended to limit the invention to the particular form disclosed, but to the contrary, the intention is to cover all modifications, equivalents, and alternatives falling within the spirit and scope of the present invention as defined by the appended claims. Further modifications and alternative embodiments of various aspects of the invention will be apparent to those skilled in the art in view of this description. Accordingly, this description and the drawings are to be construed as illustrative only and are for the purpose of teaching those skilled in the art the general manner of carrying out the invention. It is to be understood that the forms of the invention shown and described herein are to be taken as examples of embodiments. Elements and materials may be substituted for those illustrated and described herein, parts and processes may be reversed or omitted, and certain features of the invention may be utilized independently, all as would be apparent to one skilled in the art after having the benefit of this description of the invention. Changes may be made in the elements described herein without departing from the spirit and scope of the invention as described in the following claims. Headings used herein are for organizational purposes only and are not meant to be used to limit the scope of the description.
- All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
Claims (21)
1-43. (canceled)
44. A kit comprising a container containing a pharmaceutical composition communicating through a fluidic conduit with a drip chamber, wherein the drip chamber communicates through a fluidic conduit with an intravenous needle, and wherein
the pharmaceutical composition comprising a plurality of Treg cells engineered to express a chimeric antigen receptor (CAR-Treg), and a pharmaceutically acceptable carrier,
the CAR comprises an antigen-binding domain, a hinge domain, a transmembrane domain, one or more co-stimulatory domains, and an intracellular signaling domain,
the antigen binding domain binds to citrullinated vimentin, citrullinated filaggrin, and citrullinated fibrinogen, or citrullinated fragments thereof, and
the antigen binding domain comprises a VH domain and a VL domain, wherein:
(i) the VH domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and
(ii) the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
45. The kit of claim 44 , wherein the container comprises a bag.
46. The kit of claim 44 , wherein the fluidic conduit between the container and the needle comprises one or more Y-sites and a roller clamp.
47. A method of preparing T regulatory cells (Treg) expressing a chimeric antigen receptor (CAR), the method comprising:
(a) isolating T cells from a biological sample obtained from a human subject;
(b) enriching the T cells for T regulatory cells (Treg);
(c) transfecting the enriched Treg cells with an expression vector encoding the CAR to produce CAR-Treg cells; and
(d) expanding the CAR-Treg cells to produce a plurality of CAR-Treg cells, wherein
the CAR comprises an antigen-binding domain, a hinge domain, a transmembrane domain, one or more co-stimulatory domains, and an intracellular signaling domain,
the antigen binding domain binds to citrullinated vimentin, citrullinated filaggrin, and citrullinated fibrinogen, or citrullinated fragments thereof, and
the antigen binding domain comprises a VH domain and a VL domain, wherein:
(i) the VH domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and
(ii) the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
48. The method of claim 47 , wherein the expansion comprises using anti-CD3/CD28 coated beads.
49. The method of claim 47 , wherein the expansion does not comprise using anti-CD3/CD28 coasted beads.
50. The method of claim 47 , wherein the transfection occurs by use of a viral vector, electroporation, heat shock, bacteriophage, sonication, or calcium phosphate.
51. The method of claim 50 , wherein the transfection occurs by use of a viral vector.
52. The method of claim 47 , wherein the antigen-binding domain comprises a single chain variable fragment (scFv) comprising:
(a) a VH domain comprising the amino acid sequence having at least 95% identity to SEQ ID NO:1; and
(b) a VL domain comprising the amino acid sequence having at least 95% identity to SEQ ID NO:4.
53. The method of claim 52 , wherein the scFv comprises the amino acid sequence having at least 95% identity to SEQ ID NO:5.
54. The method of claim 47 , wherein the human subject has rheumatoid arthritis.
55. A pharmaceutical composition comprising the plurality of the CAR-Treg cells produced by the method of claim 54 , and a pharmaceutically acceptable carrier.
56. A method of treating rheumatoid arthritis, the method comprising: administering the to the subject an effective amount of the pharmaceutical composition of claim 55 .
57. The method of claim 56 , further comprising administering one or more anti-inflammatory and/or therapeutic agents to the subject.
58. The method of claim 57 , wherein the anti-inflammatory agent is an anti-TNF antibody, an anti-IL-6 antibody, or a combination thereof.
