US20220155295A1 - Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration - Google Patents
Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration Download PDFInfo
- Publication number
- US20220155295A1 US20220155295A1 US17/409,066 US202117409066A US2022155295A1 US 20220155295 A1 US20220155295 A1 US 20220155295A1 US 202117409066 A US202117409066 A US 202117409066A US 2022155295 A1 US2022155295 A1 US 2022155295A1
- Authority
- US
- United States
- Prior art keywords
- antibodies
- amd
- group
- wet amd
- individual
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 208000000208 Wet Macular Degeneration Diseases 0.000 title claims abstract description 97
- 238000011282 treatment Methods 0.000 title abstract description 60
- 208000011325 dry age related macular degeneration Diseases 0.000 claims abstract description 53
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 14
- -1 GAPDH-H2 Proteins 0.000 claims description 54
- 238000000034 method Methods 0.000 claims description 53
- 102100022022 Protein adenylyltransferase SelO, mitochondrial Human genes 0.000 claims description 30
- 102100023410 Phospholipid hydroperoxide glutathione peroxidase Human genes 0.000 claims description 29
- 210000000349 chromosome Anatomy 0.000 claims description 27
- 108010071690 Prealbumin Proteins 0.000 claims description 25
- 102100037082 Signal recognition particle 14 kDa protein Human genes 0.000 claims description 23
- 101710089523 Signal recognition particle 14 kDa protein Proteins 0.000 claims description 22
- 102100036790 Tubulin beta-3 chain Human genes 0.000 claims description 22
- 101000713575 Homo sapiens Tubulin beta-3 chain Proteins 0.000 claims description 21
- 101001095043 Homo sapiens Bone marrow proteoglycan Proteins 0.000 claims description 20
- 101001058231 Homo sapiens Gamma-enolase Proteins 0.000 claims description 20
- 101001131990 Homo sapiens Peroxidasin homolog Proteins 0.000 claims description 20
- 101000582986 Homo sapiens Phospholipid phosphatase-related protein type 3 Proteins 0.000 claims description 20
- 102100034601 Peroxidasin homolog Human genes 0.000 claims description 20
- 102100034526 AP-1 complex subunit mu-1 Human genes 0.000 claims description 19
- 108090000672 Annexin A5 Proteins 0.000 claims description 19
- 102100028652 Gamma-enolase Human genes 0.000 claims description 19
- 102100030395 Glycerol-3-phosphate dehydrogenase, mitochondrial Human genes 0.000 claims description 19
- 101000924643 Homo sapiens AP-1 complex subunit mu-1 Proteins 0.000 claims description 19
- 101001009678 Homo sapiens Glycerol-3-phosphate dehydrogenase, mitochondrial Proteins 0.000 claims description 19
- 102000004963 gamma-Synuclein Human genes 0.000 claims description 19
- 108090001121 gamma-Synuclein Proteins 0.000 claims description 19
- 102000004121 Annexin A5 Human genes 0.000 claims description 18
- 101001081606 Homo sapiens Islet cell autoantigen 1 Proteins 0.000 claims description 18
- 102100027640 Islet cell autoantigen 1 Human genes 0.000 claims description 18
- 101100366137 Mesembryanthemum crystallinum SODCC.1 gene Proteins 0.000 claims description 18
- 101100096142 Panax ginseng SODCC gene Proteins 0.000 claims description 18
- 102000003802 alpha-Synuclein Human genes 0.000 claims description 18
- 108090000185 alpha-Synuclein Proteins 0.000 claims description 18
- 101150017120 sod gene Proteins 0.000 claims description 18
- 230000003247 decreasing effect Effects 0.000 claims description 17
- XLEYFDVVXLMULC-UHFFFAOYSA-N 2',4',6'-trihydroxyacetophenone Chemical compound CC(=O)C1=C(O)C=C(O)C=C1O XLEYFDVVXLMULC-UHFFFAOYSA-N 0.000 claims description 15
- 101100377506 Drosophila melanogaster 14-3-3zeta gene Proteins 0.000 claims description 15
- HATRDXDCPOXQJX-UHFFFAOYSA-N Thapsigargin Natural products CCCCCCCC(=O)OC1C(OC(O)C(=C/C)C)C(=C2C3OC(=O)C(C)(O)C3(O)C(CC(C)(OC(=O)C)C12)OC(=O)CCC)C HATRDXDCPOXQJX-UHFFFAOYSA-N 0.000 claims description 15
- 102100024341 10 kDa heat shock protein, mitochondrial Human genes 0.000 claims description 14
- 108010059013 Chaperonin 10 Proteins 0.000 claims description 14
- 101000629626 Drosophila melanogaster Protein sprouty Proteins 0.000 claims description 11
- 102000009836 Aconitate hydratase Human genes 0.000 claims description 10
- 108010009924 Aconitate hydratase Proteins 0.000 claims description 10
- 108010058432 Chaperonin 60 Proteins 0.000 claims description 5
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 claims description 2
- 101100202882 Homo sapiens SELENOO gene Proteins 0.000 claims 5
- 101001052490 Homo sapiens Mitogen-activated protein kinase 3 Proteins 0.000 claims 4
- 102100024192 Mitogen-activated protein kinase 3 Human genes 0.000 claims 4
- 101150042165 Ogfr gene Proteins 0.000 claims 4
- 102100026949 Opioid growth factor receptor Human genes 0.000 claims 4
- 101000829725 Homo sapiens Phospholipid hydroperoxide glutathione peroxidase Proteins 0.000 claims 3
- 102000007584 Prealbumin Human genes 0.000 claims 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 abstract description 65
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 abstract description 65
- 239000005557 antagonist Substances 0.000 abstract description 63
- 239000000090 biomarker Substances 0.000 abstract description 11
- 238000006243 chemical reaction Methods 0.000 abstract description 8
- 230000004043 responsiveness Effects 0.000 abstract description 8
- 239000000427 antigen Substances 0.000 description 44
- 102000036639 antigens Human genes 0.000 description 44
- 108091007433 antigens Proteins 0.000 description 44
- 239000000523 sample Substances 0.000 description 42
- 241000282414 Homo sapiens Species 0.000 description 38
- 102000039479 opioid growth factor receptor family Human genes 0.000 description 34
- 108091056482 opioid growth factor receptor family Proteins 0.000 description 34
- 102100039950 Eukaryotic initiation factor 4A-I Human genes 0.000 description 29
- 101000959666 Homo sapiens Eukaryotic initiation factor 4A-I Proteins 0.000 description 29
- 108010033024 Phospholipid Hydroperoxide Glutathione Peroxidase Proteins 0.000 description 26
- 101710093368 Protein adenylyltransferase SelO, mitochondrial Proteins 0.000 description 26
- 108090000623 proteins and genes Proteins 0.000 description 26
- 206010064930 age-related macular degeneration Diseases 0.000 description 25
- 238000004458 analytical method Methods 0.000 description 25
- 208000002780 macular degeneration Diseases 0.000 description 25
- 102000004169 proteins and genes Human genes 0.000 description 25
- 229940076783 lucentis Drugs 0.000 description 24
- 102100029290 Transthyretin Human genes 0.000 description 23
- 230000004438 eyesight Effects 0.000 description 22
- 201000004569 Blindness Diseases 0.000 description 19
- 238000002560 therapeutic procedure Methods 0.000 description 18
- 230000004393 visual impairment Effects 0.000 description 18
- 230000004304 visual acuity Effects 0.000 description 17
- 108020004999 messenger RNA Proteins 0.000 description 15
- 101000738180 Euglena gracilis Chaperonin CPN60, mitochondrial Proteins 0.000 description 14
- 238000002493 microarray Methods 0.000 description 14
- 108010029485 Protein Isoforms Proteins 0.000 description 13
- 102000001708 Protein Isoforms Human genes 0.000 description 13
- 230000027455 binding Effects 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 238000004949 mass spectrometry Methods 0.000 description 12
- 210000002966 serum Anatomy 0.000 description 12
- 238000003556 assay Methods 0.000 description 11
- 230000008859 change Effects 0.000 description 11
- 230000009257 reactivity Effects 0.000 description 11
- 108010081667 aflibercept Proteins 0.000 description 10
- 150000001413 amino acids Chemical group 0.000 description 10
- 238000000540 analysis of variance Methods 0.000 description 10
- 230000002438 mitochondrial effect Effects 0.000 description 10
- 230000006872 improvement Effects 0.000 description 9
- 102100040958 Aconitate hydratase, mitochondrial Human genes 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 102100038910 Alpha-enolase Human genes 0.000 description 7
- 241000283690 Bos taurus Species 0.000 description 7
- 102000014914 Carrier Proteins Human genes 0.000 description 6
- 238000013528 artificial neural network Methods 0.000 description 6
- 108091008324 binding proteins Proteins 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 238000007418 data mining Methods 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 229960003876 ranibizumab Drugs 0.000 description 6
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 6
- 101710088194 Dehydrogenase Proteins 0.000 description 5
- 102100040856 Dual specificity protein kinase CLK3 Human genes 0.000 description 5
- 102000044159 Ubiquitin Human genes 0.000 description 5
- 108090000848 Ubiquitin Proteins 0.000 description 5
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 5
- 229960002833 aflibercept Drugs 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 210000001124 body fluid Anatomy 0.000 description 5
- 239000010839 body fluid Substances 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 238000003745 diagnosis Methods 0.000 description 5
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 102000007469 Actins Human genes 0.000 description 4
- 108010085238 Actins Proteins 0.000 description 4
- 102000006303 Chaperonin 60 Human genes 0.000 description 4
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 4
- 101000965314 Homo sapiens Aconitate hydratase, mitochondrial Proteins 0.000 description 4
- 101000882335 Homo sapiens Alpha-enolase Proteins 0.000 description 4
- 101000749304 Homo sapiens Dual specificity protein kinase CLK3 Proteins 0.000 description 4
- 101001024316 Homo sapiens Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 Proteins 0.000 description 4
- 101710118630 Homocitrate dehydratase, mitochondrial Proteins 0.000 description 4
- 102000004157 Hydrolases Human genes 0.000 description 4
- 108090000604 Hydrolases Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 108090000315 Protein Kinase C Proteins 0.000 description 4
- 102000003923 Protein Kinase C Human genes 0.000 description 4
- 101710171478 Putative aconitate hydratase, mitochondrial Proteins 0.000 description 4
- 108091008605 VEGF receptors Proteins 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 238000003795 desorption Methods 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 238000010234 longitudinal analysis Methods 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 230000002207 retinal effect Effects 0.000 description 4
- 238000011269 treatment regimen Methods 0.000 description 4
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 3
- 101710165425 Alpha-enolase Proteins 0.000 description 3
- 102000008102 Ankyrins Human genes 0.000 description 3
- 108010049777 Ankyrins Proteins 0.000 description 3
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 3
- 206010060823 Choroidal neovascularisation Diseases 0.000 description 3
- 238000009007 Diagnostic Kit Methods 0.000 description 3
- 102100028987 Dual specificity protein phosphatase 2 Human genes 0.000 description 3
- 102100034893 E3 ubiquitin-protein ligase HUWE1 Human genes 0.000 description 3
- 101710184673 Enolase 1 Proteins 0.000 description 3
- 102100039289 Glial fibrillary acidic protein Human genes 0.000 description 3
- 101710193519 Glial fibrillary acidic protein Proteins 0.000 description 3
- 102100035354 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 101000838335 Homo sapiens Dual specificity protein phosphatase 2 Proteins 0.000 description 3
- 101001019732 Homo sapiens E3 ubiquitin-protein ligase HUWE1 Proteins 0.000 description 3
- 206010025415 Macular oedema Diseases 0.000 description 3
- 239000000020 Nitrocellulose Substances 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 101710120037 Toxin CcdB Proteins 0.000 description 3
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 3
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 3
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 3
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 3
- 229940091179 aconitate Drugs 0.000 description 3
- GTZCVFVGUGFEME-UHFFFAOYSA-N aconitic acid Chemical compound OC(=O)CC(C(O)=O)=CC(O)=O GTZCVFVGUGFEME-UHFFFAOYSA-N 0.000 description 3
- 210000001742 aqueous humor Anatomy 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- VLMZMRDOMOGGFA-WDBKCZKBSA-N festuclavine Chemical compound C1=CC([C@H]2C[C@H](CN(C)[C@@H]2C2)C)=C3C2=CNC3=C1 VLMZMRDOMOGGFA-WDBKCZKBSA-N 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 230000004377 improving vision Effects 0.000 description 3
- 201000010230 macular retinal edema Diseases 0.000 description 3
- 238000000074 matrix-assisted laser desorption--ionisation tandem time-of-flight detection Methods 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 229920001220 nitrocellulos Polymers 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 230000035939 shock Effects 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- VEPOHXYIFQMVHW-PVJVQHJQSA-N (2r,3r)-2,3-dihydroxybutanedioic acid;(2s,3s)-3,4-dimethyl-2-phenylmorpholine Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.O1CCN(C)[C@@H](C)[C@@H]1C1=CC=CC=C1 VEPOHXYIFQMVHW-PVJVQHJQSA-N 0.000 description 2
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 102100028754 AP-4 complex accessory subunit Tepsin Human genes 0.000 description 2
- 208000024827 Alzheimer disease Diseases 0.000 description 2
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 2
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 2
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 2
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 2
- 101710081722 Antitrypsin Proteins 0.000 description 2
- 108010001282 CT-322 Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 102100022785 Creatine kinase B-type Human genes 0.000 description 2
- 229910017518 Cu Zn Inorganic materials 0.000 description 2
- 229910017752 Cu-Zn Inorganic materials 0.000 description 2
- 229910017943 Cu—Zn Inorganic materials 0.000 description 2
- 108010072220 Cyclophilin A Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102100037362 Fibronectin Human genes 0.000 description 2
- 108010067306 Fibronectins Proteins 0.000 description 2
- 208000010412 Glaucoma Diseases 0.000 description 2
- 102100039611 Glutamine synthetase Human genes 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 101000768031 Homo sapiens AP-4 complex accessory subunit Tepsin Proteins 0.000 description 2
- 101000888841 Homo sapiens Glutamine synthetase Proteins 0.000 description 2
- 101000794329 Homo sapiens Probable tubulin polyglutamylase TTLL2 Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 108010044467 Isoenzymes Proteins 0.000 description 2
- 238000010824 Kaplan-Meier survival analysis Methods 0.000 description 2
- 208000001344 Macular Edema Diseases 0.000 description 2
- 102100030202 Probable tubulin polyglutamylase TTLL2 Human genes 0.000 description 2
- 101710092490 Protein kinase 3 Proteins 0.000 description 2
- 208000037111 Retinal Hemorrhage Diseases 0.000 description 2
- 102000019197 Superoxide Dismutase Human genes 0.000 description 2
- 108010012715 Superoxide dismutase Proteins 0.000 description 2
- 102000019355 Synuclein Human genes 0.000 description 2
- 108050006783 Synuclein Proteins 0.000 description 2
- 102000004243 Tubulin Human genes 0.000 description 2
- 108090000704 Tubulin Proteins 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 2
- 230000001475 anti-trypsic effect Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000002508 contact lithography Methods 0.000 description 2
- TVZPLCNGKSPOJA-UHFFFAOYSA-N copper zinc Chemical compound [Cu].[Zn] TVZPLCNGKSPOJA-UHFFFAOYSA-N 0.000 description 2
- 230000001186 cumulative effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 229940051306 eylea Drugs 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 210000005046 glial fibrillary acidic protein Anatomy 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical class O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 208000018769 loss of vision Diseases 0.000 description 2
- 231100000864 loss of vision Toxicity 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000000491 multivariate analysis Methods 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 238000012014 optical coherence tomography Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 238000002428 photodynamic therapy Methods 0.000 description 2
- 108091008695 photoreceptors Proteins 0.000 description 2
- 239000000049 pigment Substances 0.000 description 2
- 238000007639 printing Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 239000000376 reactant Substances 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 210000001525 retina Anatomy 0.000 description 2
- 108091008601 sVEGFR Proteins 0.000 description 2
- 210000003296 saliva Anatomy 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000002553 single reaction monitoring Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000000756 surface-enhanced laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 210000001138 tear Anatomy 0.000 description 2
- 238000012549 training Methods 0.000 description 2
- 239000002753 trypsin inhibitor Substances 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 210000004127 vitreous body Anatomy 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- WMYLYYNMCFINGV-CKCBUVOCSA-N (2s)-2-amino-5-[[(2r)-1-(carboxymethylamino)-1-oxo-3-sulfanylpropan-2-yl]amino]-5-oxopentanoic acid Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O.OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O WMYLYYNMCFINGV-CKCBUVOCSA-N 0.000 description 1
- 101710122378 10 kDa heat shock protein, mitochondrial Proteins 0.000 description 1
- 101710154868 60 kDa heat shock protein, mitochondrial Proteins 0.000 description 1
- 101800000263 Acidic protein Proteins 0.000 description 1
- 102100030446 Adenosine 5'-monophosphoramidase HINT1 Human genes 0.000 description 1
- 101710163062 Adenosine 5'-monophosphoramidase HINT1 Proteins 0.000 description 1
- 102100034033 Alpha-adducin Human genes 0.000 description 1
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 1
- 102100034283 Annexin A5 Human genes 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 102100030516 Beta-crystallin B1 Human genes 0.000 description 1
- 101710189734 Beta-crystallin B1 Proteins 0.000 description 1
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 1
- 108090000312 Calcium Channels Proteins 0.000 description 1
- 102000003922 Calcium Channels Human genes 0.000 description 1
- 102100029968 Calreticulin Human genes 0.000 description 1
- 108090000549 Calreticulin Proteins 0.000 description 1
- 102100024633 Carbonic anhydrase 2 Human genes 0.000 description 1
- 101710167917 Carbonic anhydrase 2 Proteins 0.000 description 1
- 102000004171 Cathepsin K Human genes 0.000 description 1
- 108090000625 Cathepsin K Proteins 0.000 description 1
- 101000726254 Cavia porcellus Cysteine-rich secretory protein 2 Proteins 0.000 description 1
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 1
- 108010067499 Clk dual-specificity kinases Proteins 0.000 description 1
- 102100037579 D-3-phosphoglycerate dehydrogenase Human genes 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 101100339887 Drosophila melanogaster Hsp27 gene Proteins 0.000 description 1
- 238000004252 FT/ICR mass spectrometry Methods 0.000 description 1
- 102100029114 Fatty-acid amide hydrolase 2 Human genes 0.000 description 1
- 102000053171 Glial Fibrillary Acidic Human genes 0.000 description 1
- 108700005000 Glial Fibrillary Acidic Proteins 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 102000005623 HSP27 Heat-Shock Proteins Human genes 0.000 description 1
- 108010045100 HSP27 Heat-Shock Proteins Proteins 0.000 description 1
- 108010027992 HSP70 Heat-Shock Proteins Proteins 0.000 description 1
- 102000018932 HSP70 Heat-Shock Proteins Human genes 0.000 description 1
- 101150096895 HSPB1 gene Proteins 0.000 description 1
- 101001056976 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) Catalase-peroxidase Proteins 0.000 description 1
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 1
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 1
- 102100039165 Heat shock protein beta-1 Human genes 0.000 description 1
- 101710100504 Heat shock protein beta-1 Proteins 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 102000029746 Histidine-tRNA Ligase Human genes 0.000 description 1
- 108700016229 Histidine-tRNA ligases Proteins 0.000 description 1
- 101000799076 Homo sapiens Alpha-adducin Proteins 0.000 description 1
- 101000780122 Homo sapiens Annexin A5 Proteins 0.000 description 1
- 101000918490 Homo sapiens Fatty-acid amide hydrolase 2 Proteins 0.000 description 1
- 101000787273 Homo sapiens Gamma-synuclein Proteins 0.000 description 1
- 101000663158 Homo sapiens Signal recognition particle 14 kDa protein Proteins 0.000 description 1
- 101000596684 Homo sapiens THAP domain-containing protein 10 Proteins 0.000 description 1
- 101000772194 Homo sapiens Transthyretin Proteins 0.000 description 1
- 101000659230 Homo sapiens Tubulin-tyrosine ligase-like protein 12 Proteins 0.000 description 1
- 101000809243 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 10 Proteins 0.000 description 1
- 101000748141 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 32 Proteins 0.000 description 1
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 1
- 102000015564 Islet cell autoantigen 1 Human genes 0.000 description 1
- 108050004848 Islet cell autoantigen 1 Proteins 0.000 description 1
- 102000058057 JmjC domain-containing Human genes 0.000 description 1
- 108700001203 JmjC domain-containing Proteins 0.000 description 1
- 108700036276 KH902 fusion Proteins 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 101000839464 Leishmania braziliensis Heat shock 70 kDa protein Proteins 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108010026255 MP0112 Proteins 0.000 description 1
- 206010025421 Macule Diseases 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- 101800001325 Met-enkephalin Proteins 0.000 description 1
- 102400000988 Met-enkephalin Human genes 0.000 description 1
- YFGBQHOOROIVKG-FKBYEOEOSA-N Met-enkephalin Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 YFGBQHOOROIVKG-FKBYEOEOSA-N 0.000 description 1
- 102000006404 Mitochondrial Proteins Human genes 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 102000047918 Myelin Basic Human genes 0.000 description 1
- 101710107068 Myelin basic protein Proteins 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- DCOQYNAXIITCKL-UHFFFAOYSA-N OC(=O)C(=O)CS.OC(=O)C(=O)CS Chemical compound OC(=O)C(=O)CS.OC(=O)C(=O)CS DCOQYNAXIITCKL-UHFFFAOYSA-N 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 1
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 1
- 102100034539 Peptidyl-prolyl cis-trans isomerase A Human genes 0.000 description 1
- 101710132585 Peroxidase 4 Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102100026918 Phospholipase A2 Human genes 0.000 description 1
- 108010058864 Phospholipases A2 Proteins 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 101800001072 Protein 1A Proteins 0.000 description 1
- 102000006478 Protein Phosphatase 2 Human genes 0.000 description 1
- 108010058956 Protein Phosphatase 2 Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 1
- 206010038848 Retinal detachment Diseases 0.000 description 1
- FHXAGOICBFGEBF-BQBZGAKWSA-N S-formylglutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CSC=O)C(=O)NCC(O)=O FHXAGOICBFGEBF-BQBZGAKWSA-N 0.000 description 1
- 108700021086 S-formylglutathione Proteins 0.000 description 1
- 102100022310 SPRY domain-containing SOCS box protein 3 Human genes 0.000 description 1
- 101710178386 SPRY domain-containing SOCS box protein 3 Proteins 0.000 description 1
- 102000000886 SPRY domains Human genes 0.000 description 1
- 108050007917 SPRY domains Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 101710141937 Single-stranded DNA-binding protein 3 Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 108010019965 Spectrin Proteins 0.000 description 1
- 102000005890 Spectrin Human genes 0.000 description 1
- 101710090563 Spectrin alpha chain Proteins 0.000 description 1
- 102000004385 Sulfurtransferases Human genes 0.000 description 1
- 108090000984 Sulfurtransferases Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 101710202239 Tubulin beta-3 chain Proteins 0.000 description 1
- 102100036111 Tubulin-tyrosine ligase-like protein 12 Human genes 0.000 description 1
- 108010005656 Ubiquitin Thiolesterase Proteins 0.000 description 1
- 102000005918 Ubiquitin Thiolesterase Human genes 0.000 description 1
- 102100038426 Ubiquitin carboxyl-terminal hydrolase 10 Human genes 0.000 description 1
- 101710159648 Uncharacterized protein Proteins 0.000 description 1
- 102000006668 UniProt protein families Human genes 0.000 description 1
- 108020004729 UniProt protein families Proteins 0.000 description 1
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 1
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 108010089411 angiocal protein Proteins 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 239000000091 biomarker candidate Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001775 bruch membrane Anatomy 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000004715 cellular signal transduction Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000003161 choroid Anatomy 0.000 description 1
- 229950005748 conbercept Drugs 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000013399 early diagnosis Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 230000003619 fibrillary effect Effects 0.000 description 1
- 230000001497 fibrovascular Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 108010066358 heat-shock protein 70.1 Proteins 0.000 description 1
- 108700039582 histidine triad Proteins 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000005040 ion trap Methods 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 238000012125 lateral flow test Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 210000005157 neural retina Anatomy 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 238000003068 pathway analysis Methods 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 238000011338 personalized therapy Methods 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000000649 photocoagulation Effects 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000012910 preclinical development Methods 0.000 description 1
- 239000000092 prognostic biomarker Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000005173 quadrupole mass spectroscopy Methods 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 102200139266 rs10490924 Human genes 0.000 description 1
- 108010093322 s-formylglutathione hydrolase Proteins 0.000 description 1
- 102000028528 s-formylglutathione hydrolase Human genes 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000002301 subretinal fluid Anatomy 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000000672 surface-enhanced laser desorption--ionisation Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 102000013498 tau Proteins Human genes 0.000 description 1
- 108010026424 tau Proteins Proteins 0.000 description 1
- 238000001269 time-of-flight mass spectrometry Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 108010008314 tyrosine-tubulin Proteins 0.000 description 1
- 229910021642 ultra pure water Inorganic materials 0.000 description 1
- 239000012498 ultrapure water Substances 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 230000028973 vesicle-mediated transport Effects 0.000 description 1
- 230000004382 visual function Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000010626 work up procedure Methods 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/16—Ophthalmology
- G01N2800/164—Retinal disorders, e.g. retinopathy
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
Definitions
- This invention lies in the field of medical diagnostics and also of personalized therapy.
- the invention described herein can be utilized as a diagnostic assay to identify those subjects having dry or wet AMD.
- the invention is directed to predicting whether an individual having wet AMD will clinically respond to the treatment with a VEGF antagonist.
- aspects of the invention further relate to additional diagnostic and prognostic methods regarding diagnosis and therapeutic treatment of the dry and wet AMD diseases.
- Age-related macular degeneration is the leading cause of blindness in elderly people in North America and Western Europe and has become a significant health problem as the percentage of individuals above the age of 50 increases (Hymann, Epidemology, 1992).
- AMD targets the retinal pigment epithelium (RPE), a monolayer of cells between the light sensitive photoreceptors and the vascular choroid.
- RPE retinal pigment epithelium
- the dry form is more frequent (80% of AMD patients) and results in a mild loss of visual function. Its onset is less sudden and it occurs without coincident neovascularization. The more severe wet neovascular form is less common but causes approximately 80-90% of cases of serious loss of vision.
- the wet form is characterized by neovascular “membranes” derived from the choroidal vasculature that invade Bruch's membrane, leak, and often cause detachments of the RPE and or the neural retina. These new capillaries are abnormally permeable, allowing accumulation of serum and blood under the RPE and or the neurosensory retina. The leaking blood vessels lead to a scarring of the macula.
- the loss of vision in patients with wet AMD can be rapid and result in functional blindness.
- the complex formed by the choroidal new vessels and the fibrous tissue can destroy the photoreceptors within 3-24 months.
- the dry form can turn into the wet form.
- Effective therapies for the dry AMD form are rare, whereas the wet form can be treated by laser photocoagulation, photodynamic therapy or by using VEGF antagonists.
- Early diagnosis of the wet form is essential in order to take action as promptly as possible to obtain best results from therapy.
- Anti-VEGF therapy is now used worldwide as the main therapy for treating wet AMD.
- Several VEGF antagonists for the treatment of wet AMD have been approved for human use, including ranibizumab (Lucentis®) and aflibercept (Eylea®).
- non-responders vary depending on the criteria and determination methods used. Earlier publication found even higher percentages of non-responders to anti-VEGF treatment. It was also reported that non-responders had initial clinical characteristics and certain risk factors such as prolonged AMD, previous photodynamic therapy, fibrovascular pigment epithelial detachment, lesion size, age of the patients.
- the invention is directed to predicting whether an individual having wet AMD will clinically respond to the treatment with a VEGF antagonist.
- a second aspect of the invention relates to diagnose dry and wet AMD, in particular to factors which distinguish between the two forms of AMD.
- the invention is directed to predicting the risk of a patient with dry AMD disease to suffer from conversion of dry AMD to wet AMD.
- a first aspect of the present invention is based on the finding that particular biomarkers can be used to select those individuals having wet AMD who are likely to respond to treatment with a VEGF antagonist. It was surprisingly found that the IgG autoantibody patterns in a sample from an individual having wet AMD compared to a control, can be used to predict whether that individual n will respond to anti-VEGF treatment.
- the present invention thus allows a treatment provider to identify those individuals having wet AMD who are responders to anti-VEGF treatment, and those who are non-responders to such treatment, prior to administration of a VEGF antagonist and also during therapy with a VEGF antagonist.
- Group A antibodies consists of or includes antibodies directed against: MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1, SELO, SOD, ENO2.
- Group A autoantibodies were additionally found to be useful in the prediction of the risk of conversion from dry AMD to a wet AMD disease.
- Group B antibodies These autoantibodies relevant for the second aspect of the invention, i.e. for the distinction between dry and wet AMD, are for the purpose of this invention termed Group B antibodies.
- the Group B of antibodies consists of or includes antibodies directed against: alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4.
- Some of the autoantibodies of this invention are members of both the Group A and the Group B.
- the antibodies of Group A and Group B are assigned to the following subgroups relating to their diagnostic significance.
- a subgroup A-1 of first priority autoantibodies comprises MAPK3, OGFR, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2, Chromosome 17, EIFA1;
- a subgroup A-2 of second priority autoantibodies comprises GPX4, Gamma-synuclein, GPD2, AP1M1, ENO1-H7, PRG2;
- a subgroup A-3 of third priority autoantibodies comprises ATP synthase, GNB1-A3, TUBB3, HSP60, ICA1, SELO.
- a subgroup B-1 of first priority autoantibodies comprises alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10;
- a subgroup B-2 of second priority autoantibodies comprises ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZC-3, EIFA1, MAPK3;
- a subgroup B-3 of third priority autoantibodies comprises ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4.
- one or several autoantibodies of a specified group or subgroup is relevant to a particular step of a method of diagnosis or prognosis relating to AMD.
- the phrase one or several antibodies selected from antibodies of a group or of a subgroup, in particular directed against a list of specified antigenic proteins comprises each of the autoantibodies of the specified group or subgroup—or each of the corresponding antigenic proteins—separately and in all possible combinations with one or more than one up to all of the other antibodies or antigens of the particular group or subgroup of antibodies or antigens.
- one or several antibodies selected from antibodies of a particular group or subgroup may include each and every one of the antibodies listed as member of the particular group or subgroup or may include any fraction thereof, e.g. the all of the members except for one or more than one of the antibodies belonging to a particular group.
- diagnosis and diagnostic relate to the diagnosis of dry and wet AMD and also to the prognosis of a prospective course of dry and wet AMD, including but not limited to responsiveness to a particular AMD treatment, in particular a treatment of wet AMD with a VEGF-antagonist, and in particular to the risk of conversion from dry to wet AMD.
- an autoantibody is an antibody formed in response to, and reacting against, an antigenic constituent of the individual's own tissue.
- An autoantibody is directed against one or more of the individual's own protein (self antigen).
- a method for determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist is provided.
- a method for determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist by measuring the autoantibody content of a sample from said individual and comparing it with the antibody content of a healthy control is provided.
- the invention provides a method of determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist, the method comprising:
- the invention in the first aspect provides a method of determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist, the method comprising:
- a method for determining whether a subject with wet AMD should be treated with a VEGF antagonist comprising:
- a method for determining whether a subject with wet AMD should be treated with a VEGF antagonist comprising:
- said subject in the method provided for determining whether a subject with wet AMD should be treated with a VEGF antagonist, said subject should be treated with a VEGF antagonist, when the level of one or several group A autoantibodies in the sample is increased or decreased by at least 10%, by 20%, by 30%, by 40%, by 50%, by 100%, by 150%, by 200%, by 250%, preferably by 25%-150%, more preferably by 50-100%, in the sample compared to a control value, in particular a control value derived from healthy subjects.
- the determination of the quantity of antibodies may be done using Western blot or immunoblot assays, enzyme-linked immunoabsorbent assays (ELISA), radioimmunoassays, real-time PCR, microarrays, lateral flow, microfluidic, bead based assays, mass spectrometry.
- ELISA enzyme-linked immunoabsorbent assays
- radioimmunoassays real-time PCR
- microarrays lateral flow
- microfluidic microfluidic
- bead based assays mass spectrometry.
- the binding partners are not limited to their physiological antigenic binding partners but include also e.g. peptides such as fragments of the entire physiological polypeptide or other variants thereof.
- the method can be performed with a sample that is a fluid sample such as blood, serum, tears, saliva, urine, a cell sample such as buccal cells, aqueous humor or vitreous body of the eye.
- a fluid sample such as blood, serum, tears, saliva, urine
- a cell sample such as buccal cells, aqueous humor or vitreous body of the eye.
- kits for determining an AMD patient as a responder to anti-VEGF treatment are provided.
- a diagnostic kit for determining if an individual with wet AMD is a VEGF antagonist responder comprises one or more than one agent for measuring the quantity of one or several autoantibodies selected from Group A antibodies directed against MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1, SELO, SOD, ENO2 and instructions for use or in particular for measuring the quantity of one or several autoantibodies selected from subgroup A-1 and or subgroup A-2 and/or subgroup A-3.
- kits for determining if an individual with wet AMD is a VEGF antagonist responder comprises antigen carrying elements which carry ocular antigens and/or carries one or several antigens of any of Groups A and/or B.
- An ocular antigen is defined as an antigen expressed in any tissue of the eye.
- the antigen carrying element is or is part of a microarray slide, such as a lateral flow test strip or a microfluidic chip.
- a diagnostic kit comprises auxiliary materials such as analytical tools and or software for an image reader wherein the software is used for one or more of the steps of quantifying the measured autoimmune reactivity.
- auxiliary material for taking a sample of body fluid is included, such as for example blotting paper, reactants and/or reaction containers for the detection and measurement of the autoimmune reactivity after incubation of the antigen carrying element with a body fluid or reactants for treating a body fluid sample prior to incubation with the antigen carrying element or for eluting the body fluid from an adsorbant material on which it was collected.
- the second aspect of the invention relates to a method to diagnose wet and dry AMD and to distinguish between the two forms of the AMD disease based on a Group of autoantibodies termed the Group B of antibodies as mentioned above. While the dry form is more frequent and less severe, patients with dry AMD have an increased risk of developing the more severe form of wet AMD. Thus, in the second aspect of the invention autoimmunereactivites distinctive for dry and wet AMD are analyzed. In particular the amount of the Group B antibodies are compared between a sample from an individual to be tested and control values which may be obtained by analysis of the autoimmunereactivities of the same Group B antibodies from healthy individuals and/or from individuals with dry AMD and/or with individuals with wet AMD.
- a method is provided to determine whether an individual suffers from dry AMD and/or wet AMD, the method comprising:
- a method for diagnosis of wet and dry AMD and for distinguishing between the two forms of the AMD comprising:
- a method is provided to determine the probability that a patient diagnosed with dry AMD will develop wet AMD.
- Autoantibodies which are members of the Group A and autoantibodies which are members of the Group B i.e. autoantibodies which are members of either Group A or of Group B and autoantibodies which are members of both Groups A and B were found to be useful in the prediction of the risk of conversion from dry AMD to a wet AMD disease.
- a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
- a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
- a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
- FIG. 1 shows a longitudinal analysis of IgG immunoreactivities in wet AMD patients, who started with Lucentis treatment. Samples were taken before and 2, 3, 4, 6, and 12 months after starting Lucentis treatment.
- FIG. 2 Comparison of immunoreactivities in patients suffering from dry AMD and wet AMD compared to CTRL. All immunoreactivities.
- FIG. 3 Comparison of immunoreactivities in patients suffering from dry AMD and wet AMD compared to CTRL. 20 most significant reactivities.
- FIG. 4 Comparison of immunoreactivities in patients suffering from wet AMD. The patients were divided into those showing vision loss ( ⁇ 1), no change in vision (0), or improvement of vision (1). All immunoreactivities.
- FIG. 5 Comparison of immunoreactivities in patients suffering from wet AMD. The patients were divided into those showing vision loss ( ⁇ 1), no change in vision (0), or improvement of vision (1). 20 most significant reactivities.
- FIG. 6 The results of the data mining procedures (C&RT and artificial neural networks) were used as input for this analysis.
- a survival analysis Kerpan-Meier analysis, Cumulative proportion surviving was performed to assess how strongly the classification of the data mining procedures influence the survival time (time to vision loss) in this 12 months study.
- a patient can be considered a responder if treatment with a VEGF antagonist is useful and effective, as regards not only improvement but also stability, meaning a visual acuity (VA) loss of fewer than 15 ETDRS letters (ETDRS stands for Early Treatment Diabetic Retinopathy Study) after three successive follow-up visits (the follow-up visits start after three anti-VEGF injections).
- a patient can be considered as responder who gains visual acuity and maintains the gain over time. Patients who gain visual acuity but do not maintain the gain, losing visual acuity to not lower than at baseline are also considered responders. Responders are also considered as patients who gain visual acuity but do not maintain the gain, losing visual acuity to less than 15 ETDRS letters lower than at baseline.
- a patient can be considered a non-responder if treatment with a VEGF antagonist gives no overall clinical benefit, assessed on the basis of morphological and functional parameters, and there is immediate or late visual loss.
- Non-responders are patients who lose more than 15 ETDRS letters in total in three successive follow-up visits (the follow-up visits start after three anti-VEGF injections).
- Non-responders are also considered as patients who lose more than 30 ETDRS letters compared with baseline and or best visual acuity recorded at baseline.
- Non-responders are also defined as patients whose best corrected visual acuity (BCVA) had worsened in the log MAR score.
- BCVA best corrected visual acuity
- non-responders are also determined by fundus findings including OCT (optical coherence tomography).
- a non-responder is also defined as a patient in whom exudative fundus findings (pigment epithelial detachment, subretinal fluid, macular oedema, haemorrhage) had increased or had appeared after treatment, or in whom the central retinal thickness (CTR) increased by more than 100 ⁇ m within 12 months after the initial anti-VEGF injection.
- exudative fundus findings pigment epithelial detachment, subretinal fluid, macular oedema, haemorrhage
- CTR central retinal thickness
- the quantity of one or several autoantibodies selected from autoantibodies directed against MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1 and SELO, SOD, ENO2 in the patient serum can therefore be used as a means to determine if a patient suffering from dry or wet AMD will respond to a VEGF antagonist therapy, before the VEGF antagonist therapy is initiated.
- immunoreactivities against PolyRp2, GNB1-A3, and TUBB3 are down-regulated in patients improving vision during 12 months under lucentis treatment and upregulated in those who do not.
- the detectable amount of autoantibodies in the serum of a patient suffering from wet AMD changes over time.
- a positive correlation between an optimal dosing regimen and the level of autoantibodies could have been identified.
- the quantity of one or several autoantibodies selected from the Group A of autoantibodies directed against MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1 and SELO, SOD, ENO2 is therefore also a predictive marker when the VEGF antagonist needs to be applied to the patient.
- autoantibody patterns are able to differentiate between patients suffering from wet or dry AMD.
- VEGF is a well-characterised signal protein which stimulates angiogenesis.
- a “VEGF antagonist” refers to a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing or interfering with VEGF activities including its binding to one or more VEGF receptors.
- the VEGF antagonist may be administered intravitreally, e.g. through injection, or topically, e.g. in form of eye drops.
- VEGF antagonists include anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors, anti-VEGF receptor antibodies and VEGF receptor antagonists such as small molecule inhibitors of the VEGFR tyrosine kinases, and fusions proteins.
- the invention also provides non-antibody VEGF antagonists.
- the VEGF antagonist is an antibody. In one embodiment, the VEGF antagonist is a mimetic of the VEGF receptor. In one embodiment, the VEGF antagonist is ranibizumab. In one embodiment, the VEGF antagonist is bevacizumab.
- the VEGF antagonist is a non-antibody VEGF antagonist.
- the non-antibody VEGF antagonist is an immunoadhesin.
- aflibercept Esylea®
- VEGF-trap VEGF-trap
- Aflibercept is the preferred non-antibody VEGF antagonist for use with the invention.
- Aflibercept is a recombinant human soluble VEGF receptor fusion protein consisting of portions of human VEGF receptors 1 and 2 extracellular domains fused to the Fc portion of human IgG1.
- VEGF antagonist immunoadhesin currently in pre-clinical development is a recombinant human soluble VEGF receptor fusion protein similar to VEGF-trap containing extracellular ligand-binding domains 3 and 4 from VEGFR2/KDR, and domain 2 from VEGFR1/n Flt-1; these domains are fused to a human IgG Fc protein fragment (Li et al., Molecular Vision, 2011).
- This antagonist binds to isoforms VEGF-A, VEGF-B and VEGF-C.
- the molecule is prepared using two different production processes resulting in different glycosylation patterns on the final proteins.
- the two glycoforms are referred to as KH902 (conbercept) and KH906.
- the fusion protein can have the following amino acid sequence (SEQ ID NO:2):
- Non-antibody VEGF antagonists include antibody mimetics (e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, Kunitz domain peptides, and monobodies) with VEGF antagonist activity.
- antibody mimetics e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, Kunitz domain peptides, and monobodies
- the ankyrin binding domain may have the following amino acid sequence (SEQ ID NO: 3):
- Recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2 are described in more detail in WO2010/060748 and WO2011/135067.
- antibody mimetics with VEGF antagonist activity are the 40 kD pegylated anticalin PRS-050 and the monobody angiocept (CT-322).
- the non-antibody VEGF antagonist may be modified to further improve its pharmacokinetic properties or bioavailability.
- a non-antibody VEGF antagonist may be chemically modified (e.g., pegylated) to extend its in vivo half-life.
- it may be modified by glycosylation or the addition of further glycosylation sites not present in the protein sequence of the natural protein from which the VEGF antagonist was derived.
- Variants of the above-specified VEGF antagonists that have improved characteristics for the desired application may be produced by the addition or deletion of amino acids.
- these amino acid sequence variants will have an amino acid sequence having at least 60% amino acid sequence identity with the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%, including for example, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100%.
- Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as BLAST or FASTA, two polypeptides are aligned for optimal matching of their respective amino acids (either along the full length of one or both sequences or along a pre-determined portion of one or both sequences). The programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 [a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 (1978)] can be used in conjunction with the computer program. For example, the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the longer sequences in order to align the two sequences.
- the autoantibody pattern, the presence or lack of a certain quantity of an antibody in a sample from an individual having AMD can individually, or in combination, serve as biomarkers to predict responsiveness of that individual to treatment with a VEGF antagonist.
- the presence of these biomarkers can be determined in a sample from an individual of interest.
- the sample can be any sample including but is not limited to a fluid sample such as blood, serum, tears, saliva, urine, a cell sample such as buccal cells, aqueous humor or vitreous body of the eye.
- predicting indicates that the methods described herein provide information to enable a health care provider to determine the likelihood that an individual having wet AMD will respond to VEGF antagonist treatment (anti-VEGF therapy). Following a positive determination of the relevant biomarker(s) in a sample of interest, the individual will be administered a VEGF antagonist.
- Methods to quantify the autoantibody contents include but are not limited to standard immunological analytical techniques such as Western blot or immunoblot assays, enzyme-linked immunoabsorbent assays (ELISA), radioimmunoassays, real-time PCR, microarrays, lateral flow, microfluidic assays, bead based assays, nontargeted proteomics involving e.g. massanalyzers such as ion-trap detection, fourier transformion cyclotron resonance, time-of-flight (TOF) mass spectrometry, targeted proteomics involving e.g.
- standard immunological analytical techniques such as Western blot or immunoblot assays, enzyme-linked immunoabsorbent assays (ELISA), radioimmunoassays, real-time PCR, microarrays, lateral flow, microfluidic assays, bead based assays, nontargeted proteomics involving e.g. massanalyzers
- SRM selected reaction monitoring
- TQMS triple quadrupole mass spectrometry
- MALDI matrix assisted laser desorption/ionization mass spectrometry
- the invention is not limited by the types of methods used to determine the quantities of autoantibodies.
- an individual is classified as a VEGF antagonist responder if the amounts of one or several of Group A autoantibodies selected from antibodies directed against MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1, SELO, SOD, ENO2 are increased or decreased by at least 10%, by 20%, by 30%, by 40%, by 50%, by 100%, by 150%, by 200%, by 250%, preferably by 25%-150%, more preferably by 50-100%, in the sample compared to a control (healthy individual).
- an individual having dry AMD is classified as having a risk that the dry AMD converts into wet AMD if the amounts of one or several autoantibodies selected from antibodies of Group A antibodies comprising antibodies directed against: MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1, SELO, SOD, ENO2 or if the amounts of one or several autoantibodies selected from antibodies of Group B antibodies comprising antibodies directed against: alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO
- the methods described herein can be utilized as a diagnostic assay to identify those subjects having wet AMD who are likely to respond to a VEGF antagonist.
- the methods of the invention can be used to determine whether a subject should be administered a VEGF antagonist to reduce the severity of wet AMD.
- the methods described herein can also be utilized as a prognostic assay to identify those subjects having dry AMD who are at risk to develop wet AMD and who would benefit from receiving a VEGF antagonist.
- Prognostic assays can be used for predictive purposes or prophylactic purposes to treat an individual who is at risk to develop wet AMD.
- the autoantibody patterns against retinal antigens in sera of patients with “wet” AMD were analyzed and compared to healthy control subjects and patients with “dry” AMD by mass spectrometry (MS) approach. It is known that two third of serum immunoglobulins in healthy individuals are natural occurring autoantibodies, so that complex profiles exist even in healthy people and disease specific changes of circulating autoantibodies are known from several other diseases, e.g. glaucoma or Sicca syndrome. After successful de novo screening of immunoreactivities using MS-based approach and high density Protagen antigen microarrays, a customized antigen microarray containing 61 antigens was built (Table 2). Each microarray contained each antigen as triplicate. Patients were included in the study based on the protocol following all inclusion- and exclusion criteria.
- Cyclophilin A human Cyclophilin B isomerase A (Cyclophilin A) P61604 10.9 10 kDa heat shock Chaperonin 10, HSP 10 protein, mitochondrial Recombinant, (Hsp10) Human P00441 15.9 Superoxide dismutase Superoxide Dismutase SOD [Cu—Zn] from bovine erythrocytes P02686 33.1 Myelin basic protein Myelin Basic Protein MBP (MBP); Isoform 1 from bovine brain P04792 22.8 Heat shock protein Hsp27 Protein - Low HSP 27 beta-1 (Heat shock 27 Endotoxin kDa protein; Hsp27) P08107 70.1 Heat shock 70 kDa Heat Shock Protein 70 HSP 70 protein 1A/1
- mRNA B7Z4U7 65.1 Sec1 family domain vesicle transport-related VTI-B containing 1, isoform protein isoform b CRA_b [ Homo sapiens ] Q9BVL4 73.5 Selenoprotein O Homo sapiens SELO selenoprotein O (SELO) mRNA Q6PJ21 39.4 SPRY domain-contain- SPRY domain-containing SPRX ing SOCS box protein 3 SOCS box protein SSB-3 P35611 81.0 Alpha-adducin adducin 1 (alpha) Adduccin isoform c [ Homo sapiens ] Q99798 85.4 Aconitate hydratase, Aconitate Hydratase 2 Aconitate mitochondrial (mitochondrial) Hydratase P06576 56.6 ATP synthase subunit ATP synthase ATP Synthase beta, mitochondrial P40926 35.5 Malate dehydrogenase, Malat dehydrogenase Mal
- the immunoreactivities were analyzed in patients suffering from dry AMD, wet AMD, and compared to healthy controls.
- Table 3 shows the results of ANOVA analysis and their corresponding p-values for the most-significant antigens.
- the immunoreactivities of dry and wet AMD patients are highly significantly different from each other and from controls. Although as part of natural autoimmunity also in healthy subjects complex antibody patterns against the tested antigens could be shown, the patterns in both AMD groups are changed. One of the most prominently changed reactivity is against alpha-synuclein. Alpha-synuclein is known from other neurodegenerative diseases. Others are heat shock proteins (e.g. HSP 10) and also Annexin V, which plays a major role in apoptotic processes. Some others are antithetic regulated in wet and dry-AMD such as VTI-B, PBP-12, and OGFR.
- Pathway comparison analysis revealed protein functions particularly found in immunological diseases, especially aconitase 2, which plays a role in citric acid cycle, further enolase 1, Annexin V, mitogen-activated protein kinase C (MAPK3) and Alpha-Synuclein. Mutations in Alpha-synuclein e.g. are associated with Parkinson's disease, Alzheimer's disease, and several other neurodegenerative illnesses.
- Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Apart from the immunological markers, bio functions playing a major role in inflammation could be observed, like e.g.
- Alpha-synuclein, aconitase 2, enolase 1 and GADPH glycosylcholine dehydrogenase
- GADPH glycosylcholine dehydrogenase
- Annexin V is proposed to have anti-apoptotic and anti-inflammatory functions, comparison of immunoreactivities in our study revealed higher reactivity in the dry AMD-group. It could clearly be demonstrated that there are huge differences in the immunoreactivities in both wet and dry AMD groups.
- FIG. 1 shows the IgG pattern analysis in wet AMD patients. The samples were taken before, and 2, 3, 4, 6, and 12 months after starting lucentis treatment. Table 4 reveals the most significant antibody reactivities changing after starting treatment with lucentis. Overall, no clear increase in immunoreactivities could be observed after the lucentis treatment. Most significant change is shown for MAPK3. No single antigen revealed significant changes in univariate ANOVA. However, the Mahalanobis distances could reveal several significant differences in multivariate analysis taken the complete antibody/antigen pattern simultaneously, especially between the later time points. Furthermore, no differentiation between the groups could be detected in multivariate canonical root analysis.
- Wilks' Lamda values in the range of 0 (perfect discrimination) to 1 (no discrimination)
- Partial Lambda The Wilks' Lambda associated with the unique contribution of the respective variable to the discriminatory power of the model.
- the immunoreactivities in patients suffering from wet AMD depending on success of treatment were compared. Based on visual acuity (log mar) the patients were divided into those showing vision loss during the 12 months treatment by lucentis ( ⁇ 1), no change in vision (0), or improvement of vision (1). Highly significant changes could be observed between those immunoreactivities from patients showing an improvement of vision during lucentis treatment and those who do not.
- FIG. 4 and FIG. 5 compare the IgG reactivities and reveal the most significant changes. Furthermore, ANOVA could demonstrate highly significant changes in a large number of antigens (Table 5 and Table 6). Multivariate canonical root analysis could reveal a good differentiation between the groups.
- GMM general regression model
- the immunoreactivities could have predictive value to determine the treatment effect of lucentis in AMD patients.
- Involved are antigens such as MAPK3, Gamma-synuclein, different heat shock proteins and many others.
- Several of the immunoreactivities are regulated in opposed directions. E.g. immunoreactivities against OGFR, Gamma-synuclein, pre-albumin, and PRG2 are up-regulated in patients improving vision during 12 months under lucentis therapy and down-regulated in those who do not.
- immunoreactivities against PolyRp2, GNB1-A3, and TUBB3 are down-regulated in patients improving vision during 12 months under lucentis treatment and up-regulated in those who do not.
- some heat shock proteins show huge difference in IgG immunoreactivities against them.
- Pathway analysis showed that nine proteins were associated with cellular growth and proliferation, namely ATP synthase, eukaryotic translation initiation factor 4A1 (EIFA1), enolase 1, glutathione peroxidase 4 (GPX4), HSP60, MAPK3, Opioid growth factor receptor (OGFR), Gamma-Synuclein and beta Tubulin (TUBB3).
- EIFA1 eukaryotic translation initiation factor 4A1
- GPX4 enolase 1
- HSP60 eukaryotic translation initiation factor 4A1
- MAPK3 Opioid growth factor receptor
- TUBB3 Gamma-Synuclein
- Immunoreactivities against OGFR were up-regulated in patients improving in vision under lucentis therapy, whereas a down-regulation was observed in case of vision loss.
- C&RT models general classification/regression tree models
- an artificial neural network was trained to recognize those antibody patterns which are correlated with a successful treatment with lucentis. After training, those patterns could be recognized with a sensitivity and specificity of about 95%. Nevertheless, it is important to consider that the number of patients in this pilot study is small and further validation studies in larger cohorts are needed to address the predictive value in detail. The most discrimination power was attributed to e.g. OGFR, SPR14, pre-albumin etc. which also were important immunoreactivities in the preceding analyses.
- the Kaplan-Meier plot demonstrates the huge impact this a priori classification based on their antibody patterns has on the outcome of lucentis treatment over time.
- a component of variance analysis was performed to assess the effect of the parameters vision change, retinal hemorrhage, macular edema, and choroidal neovascularization (CNV) on immunoreactivities. There are no very clear singular effects of these clinical parameters on the immunoreactivity levels for each antigen. For all of the antigens, the effect of change in vision, retinal hemorrhage, macular edema, or CNV are very small and not significant. However, the interaction between those (e.g. 1*2*3*4) can have a larger impact on the antibody patterns.
- SELDI-TOF surface enhanced laser desorption/ionization-time of flight
- MS mass spectrometry
- Maldi-TOF or ESI-MSMS Maldi-TOF or ESI-MSMS.
- the magnetic beads are designed to capture immunoglobulins via a cell wall component, binding a wide range of IgG antibodies during incubation with various body fluids, such as sera. During a subsequent incubation with homogenized antigens it is possible to capture relevant antigens by secondary binding to the antibodies.
- antigens can be analyzed by SELDI-TOF MS using ProteinChips with different, separating chip surfaces e.g. cationic and anionic exchangers, hydrophobic surfaces and metal-ion affinity-chromatographic surfaces. Resulting mass spectra can be statistically analyzed and compared to gain significantly higher or lower antigen-antibody-reactivity peaks according to the study groups.
- Plasma samples will be centrifuged at 1000 g for ten minutes and the supernatant will be stored at ⁇ 80° C. for subsequent analysis.
- Magnetic protein G beads (Dynal, Oslo, Norway) will be incubated with the patient's sera. After several washings steps the patient's antibodies will be covalently bound to the beads using ethanolamine.
- the bead-antibody complexes will be incubated with homogenized retinal antigens.
- the antigens bound to the patient's autoantibodies will be eluted, concentrated, and analyzed by SELDI time-of-flight (TOF) MS ProteinChips with two different chromatographic surfaces (CM10 cation exchange and H50 reversed phase).
- TOF SELDI time-of-flight
- the samples will be measured with a SELDI-TOF MS ProteinChip system (Biorad, Hercules) on a PBS-IIc ProteinChip Reader.
- Raw data will be transferred to CiphergenExpress 2.1 database software (Biorad, Hercules) for workup and analysis.
- a recently developed Proteomics Software Project (PSP) will statistically evaluate the spectra using different statistical approaches (trained neuronal networks, tree algorithms and multivariate statistics) to guarantee a high specificity and sensitivity of antibody patterns for the observed study groups.
- the PSP will additionally search for highly significant biomarkers directing a Statistical based analysis using above mentioned algorithms.
- proteins will be tryptically digested, crystallized on matrix, and analyzed on a MALDI target.
- the obtained peptide mass fingerprint data will be exported into BioTools and used for an internal Mascot database search (SwissProt and NCBI), leading to protein identifications.
- the spotting of antigens was performed with both a non-contact printing technology (sciFLEXARRAYER S3, Scienion, Berlin, Germany), based on piezo dispensing, and the commonly used pin based contact printing technique (OmniGrid100, Digilab Genomic Solutions, Ann Arbor, USA). Results were comparatively evaluated for spot morphology and spot to spot variability. For printing of the whole set of study microarrays the piezo based spotting technique was used. Each antigen was spotted in triplicate onto nitrocellulose-slides (Oncyte, nitrocellulose 16 multi-pad slides, Grace Bio-Labs, Bend, USA).
- mouse anti human IgG/A/M or human IgG (10 ⁇ g/ ⁇ l) and spotting buffer.
- the spotting process was performed at RT and a humidity of 30%.
- Approximately 1 nl of each antigen-dilution was applied onto the nitrocellulose surface by spotting three times 330 ⁇ l on exactly the same position.
- the accurateness of the spotting volume and the correct positioning of the droplets were monitored prior and after the spotting process of each antigen using the sciDrop-VOLUME and autodrop-detection software (Scienion, Berlin, Germany).
- spot intensity mean intensity SP ⁇ ((sumbkg ⁇ sumtop5 bkg)/(number of pixelSP ⁇ number of pixelstop5 bkg)) where SP represents any spot, bkg the corresponding background and top5 bkg the top five percent of background pixel.
- the confidence levels was calculated as 0.0087 ( ⁇ 1: vision loss); 0,156 (0: no vision change) and 0,835 (1: vision gain).
- the patient will respond to the anti-VEGF treatment with highest probability.
Abstract
The invention is directed to the use of biomarkers to determine responsiveness of an individual with wet AMD to treatment with a VEGF antagonist, to diagnose and distinguish dry and wet AMD and to determine the risk of conversion of a dry AMD disease to a wet AMD disease.
Description
- This application claims the priority of U.S. provisional patent application 62/300,952, filed Feb. 29, 2016, the disclosure of which is incorporated herein by reference in its entirety.
- This application hereby incorporates by reference the material of an electronic Sequence Listing. The material in the electronic Sequence Listing is submitted as a text (.txt) file entitled “P173267PC00_SEQLIST” created on Feb. 27, 2017 which, has a file size of 10 KB, and is herein incorporated by reference in its entirety.
- This invention lies in the field of medical diagnostics and also of personalized therapy. The invention described herein can be utilized as a diagnostic assay to identify those subjects having dry or wet AMD. In a particular aspect, the invention is directed to predicting whether an individual having wet AMD will clinically respond to the treatment with a VEGF antagonist. Aspects of the invention further relate to additional diagnostic and prognostic methods regarding diagnosis and therapeutic treatment of the dry and wet AMD diseases.
- Age-related macular degeneration (AMD) is the leading cause of blindness in elderly people in North America and Western Europe and has become a significant health problem as the percentage of individuals above the age of 50 increases (Hymann, Epidemology, 1992). AMD targets the retinal pigment epithelium (RPE), a monolayer of cells between the light sensitive photoreceptors and the vascular choroid. As AMD progresses two distinct clinical manifestations of late AMD can develop and both forms can even occur in the same patient. One form is referred to as the dry or atrophic form, characterized by the accumulation of small drusen in the RPE leading to a loss of RPE and to a degeneration of the retina in the macular region. The dry form is more frequent (80% of AMD patients) and results in a mild loss of visual function. Its onset is less sudden and it occurs without coincident neovascularization. The more severe wet neovascular form is less common but causes approximately 80-90% of cases of serious loss of vision. The wet form is characterized by neovascular “membranes” derived from the choroidal vasculature that invade Bruch's membrane, leak, and often cause detachments of the RPE and or the neural retina. These new capillaries are abnormally permeable, allowing accumulation of serum and blood under the RPE and or the neurosensory retina. The leaking blood vessels lead to a scarring of the macula. The loss of vision in patients with wet AMD can be rapid and result in functional blindness. In patients with wet AMD the complex formed by the choroidal new vessels and the fibrous tissue can destroy the photoreceptors within 3-24 months. The dry form can turn into the wet form. Effective therapies for the dry AMD form are rare, whereas the wet form can be treated by laser photocoagulation, photodynamic therapy or by using VEGF antagonists. Early diagnosis of the wet form is essential in order to take action as promptly as possible to obtain best results from therapy. Anti-VEGF therapy is now used worldwide as the main therapy for treating wet AMD. Several VEGF antagonists for the treatment of wet AMD have been approved for human use, including ranibizumab (Lucentis®) and aflibercept (Eylea®).
- A certain heterogeneity is seen with the implementation of anti-VEGF therapeutics and anti-VEGF therapy is not completely effective for every AMD patient. Some patients still lose their visual acuity despite treatment. This heterogeneity demonstrates the need for predictive biomarkers. It would be very helpful for AMD patients if the efficacy of the anti-VEGF treatment could be determined as early as possible in the treatment so that non-responders could change therapy or treatment regimen. Between 10-17% of eyes treated with intravitreal injections of ranibizumab were found to be non-responders (Otsuji et al, Clinical Ophthalmology, 2013; Suzuki et al., British Journal of Ophthalmology, 2014; Kruger Falk et al., Amercian Journal of Ophthalmology 2013). The percentage of non-responders varies depending on the criteria and determination methods used. Earlier publication found even higher percentages of non-responders to anti-VEGF treatment. It was also reported that non-responders had initial clinical characteristics and certain risk factors such as prolonged AMD, previous photodynamic therapy, fibrovascular pigment epithelial detachment, lesion size, age of the patients.
- No means are currently available to determine if a patient will respond positively to an anti-VEGF therapy. It was reported that candidate single nucleotide polymorphisms (SNP's) might serve as prognostic or predictive markers for AMD and a statistically significant association between the LOC387715 A69S TT genotype and anti-VEGF treatment outcome was found (Kitchens et al., Clinical Ophthalmology 2013). There is an increasing body of evidence that suggests a patient's genetic profile can be determinative to a patient's responsiveness to a therapeutic treatment. A determination of genetic factors that influence, for example, the response to a particular drug, could be used to provide a patient with a personalized treatment regimen. Such personalized treatment regimen offer the potential to maximize therapeutic benefit to the patient while minimizing related side effects that can be associated with alternative treatment regimen.
- There is a need to identify factors which can be used to predict whether a wet AMD patient is likely to respond to a particular therapy. There is also a need to identify factors to diagnose dry and wet AMD, in particular to identify factors which distinguish between the two forms of AMD and furthermore there is a need to predict if a patient currently diagnosed with dry AMD will develop the wet form of the disease.
- In a first aspect, the invention is directed to predicting whether an individual having wet AMD will clinically respond to the treatment with a VEGF antagonist. A second aspect of the invention relates to diagnose dry and wet AMD, in particular to factors which distinguish between the two forms of AMD. A third aspect, the invention is directed to predicting the risk of a patient with dry AMD disease to suffer from conversion of dry AMD to wet AMD.
- A first aspect of the present invention is based on the finding that particular biomarkers can be used to select those individuals having wet AMD who are likely to respond to treatment with a VEGF antagonist. It was surprisingly found that the IgG autoantibody patterns in a sample from an individual having wet AMD compared to a control, can be used to predict whether that individual n will respond to anti-VEGF treatment. The present invention thus allows a treatment provider to identify those individuals having wet AMD who are responders to anti-VEGF treatment, and those who are non-responders to such treatment, prior to administration of a VEGF antagonist and also during therapy with a VEGF antagonist.
- These autoantibodies relevant for the first aspect of the invention, i.e. for the distinction between responders and non-responders to anti VEGF treatment, are for the purpose of this invention termed Group A antibodies. The Group A of antibodies consists of or includes antibodies directed against: MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2. - These Group A autoantibodies were additionally found to be useful in the prediction of the risk of conversion from dry AMD to a wet AMD disease.
- Further aspects of the invention are based on the finding that IgG autoantibody patterns in a sample from an individual having wet AMD compared to a sample from an individual having dry AMD differ. Thus, a group of autoantibodies was identified which distinguishes between dry and wet AMD patients.
- These autoantibodies relevant for the second aspect of the invention, i.e. for the distinction between dry and wet AMD, are for the purpose of this invention termed Group B antibodies. The Group B of antibodies consists of or includes antibodies directed against: alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4.
- Some of the autoantibodies of this invention are members of both the Group A and the Group B.
- In a third aspect of the invention it was found, that members of the Group A and members of the Group B, i.e. autoantibodies which are members of either Group A or Group B and autoantibodies which are members of both Group A and Group B were additionally found to be useful in the prediction of the risk of conversion from dry AMD to a wet AMD disease.
- The antibodies of Group A and Group B are assigned to the following subgroups relating to their diagnostic significance.
- Regarding Group A:
- a subgroup A-1 of first priority autoantibodies comprises MAPK3, OGFR, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2,
Chromosome 17, EIFA1; - a subgroup A-2 of second priority autoantibodies comprises GPX4, Gamma-synuclein, GPD2, AP1M1, ENO1-H7, PRG2;
- a subgroup A-3 of third priority autoantibodies comprises ATP synthase, GNB1-A3, TUBB3, HSP60, ICA1, SELO.
- Regarding Group B:
- a subgroup B-1 of first priority autoantibodies comprises alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10;
- a subgroup B-2 of second priority autoantibodies comprises ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZC-3, EIFA1, MAPK3;
- a subgroup B-3 of third priority autoantibodies comprises ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4.
- As will be evident from the text below, in various embodiments of the different aspects of the invention, one or several autoantibodies of a specified group or subgroup is relevant to a particular step of a method of diagnosis or prognosis relating to AMD. For the purpose of this invention the phrase one or several antibodies selected from antibodies of a group or of a subgroup, in particular directed against a list of specified antigenic proteins, comprises each of the autoantibodies of the specified group or subgroup—or each of the corresponding antigenic proteins—separately and in all possible combinations with one or more than one up to all of the other antibodies or antigens of the particular group or subgroup of antibodies or antigens. Thus, conversely, it is understood that the phrase one or several antibodies selected from antibodies of a particular group or subgroup may include each and every one of the antibodies listed as member of the particular group or subgroup or may include any fraction thereof, e.g. the all of the members except for one or more than one of the antibodies belonging to a particular group.
- For the purpose of this invention, unless otherwise explicitly stated or unless evident from the context, the terms diagnosis and diagnostic relate to the diagnosis of dry and wet AMD and also to the prognosis of a prospective course of dry and wet AMD, including but not limited to responsiveness to a particular AMD treatment, in particular a treatment of wet AMD with a VEGF-antagonist, and in particular to the risk of conversion from dry to wet AMD.
- For the purpose of this invention, the terms autoantibodies, antibodies and immunoglobulins shall be used interchangeably. An autoantibody is an antibody formed in response to, and reacting against, an antigenic constituent of the individual's own tissue. An autoantibody is directed against one or more of the individual's own protein (self antigen).
- In one embodiment, of the first aspect of the invention a method for determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist is provided.
- In one embodiment of the first aspect of the invention a method for determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist by measuring the autoantibody content of a sample from said individual and comparing it with the antibody content of a healthy control is provided.
- In one embodiment, the invention provides a method of determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist, the method comprising:
- (i)isolating a sample from an individual having wet AMD;
- (ii) determining the quantity of one or several antibodies selected from Group A antibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 and - (iii) assigning the individual as a VEGF antagonist responder if the sample has an increased or decreased level of any one of the Group A antibodies MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 antibodies compared to a control value, in particular a control value derived from healthy subjects and/or from AMD patients who are responders and/or who are non-responders to treatment with a VEGF antagonist. - In a preferred embodiment, the invention in the first aspect provides a method of determining the responsiveness of an individual with wet AMD to treatment with a VEGF antagonist, the method comprising:
- (i) isolating a sample from an individual having wet AMD;
- (ii) determining the quantity of antibodies directed against selected from a subgroup A-1 of antibodies directed against MAPK3, OGFR, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2,
Chromosome 17, EIFA1; and - (iii) assigning the individual as a VEGF antagonist responder if the sample has an increased or decreased level of antibodies used in step 2 compared to a control value, in particular a control value derived from healthy subjects and/or from AMD patients who are responders and/or who are non-responders to treatment with a VEGF antagonist.
- In another embodiment of the invention there is provided a method for determining whether a subject with wet AMD should be treated with a VEGF antagonist, the method comprising:
- (a)isolating a sample from the subject;
- (b) determining the quantity of one or several antibodies selected from antibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 in the sample; and - (c) determining that the subject should be treated with a VEGF antagonist.
- In a preferred embodiment of the invention there is provided a method for determining whether a subject with wet AMD should be treated with a VEGF antagonist, the method comprising:
- (a) isolating a sample from the subject;
- (b) determining the quantity of antibodies directed against selected from a subgroup A-1 of antibodies directed against MAPK3, OGFR, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2,
Chromosome 17, EIFA1 in the sample; and - (c) determining that the subject should be treated with a VEGF antagonist.
- In these and other embodiments of the invention in the method provided for determining whether a subject with wet AMD should be treated with a VEGF antagonist, said subject should be treated with a VEGF antagonist, when the level of one or several group A autoantibodies in the sample is increased or decreased by at least 10%, by 20%, by 30%, by 40%, by 50%, by 100%, by 150%, by 200%, by 250%, preferably by 25%-150%, more preferably by 50-100%, in the sample compared to a control value, in particular a control value derived from healthy subjects.
- In some embodiments of the invention the determination of the quantity of antibodies may be done using Western blot or immunoblot assays, enzyme-linked immunoabsorbent assays (ELISA), radioimmunoassays, real-time PCR, microarrays, lateral flow, microfluidic, bead based assays, mass spectrometry.
- In some embodiments of the invention for the determination of the quantity of antibodies the binding partners are not limited to their physiological antigenic binding partners but include also e.g. peptides such as fragments of the entire physiological polypeptide or other variants thereof.
- In some embodiments of the invention including the method for determining whether a subject with wet AMD should be treated with a VEGF antagonist, the method can be performed with a sample that is a fluid sample such as blood, serum, tears, saliva, urine, a cell sample such as buccal cells, aqueous humor or vitreous body of the eye.
- In some embodiments of the first aspect of the invention a kit for determining an AMD patient as a responder to anti-VEGF treatment is provided.
- In some embodiments of the invention a diagnostic kit for determining if an individual with wet AMD is a VEGF antagonist responder is provided, the kit comprises one or more than one agent for measuring the quantity of one or several autoantibodies selected from Group A antibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 and instructions for use or in particular for measuring the quantity of one or several autoantibodies selected from subgroup A-1 and or subgroup A-2 and/or subgroup A-3. - In another embodiment a diagnostic kit for determining if an individual with wet AMD is a VEGF antagonist responder is provided, the kit comprises antigen carrying elements which carry ocular antigens and/or carries one or several antigens of any of Groups A and/or B. An ocular antigen is defined as an antigen expressed in any tissue of the eye.
- In some embodiments the antigen carrying element is or is part of a microarray slide, such as a lateral flow test strip or a microfluidic chip. In further embodiments such a diagnostic kit comprises auxiliary materials such as analytical tools and or software for an image reader wherein the software is used for one or more of the steps of quantifying the measured autoimmune reactivity. In further embodiments auxiliary material for taking a sample of body fluid is included, such as for example blotting paper, reactants and/or reaction containers for the detection and measurement of the autoimmune reactivity after incubation of the antigen carrying element with a body fluid or reactants for treating a body fluid sample prior to incubation with the antigen carrying element or for eluting the body fluid from an adsorbant material on which it was collected.
- The second aspect of the invention relates to a method to diagnose wet and dry AMD and to distinguish between the two forms of the AMD disease based on a Group of autoantibodies termed the Group B of antibodies as mentioned above. While the dry form is more frequent and less severe, patients with dry AMD have an increased risk of developing the more severe form of wet AMD. Thus, in the second aspect of the invention autoimmunereactivites distinctive for dry and wet AMD are analyzed. In particular the amount of the Group B antibodies are compared between a sample from an individual to be tested and control values which may be obtained by analysis of the autoimmunereactivities of the same Group B antibodies from healthy individuals and/or from individuals with dry AMD and/or with individuals with wet AMD.
- In one embodiment of the second aspect of the invention a method is provided to determine whether an individual suffers from dry AMD and/or wet AMD, the method comprising:
-
- isolating a sample from a subject;
- determining the quantity of one or several antibodies selected from Group B antibodies directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4 and
- determining that the individual suffers from the dry and/or the wet AMD disease if the amount of the selected Group B autoantibodies is increased or decreased, in particular increased or decreased by at least 20%, at least 30%, at least 40%, at least 50% or at least 75% compared to control values, in particular control values derived from subjects who are healthy and/or derived from subjects with dry AMD and/or with wet AMD.
- In a preferred embodiment a method for diagnosis of wet and dry AMD and for distinguishing between the two forms of the AMD is provided, the method comprising:
-
- isolating a sample from a subject;
- determining the quantity of one or several antibodies of a subgroup B-1 of the Group B autoantibodies directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10;
- determining that the individual suffers from the dry and/or the wet AMD disease if the amount of the selected Group B autoantibodies is increased or decreased, in particular increased or decreased by at least 20%, at least 30%, at least 40%, at least 50% or at least 75%, compared to a control value, in particular control values.
- In the third aspect of the invention a method is provided to determine the probability that a patient diagnosed with dry AMD will develop wet AMD. Autoantibodies which are members of the Group A and autoantibodies which are members of the Group B, i.e. autoantibodies which are members of either Group A or of Group B and autoantibodies which are members of both Groups A and B were found to be useful in the prediction of the risk of conversion from dry AMD to a wet AMD disease.
- In one embodiment of the third aspect of the invention a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
-
- isolating a sample from a subject;
- determining the quantity of one or several antibodies selected from autoantibodies which are members of Group A or of Group B wherein Group A antibodies are directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 and wherein Group B antibodies are directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4 - determining that the individual is at risk to develop wet AMD if the amount of the selected antibodies is decreased or increased, in particular decreased or increased by at least 20%, at least 30%, at least 40%, at least 50%, or at least 75% compared to control values, in particular control values derived from subjects who are healthy and/or derived from subjects with dry AMD and/or with wet AMD.
- In one embodiment of the third aspect of the invention a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
-
- isolating a sample from a subject;
- determining the quantity of one or several antibodies selected from autoantibodies which are members of preferred subgroups A-1 and/or B-1 of Groups A and B, wherein antibodies of the subgroup A-1 are directed against MAPK3, OGFR, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2,
Chromosome 17, EIFA1; and wherein antibodies of subgroup B-1 are directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10; - determining that the individual is at risk to develop wet AMD if the amount of the selected antibodies is decreased or increased, in particular decreased or increased by at least 20%, at least 30%, at least 40%, at least 50%, or at least 75% compared to control values, in particular control values derived from subjects who are healthy and/or derived from subjects with dry AMD and/or with wet AMD.
- In some of these and other embodiments of the third aspect of the invention a method is provided to determine that an individual with dry AMD is at risk to develop wet AMD, the method comprising:
-
- isolating a first sample from a subject;
- isolating a second sample from the subject within a time period of about 2 weeks, or of about 1 month, or of about 2 months, or of about 6 months, or of n about 12 months, or of at least about 12 months after the first sample;
- determining the amount of one or several selected antibodies from Group A or from Group B or subgroups of them as described above.
- determining that the individual is at risk to develop wet AMD if the amount of the selected antibodies is decreased or increased in the second sample compared to the first sample, in particular decreased or increased by at least 20%, at least 30%, at least 40%, at least 50%, or at least 75%.
- The invention will be better understood and objects other than those set forth above will become apparent when consideration is given to the following detailed description thereof. This description makes reference to the annexed figures, wherein:
-
FIG. 1 shows a longitudinal analysis of IgG immunoreactivities in wet AMD patients, who started with Lucentis treatment. Samples were taken before and 2, 3, 4, 6, and 12 months after starting Lucentis treatment. -
FIG. 2 : Comparison of immunoreactivities in patients suffering from dry AMD and wet AMD compared to CTRL. All immunoreactivities. -
FIG. 3 : Comparison of immunoreactivities in patients suffering from dry AMD and wet AMD compared to CTRL. 20 most significant reactivities. -
FIG. 4 : Comparison of immunoreactivities in patients suffering from wet AMD. The patients were divided into those showing vision loss (−1), no change in vision (0), or improvement of vision (1). All immunoreactivities. -
FIG. 5 : Comparison of immunoreactivities in patients suffering from wet AMD. The patients were divided into those showing vision loss (−1), no change in vision (0), or improvement of vision (1). 20 most significant reactivities. -
FIG. 6 : The results of the data mining procedures (C&RT and artificial neural networks) were used as input for this analysis. A survival analysis (Kaplan-Meier analysis, Cumulative proportion surviving) was performed to assess how strongly the classification of the data mining procedures influence the survival time (time to vision loss) in this 12 months study. - Good results can be achieved for many patients suffering from wet AMD when treated with the approved VEGF antagonists (ranibizumab, aflibercept), meaning either a gain of vision or at least stability of the visual acuity. However, there exists still a certain percentage of patients which do not respond to those approved therapies. These patients suffer from further vision loss and are so called non-responders.
- A patient can be considered a responder if treatment with a VEGF antagonist is useful and effective, as regards not only improvement but also stability, meaning a visual acuity (VA) loss of fewer than 15 ETDRS letters (ETDRS stands for Early Treatment Diabetic Retinopathy Study) after three successive follow-up visits (the follow-up visits start after three anti-VEGF injections). A patient can be considered as responder who gains visual acuity and maintains the gain over time. Patients who gain visual acuity but do not maintain the gain, losing visual acuity to not lower than at baseline are also considered responders. Responders are also considered as patients who gain visual acuity but do not maintain the gain, losing visual acuity to less than 15 ETDRS letters lower than at baseline. Patients who do not gain visual acuity but remain stable, with visual acuity loss not lower than at baseline are also considered as responders. Patients who do not gain visual acuity but whose visual acuity loss does not exceed 15 ETDRS letters compared to a baseline are also considered as responders.
- A patient can be considered a non-responder if treatment with a VEGF antagonist gives no overall clinical benefit, assessed on the basis of morphological and functional parameters, and there is immediate or late visual loss. Non-responders are patients who lose more than 15 ETDRS letters in total in three successive follow-up visits (the follow-up visits start after three anti-VEGF injections). Non-responders are also considered as patients who lose more than 30 ETDRS letters compared with baseline and or best visual acuity recorded at baseline. Non-responders are also defined as patients whose best corrected visual acuity (BCVA) had worsened in the log MAR score. Besides the functional definitions, non-responders are also determined by fundus findings including OCT (optical coherence tomography). A non-responder is also defined as a patient in whom exudative fundus findings (pigment epithelial detachment, subretinal fluid, macular oedema, haemorrhage) had increased or had appeared after treatment, or in whom the central retinal thickness (CTR) increased by more than 100 μm within 12 months after the initial anti-VEGF injection.
- It is known that two third of serum immunoglobulins in healthy individuals are natural occurring autoantibodies. The autoantibody patterns of patients suffering from wet and/or suffering from dry AMD and the autoantibody patterns of patients suffering from wet AMD receiving VEGF antagonist therapy were analysed.
- It was surprisingly found that the amount of autoantibodies directed against antibodies of Group A comprising MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1 and SELO, SOD, ENO2 is significantly different in the serum of patients suffering from either dry or wet AMD in comparison to healthy patients. The quantity of one or several autoantibodies selected from autoantibodies directed against MAPK3, OGFR, PolyRp2,Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1 and SELO, SOD, ENO2 in the patient serum can therefore be used as a means to determine if a patient suffering from dry or wet AMD will respond to a VEGF antagonist therapy, before the VEGF antagonist therapy is initiated. - It was also found that in wet AMD patients with vision gain after ranibizumab therapy the serum level of antibodies directed against OGFR, Gamma-synuclein, Pre-Albumin and PRG2 were significantly increased, whereas in patients who showed a vision loss after ranibizumab therapy the level of said antibodies was significantly decreased.
- Furthermore, e.g. immunoreactivities against PolyRp2, GNB1-A3, and TUBB3 are down-regulated in patients improving vision during 12 months under lucentis treatment and upregulated in those who do not.
- The detectable amount of autoantibodies in the serum of a patient suffering from wet AMD changes over time. A positive correlation between an optimal dosing regimen and the level of autoantibodies could have been identified. The quantity of one or several autoantibodies selected from the Group A of autoantibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1 and SELO, SOD, ENO2 is therefore also a predictive marker when the VEGF antagonist needs to be applied to the patient. - Surprisingly it was also found, that autoantibody patterns are able to differentiate between patients suffering from wet or dry AMD. In particular, changes in the autoantibody levels of one or several autoantibodies selected from autoantibodies of Group B of autoantibodies directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4.
- Furthermore, it was found that changes in the autoantibody levels of one or several autoantibodies selected from autoantibodies of Group A or of Group B as defined above directed have a prognostic value to indicate the conversion of the dry AMD form to the wet AMD form.
- VEGF is a well-characterised signal protein which stimulates angiogenesis. A “VEGF antagonist” refers to a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing or interfering with VEGF activities including its binding to one or more VEGF receptors. The VEGF antagonist may be administered intravitreally, e.g. through injection, or topically, e.g. in form of eye drops. VEGF antagonists include anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors, anti-VEGF receptor antibodies and VEGF receptor antagonists such as small molecule inhibitors of the VEGFR tyrosine kinases, and fusions proteins. The invention also provides non-antibody VEGF antagonists.
- a) Antibody VEGF Antagonists
- In one embodiment, the VEGF antagonist is an antibody. In one embodiment, the VEGF antagonist is a mimetic of the VEGF receptor. In one embodiment, the VEGF antagonist is ranibizumab. In one embodiment, the VEGF antagonist is bevacizumab.
- b) Non-Antibody VEGF Antagonists
- In one embodiment, the VEGF antagonist is a non-antibody VEGF antagonist. In one aspect of the invention, the non-antibody VEGF antagonist is an immunoadhesin. One such immuoadhesin is aflibercept (Eylea®), which has recently been approved for human use and is also known as VEGF-trap (Holash et al., PNAS USA, 2002; Riely & Miller, Clinical Cancer Research, 2007). Aflibercept is the preferred non-antibody VEGF antagonist for use with the invention. Aflibercept is a recombinant human soluble VEGF receptor fusion protein consisting of portions of
human VEGF receptors 1 and 2 extracellular domains fused to the Fc portion of human IgG1. It is a dimeric glycoprotein with a protein molecular weight of 97 kilodaltons (kDa) and contains glycosylation, constituting an additional 15% of the total molecular mass, resulting in a total molecular weight of 115 kDa. It is conveniently produced as a glycoprotein by expression in recombinant CHO K1 cells. Each monomer can have the following amino acid sequence (SEQ ID NO: 1): -
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFP LDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKT NYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGID FNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQ GLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG
and disulfide bridges can be formed between residues 30-79, 124-185, 246-306 and 352-410 within each monomer, and between residues 211-211 and 214-214 between the monomers. - Another non-antibody VEGF antagonist immunoadhesin currently in pre-clinical development is a recombinant human soluble VEGF receptor fusion protein similar to VEGF-trap containing extracellular ligand-binding
domains 3 and 4 from VEGFR2/KDR, and domain 2 from VEGFR1/n Flt-1; these domains are fused to a human IgG Fc protein fragment (Li et al., Molecular Vision, 2011). This antagonist binds to isoforms VEGF-A, VEGF-B and VEGF-C. The molecule is prepared using two different production processes resulting in different glycosylation patterns on the final proteins. The two glycoforms are referred to as KH902 (conbercept) and KH906. The fusion protein can have the following amino acid sequence (SEQ ID NO:2): -
MVSYWDTGVLLCALLSCLLLTGSSSGGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIIS NATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGI ELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKT QSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRV HEKPFVAFGSGMESLVEATVGERVRLPAKYLGYPPPEIKWYKNGI PLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVS LVVYVPPGPGDKTHTCPLCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKATPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK
and, like VEGF-trap, can be present as a dimer. This fusion protein and related molecules are further characterized in EP1767546. - Other non-antibody VEGF antagonists include antibody mimetics (e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, Kunitz domain peptides, and monobodies) with VEGF antagonist activity. This includes recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2. One example for such a molecule is DARPin® MP0112. The ankyrin binding domain may have the following amino acid sequence (SEQ ID NO: 3):
-
GSDLGKKLLEAARAGQDDEVRILMANGADVNTADSTGWTPLHLAV PWGHLEIVEVLLKYGADVNAKDFQGWTPLHLAAAIGHQEIVEVLL KNGADVNAQDKFGKTAFDISIDNGNEDLAEILQKAA - Recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2 are described in more detail in WO2010/060748 and WO2011/135067.
- Further specific antibody mimetics with VEGF antagonist activity are the 40 kD pegylated anticalin PRS-050 and the monobody angiocept (CT-322).
- The non-antibody VEGF antagonist may be modified to further improve its pharmacokinetic properties or bioavailability. For example, a non-antibody VEGF antagonist may be chemically modified (e.g., pegylated) to extend its in vivo half-life. Alternatively or in addition, it may be modified by glycosylation or the addition of further glycosylation sites not present in the protein sequence of the natural protein from which the VEGF antagonist was derived.
- Variants of the above-specified VEGF antagonists that have improved characteristics for the desired application may be produced by the addition or deletion of amino acids. Ordinarily, these amino acid sequence variants will have an amino acid sequence having at least 60% amino acid sequence identity with the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%, including for example, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100%. Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as BLAST or FASTA, two polypeptides are aligned for optimal matching of their respective amino acids (either along the full length of one or both sequences or along a pre-determined portion of one or both sequences). The programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 [a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 (1978)] can be used in conjunction with the computer program. For example, the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the longer sequences in order to align the two sequences.
- The autoantibody pattern, the presence or lack of a certain quantity of an antibody in a sample from an individual having AMD can individually, or in combination, serve as biomarkers to predict responsiveness of that individual to treatment with a VEGF antagonist. The presence of these biomarkers can be determined in a sample from an individual of interest. The sample can be any sample including but is not limited to a fluid sample such as blood, serum, tears, saliva, urine, a cell sample such as buccal cells, aqueous humor or vitreous body of the eye.
- As used herein, “predicting” indicates that the methods described herein provide information to enable a health care provider to determine the likelihood that an individual having wet AMD will respond to VEGF antagonist treatment (anti-VEGF therapy). Following a positive determination of the relevant biomarker(s) in a sample of interest, the individual will be administered a VEGF antagonist.
- To determine the levels of autoantibodies any known method in the art can be used. Methods to quantify the autoantibody contents include but are not limited to standard immunological analytical techniques such as Western blot or immunoblot assays, enzyme-linked immunoabsorbent assays (ELISA), radioimmunoassays, real-time PCR, microarrays, lateral flow, microfluidic assays, bead based assays, nontargeted proteomics involving e.g. massanalyzers such as ion-trap detection, fourier transformion cyclotron resonance, time-of-flight (TOF) mass spectrometry, targeted proteomics involving e.g. the use of selected reaction monitoring (SRM) with triple quadrupole mass spectrometry (TQMS), immunoaffinity mass spectrometry, surface enhanced laser desorption/ionization in time of flight mass spectrometry (SELDI-TOF-MS), matrix assisted laser desorption/ionization mass spectrometry (MALDI) or other antibody chip techniques.
- The invention is not limited by the types of methods used to determine the quantities of autoantibodies.
- Using the methods of the invention an individual is classified as a VEGF antagonist responder if the amounts of one or several of Group A autoantibodies selected from antibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1, SELO, SOD, ENO2 are increased or decreased by at least 10%, by 20%, by 30%, by 40%, by 50%, by 100%, by 150%, by 200%, by 250%, preferably by 25%-150%, more preferably by 50-100%, in the sample compared to a control (healthy individual). - Using the methods of the invention an individual having dry AMD is classified as having a risk that the dry AMD converts into wet AMD if the amounts of one or several autoantibodies selected from antibodies of Group A antibodies comprising antibodies directed against: MAPK3, OGFR, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP 60, ICA1, SELO, SOD, ENO2 or if the amounts of one or several autoantibodies selected from antibodies of Group B antibodies comprising antibodies directed against: alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome17, Aconitate Hydratase, GPX4 detected and quantified in two samples taken in a time period of about 2 weeks, of about 1 month, of about 2 months, of about 6 months, of about 12 months, of at least about 12 months, decrease by at least 20%, by 30%, by 40%, by 50%, by 60%, by 75%, preferably by at least 30%, more preferably by at least 50%, in the sample compared to a control (healthy individual).
- The methods described herein can be utilized as a diagnostic assay to identify those subjects having wet AMD who are likely to respond to a VEGF antagonist. The methods of the invention can be used to determine whether a subject should be administered a VEGF antagonist to reduce the severity of wet AMD. The methods described herein can also be utilized as a prognostic assay to identify those subjects having dry AMD who are at risk to develop wet AMD and who would benefit from receiving a VEGF antagonist. Prognostic assays can be used for predictive purposes or prophylactic purposes to treat an individual who is at risk to develop wet AMD.
- The invention also encompasses kits for determining the level of one or several autoantibodies directed against MAPK3, OGFR, PolyRp2,
Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3,HSP 60, ICA1 and SELO, SOD, ENO2. - I. Comparison of Immunoreactivities in Dry and Wet AMD
- The autoantibody patterns against retinal antigens in sera of patients with “wet” AMD were analyzed and compared to healthy control subjects and patients with “dry” AMD by mass spectrometry (MS) approach. It is known that two third of serum immunoglobulins in healthy individuals are natural occurring autoantibodies, so that complex profiles exist even in healthy people and disease specific changes of circulating autoantibodies are known from several other diseases, e.g. glaucoma or Sicca syndrome. After successful de novo screening of immunoreactivities using MS-based approach and high density Protagen antigen microarrays, a customized antigen microarray containing 61 antigens was built (Table 2). Each microarray contained each antigen as triplicate. Patients were included in the study based on the protocol following all inclusion- and exclusion criteria.
-
TABLE 1 Breakdown Table of Descriptive Statistics. CTRL = healthy volunteers, 17 = dry AMD, 18 = wet AMD starting new anti-VEGF treatment, 19 = wet AMD continuous anti-VEGF treatment Gender Age - Number of Age - Group (m/f) Means subjects Std. Dev. CTRL f 71.8 9 9.4 CTRL m 74.5 11 11.0 17 f 80.9 14 8.5 17 m 73.2 6 7.2 18 f 81.0 120 7.9 18 m 81.4 60 5.1 19 f 82.8 64 6.9 19 m 78.4 45 5.1 All 80.4 329 7.5 Groups - Analysis of immunoreactivities of IgG against these 61 antigens was performed in 329 samples. For all samples, complex patterns of immunoreactivities could be found.
-
TABLE 2 List of antigens on customized microarray UniProt MW Abbreviation ID kDa Protein name UniProt Protein name in Study P62937 18.0 Peptidyl-prolyl cis-trans Cyclophilin A human Cyclophilin B isomerase A (Cyclophilin A) P61604 10.9 10 kDa heat shock Chaperonin 10, HSP 10 protein, mitochondrial Recombinant, (Hsp10) Human P00441 15.9 Superoxide dismutase Superoxide Dismutase SOD [Cu—Zn] from bovine erythrocytes P02686 33.1 Myelin basic protein Myelin Basic Protein MBP (MBP); Isoform 1 from bovine brain P04792 22.8 Heat shock protein Hsp27 Protein - Low HSP 27 beta-1 (Heat shock 27 Endotoxin kDa protein; Hsp27) P08107 70.1 Heat shock 70 kDa Heat Shock Protein 70 HSP 70 protein 1A/1B from bovine brain (Hsp70.1/Hsp70.2) P02751 262.6 Fibronectin; Isoform 1 Fibronectin from human Fibronektin plasma P01009 46.7 Alpha-1-antitrypsin α1-Antitrypsin from Alpha-1- human plasma Antitrypsin P08758 35.9 Annexin A5 Annexin V from human Annexin V placenta Q14694 87.1 Ubiquitin carboxyl-terminal Ubiquitin human Ubiquitin hydrolase 10 (USP10) P49773 13.8 Histidine triad nucleotide- Protein Kinase C PKC Inhibitor binding protein 1 Inhibitor, Myristoylated (Protein kinase C inhibitor 1) P02766 15.9 Transthyretin Prealbumin from human PreAlbumin (Prealbumin) plasma O76070 13.3 Gamma-synuclein γ-Synuclein human Gamma- synuclein P14136 49.9 Glial fibrillary acidic Anti-Glial Fibrillary GFAP protein (GFAP) Acidic Protein P27797 48.1 Calreticulin Calreticulin from bovine Calretikulin liver P02549 280.0 Spectrin alpha chain, Spectrin from human Spektrin erythrocyte erythrocytes P12081 57.4 Histidine-tRNA ligase, JO-1 human Jo-1 cytoplasmic (JO-1) P10809 61.1 60 kDa heat shock HSP60 (human), HSP 60 protein, mitochondrial (recombinant) (Hsp60) P53674 28.0 Beta-crystallin B1 βL-Crystallin from Beta-L- bovine eye lens Chrystalin P09211 23.4 Glutathione Glutathione S-Transferase GST S-transferase P from bovine liver P68133 42.1 Actin, alpha skeletal Actin from bovine muscle Actin muscle P15104 42.1 Glutamine synthetase Glutamine synthetase GLUL Q99798 83.4 Aconitase 2, aconitase 2, ACO2 mitochondrial mitochondrial E5RFU4 18.3 Dihydropyrimidinase- Dihydropyrimidinase- DBYSL2 like2 like 2 P09936 24.8 Ubiquitin carboxyl-terminal Ubiquitin carboxyl-terminal VCHC1 hydrolase isozyme L1 (UCHL1) hydrolase isozyme L1 P30086 21.1 Phosphatidylethanolamine- Phosphatidylethanola- PBP binding protein 1 mine-binding protein 1 P00918 29.2 Carbonic anhydrase 2 Carbonic Anhydrase II CAZ P12277 42.6 Creatine kinase B-type Creatine kinase B CKB P62873 37.4 Guanine nucleotide- Guanine nucleotide-binding GNB1 binding protein protein G(I)/G(S)/G(T) subunit G(1)/G(S)/G(T) subunit beta-1 (GNB1) beta 1 P06733 47.2 Alpha-enolase Alpha-Enolase ENO1 P04406 36.1 Glyceraldehyde-3- Glyceraldeyde (3-)phosphate GAPDH phosphate dehydrogenase dehydrogenase (GAPDH) P60842 46.2 Eukaryotic initiation Homo sapiens eukaryotic EIFA1 factor 4A-I translation initiation factor 4A isoform 1 (EIF4A1) mRNA A8K318 59.2 Protein kinase C protein kinase C PKC80 substrate 80K-H substrate 80K-H isoform 2 [Homo sapiens] Q68Y55 34.9 Poly(RC) binding poly(rC) binding protein PolyRp2 protein 2 2 isoform g [Homo sapiens] P49761 58.6 CDC-like kinase 3 Homo sapiens CDC-like CLK3 (CLK3), transcript kinase 3 (CLK3); variant phclk3, mRNA transcript variant phclk3; mRNA Q9P2Z0 28.4 THAP domain-containing THAP domain containing 10 THAP protein 10 [Homo sapiens] Q9BXS5 48.6 AP-1 complex subunit Homo sapiens adaptor- AP1M1 mu-1 (AP1M1) related protein complex 1; mu 1 subunit (AP1M1); mRNA P63330 35.6 Serine/threonine- protein phosphatase type pp2A protein phosphatase 2A 2A catalytic subunit catalytic subunit alpha alpha isoform isoform [Mus musculus] Q9NZT2 73.3 Opioid growth factor Homo sapiens opioid OGFR receptor growth factor receptor (OGFR). mRNA Homo sapiens plasticity- PRG2 related gene 2 (PRG2) mRNA P43235 37.0 Cathepsin K cathepsin K preproprotein Catepsin [Homo sapiens] Q53G92 50.4 Tubulin beta-3 chain Homo sapiens tubulin TUBB3 beta 3 (TUBB3) mRNA P37108 14.6 Signal recognition Homo sapiens signal SRP14 particle 14 kDa recognition particle protein 14 kDa (homologous Alu RNA binding protein) (SRP14) mRNA Q7Z6Z7 481.9 E3 ubiquitin-protein HUWE1 protein [Homo HUWE1 ligase HUWE1; sapiens] Isoform 1 Homo sapiens Chromo- chromosome X genomic contig, somX reference assembly Q96S16 36.9 JmjC domain-containing jumonji domain containing jumonji protein 8 (Jumonji 8 [Homo sapiens] domain-containing protein 8) Q96N21 55.1 Uncharacterized protein Homo sapiens Chromosome C17orf56 chromosome 17 open reading 17 frame 56 (C17orf56). mRNA Q96HG3 54.6 Islet cell autoantigen 1,Homo sapiens islet cell ICA1 69 kDa autoantigen 1. 69 kDa (ICA1). transcript variant 2. mRNA P10768 31.5 S-formylglutathione Homo sapiens esterase ESD hydrolase (Esterase D) D/formylglutathione hydrolase (ESD) P25325 33.2 3-mercaptopyruvate mercaptopyruvate MSI 2 sulfurtransferase sulfurtransferase isoform 2 [Homo sapiens] P27361 43.1 Mitogen-activated Homo sapiens mitogen- MAPK3 protein kinase 3; activated protein kinase 3Isoform 1 (MAPK3); transcript variant 1; mRNA P43304 80.9 Glycerol-3-phosphate Homo sapiens glycerol- GPD2 dehydrogenase, 3-phosphate d ehydrogenase mitochondrial (GPD2); 2 (mitochondrial) Isoform 1 (GPD2); mRNA P36969 22.2 Phospholipid Homo sapiens glutathione GPX4 hydroperoxide peroxidase 4 (phospholipid glutathione hydroperoxidase) peroxidase, (GPX4); transcript mitochondrial variant 1. mRNA B7Z4U7 65.1 Sec1 family domain vesicle transport-related VTI-B containing 1, isoform protein isoform b CRA_b [Homo sapiens] Q9BVL4 73.5 Selenoprotein O Homo sapiens SELO selenoprotein O (SELO) mRNA Q6PJ21 39.4 SPRY domain-contain- SPRY domain-containing SPRX ing SOCS box protein 3SOCS box protein SSB-3 P35611 81.0 Alpha-adducin adducin 1 (alpha) Adduccin isoform c [Homo sapiens] Q99798 85.4 Aconitate hydratase, Aconitate Hydratase 2 Aconitate mitochondrial (mitochondrial) Hydratase P06576 56.6 ATP synthase subunit ATP synthase ATP Synthase beta, mitochondrial P40926 35.5 Malate dehydrogenase, Malat dehydrogenase Malat mitochondrial Dehydrogenase P37840 14.5 Alpha-synuclein alpha-synuclein Alpha Synuclein P10636 78.9 Microtubule-associated tau TAU protein tau P05067 86.9 Amyloid beta A4 protein beta-amyloid Beta-Amyloid (Alzheimer disease amyloid protein) Q05923 34.4 Dual specificity protein DUSP2 dual specificity DUSP2 phosphatase 2 phosphatase 2 [Homo sapiens] Q14166 74.4 Tubulin-tyrosine ligase- Homo sapiens tubulin TTLL2 like protein 12tyrosine ligase-like family member 12 (TTLL12) mRNA P09104 47.3 Gamma-enolase Gamma-enolase ENO2 P00441 15.9 Superoxide dismutase Superoxide dismutase SOD [Cu—Zn] - The immunoreactivities were analyzed in patients suffering from dry AMD, wet AMD, and compared to healthy controls. Table 3 shows the results of ANOVA analysis and their corresponding p-values for the most-significant antigens.
- The immunoreactivities of dry and wet AMD patients are highly significantly different from each other and from controls. Although as part of natural autoimmunity also in healthy subjects complex antibody patterns against the tested antigens could be shown, the patterns in both AMD groups are changed. One of the most prominently changed reactivity is against alpha-synuclein. Alpha-synuclein is known from other neurodegenerative diseases. Others are heat shock proteins (e.g. HSP 10) and also Annexin V, which plays a major role in apoptotic processes. Some others are antithetic regulated in wet and dry-AMD such as VTI-B, PBP-12, and OGFR. Pathway comparison analysis revealed protein functions particularly found in immunological diseases, especially aconitase 2, which plays a role in citric acid cycle,
further enolase 1, Annexin V, mitogen-activated protein kinase C (MAPK3) and Alpha-Synuclein. Mutations in Alpha-synuclein e.g. are associated with Parkinson's disease, Alzheimer's disease, and several other neurodegenerative illnesses. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Apart from the immunological markers, bio functions playing a major role in inflammation could be observed, like e.g. Alpha-synuclein, aconitase 2,