59. A method of treating rheumatoid arthritis, the method comprising administering to a subject an effective amount of a pharmaceutical composition, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a plurality of T regulatory cells engineered to express a chimeric antigen receptor (CAR), wherein
the CAR comprises an antigen-binding domain, a hinge domain, a transmembrane domain, one or more co-stimulatory domains, and an intracellular signaling domain,
the antigen binding domain binds to citrullinated vimentin, citrullinated filaggrin, and citrullinated fibrinogen, or citrullinated fragments thereof, and
the antigen binding domain comprises a VH domain and a VL domain, wherein:
(i) the VH domain comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:32, a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:34, and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:36, and
(ii) the VL domain of the target-binding domain comprises a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:39, a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:41, and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:43.
60. The method of claim 59 , wherein the antigen-binding domain comprises a single chain variable fragment (scFv) comprising:
(a) a VH domain comprising the amino acid sequence having at least 95% identity to SEQ ID NO:1; and
(b) a VL domain comprising the amino acid sequence having at least 95% identity to SEQ ID NO:4.
61. The method of claim 61 , wherein the scFv comprises the amino acid sequence having at least 95% identity to SEQ ID NO:5.
62. The method of claim 59 , further comprising administering one or more anti-inflammatory and/or therapeutic agents to the subject.
63. The method of claim 62 , wherein the anti-inflammatory agent is an anti-TNF antibody, an anti-IL-6 antibody, or a combination thereof.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/453,985 US20240010703A1 (en) | 2021-07-29 | 2023-08-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163227320P | 2021-07-29 | 2021-07-29 | |
US202263339361P | 2022-05-06 | 2022-05-06 | |
PCT/US2022/074321 WO2023010122A2 (en) | 2021-07-29 | 2022-07-29 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases |
US18/058,162 US11753457B2 (en) | 2021-07-29 | 2022-11-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells to treat autoimmune diseases |
US18/453,985 US20240010703A1 (en) | 2021-07-29 | 2023-08-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/058,162 Continuation US11753457B2 (en) | 2021-07-29 | 2022-11-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells to treat autoimmune diseases |
Publications (1)
Publication Number | Publication Date |
---|---|
US20240010703A1 true US20240010703A1 (en) | 2024-01-11 |
Family
ID=85088263
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/058,162 Active US11753457B2 (en) | 2021-07-29 | 2022-11-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells to treat autoimmune diseases |
US18/453,985 Pending US20240010703A1 (en) | 2021-07-29 | 2023-08-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory t cells to treat autoimmune diseases |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/058,162 Active US11753457B2 (en) | 2021-07-29 | 2022-11-22 | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells to treat autoimmune diseases |
Country Status (7)
Country | Link |
---|---|
US (2) | US11753457B2 (en) |
EP (1) | EP4376859A2 (en) |
KR (1) | KR20240040783A (en) |
AU (1) | AU2022317142A1 (en) |
CA (1) | CA3226798A1 (en) |
IL (1) | IL310434A (en) |
WO (1) | WO2023010122A2 (en) |
Family Cites Families (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2010534469A (en) * | 2007-07-25 | 2010-11-11 | アストラゼネカ アクチボラグ | KDR-directed targeted binding substances and uses thereof |
US20150218546A1 (en) | 2011-04-05 | 2015-08-06 | Lars Klareskog | Novel peptides that bind to types of mhc class ii and their use on diagnosis and treatment |
WO2014141244A1 (en) * | 2013-03-12 | 2014-09-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Synthetic peptides for the treatment of autoimmune diseases |
GB2526898A (en) * | 2014-01-13 | 2015-12-09 | Imp Innovations Ltd | Biological materials and therapeutic uses thereof |
CA2936984A1 (en) | 2014-01-24 | 2015-07-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-ny-br-1 polypeptides, proteins, and chimeric antigen receptors |
US20170260261A1 (en) | 2014-08-28 | 2017-09-14 | Bioatla, Llc | Conditionally Active Chimeric Antigen Receptors for Modified T-Cells |
MY192062A (en) * | 2014-12-05 | 2022-07-25 | Memorial Sloan Kettering Cancer Center | Chimeric antigen receptors targeting fc receptor-like 5 and uses thereof |
WO2016210447A1 (en) | 2015-06-26 | 2016-12-29 | University Of Southern California | Masking chimeric antigen receptor t cells for tumor-specific activation |
WO2017079694A2 (en) | 2015-11-04 | 2017-05-11 | Priceman Saul J | Chimeric antigen receptors targeting her2 |
US11648268B2 (en) * | 2015-12-09 | 2023-05-16 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of using same |
KR102522419B1 (en) | 2016-06-06 | 2023-04-17 | 시티 오브 호프 | Baff-r targeted chimeric antigen receptor-modified t-cells and uses thereof |
EP3697820A4 (en) | 2017-10-17 | 2022-01-05 | The General Hospital Corporation | Methods and compositions relating to engineered regulatory t cells |
CN112004823A (en) | 2018-02-02 | 2020-11-27 | 宾夕法尼亚大学董事会 | Modified monocytes/macrophages/dendritic cells expressing chimeric antigen receptors and use in protein aggregate related diseases and disorders |
CN111954684B (en) | 2018-02-11 | 2024-05-07 | 加利福尼亚大学董事会 | CAR-T cells and autoimmune diseases |
US20210017248A1 (en) | 2018-03-16 | 2021-01-21 | The Regents Of The University Of California | Cellular signaling domain engineering in chimeric antigen receptor-modified regulatory t cells |
US20220281943A1 (en) | 2019-08-14 | 2022-09-08 | The Regents Of The University Of California | Car-t cells specific for modified proteins in extracellular spaces |
-
2022
- 2022-07-29 CA CA3226798A patent/CA3226798A1/en active Pending
- 2022-07-29 WO PCT/US2022/074321 patent/WO2023010122A2/en active Application Filing
- 2022-07-29 IL IL310434A patent/IL310434A/en unknown
- 2022-07-29 KR KR1020247006430A patent/KR20240040783A/en unknown
- 2022-07-29 AU AU2022317142A patent/AU2022317142A1/en active Pending
- 2022-07-29 EP EP22850548.3A patent/EP4376859A2/en active Pending
- 2022-11-22 US US18/058,162 patent/US11753457B2/en active Active
-
2023
- 2023-08-22 US US18/453,985 patent/US20240010703A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
CA3226798A1 (en) | 2023-02-02 |
AU2022317142A1 (en) | 2024-02-15 |
WO2023010122A3 (en) | 2023-03-02 |
KR20240040783A (en) | 2024-03-28 |
EP4376859A2 (en) | 2024-06-05 |
IL310434A (en) | 2024-03-01 |
WO2023010122A2 (en) | 2023-02-02 |
US11753457B2 (en) | 2023-09-12 |
US20230080155A1 (en) | 2023-03-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
TWI744242B (en) | Antibody constructs for egfrviii and cd3 | |
EP3572427A1 (en) | Bcma-targeting antibody and use thereof | |
JP2022028750A (en) | Anti-cd19 humanized antigen-binding domains and methods of use | |
US20200283529A1 (en) | Anti-hla-a2 antibodies and methods of using the same | |
JP2016514462A (en) | Treatment of cancer using a humanized anti-CD19 chimeric antigen receptor | |
JP6960947B2 (en) | Chimeric antigen receptor for efficient directed amplification in vitro and its application | |
US11814432B2 (en) | Anti-HLA-A2 antibodies, related chimeric antigen receptors, and uses thereof | |
TW201938586A (en) | Continuous manufacturing process for bispecific antibody products | |
JP7459046B2 (en) | Chimeric receptors for STEAP1 and methods of use thereof | |
JP2023134497A (en) | Bispecific antibody construct directed to muc17 and cd3 | |
US20240082402A1 (en) | Bispecific chimeric antigen receptors binding to cd19 and cd22 | |
US20230399371A1 (en) | Il-12 compositions and methods of use thereof | |
JP2023520572A (en) | Human immune cells genetically modified to express orthogonal receptors | |
JP2023500869A (en) | Multi-targeting antigen binding molecules for use in proliferative diseases | |
WO2024036303A2 (en) | Universal t cells and compositions and methods of use thereof | |
US11753457B2 (en) | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells to treat autoimmune diseases | |
US20240034807A1 (en) | Molecules that bind to mesothelin polypeptides | |
JP2015214569A (en) | Fdf03 antibodies and uses thereof | |
CN116284389A (en) | anti-AFP/HLA 02 TCR-like antibodies and uses thereof | |
EP4047021A1 (en) | Ox40/pd-l1 bispecific antibody | |
CN116323671A (en) | Multi-targeting bispecific antigen binding molecules with increased selectivity | |
WO2024064640A2 (en) | Citrullinated antigen-specific chimeric antigen receptors for targeting regulatory t cells to treat hidradenitis suppurativa | |
CN118234501A (en) | Synovial extracellular matrix-specific chimeric antigen receptor for targeting regulatory T cells for the treatment of autoimmune diseases | |
US20230242666A1 (en) | Methods and Compositions for the Reduction of Chimeric Antigen Receptor Tonic Signaling | |
RU2782276C2 (en) | Anti-hla-a2 antibodies and their application methods |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |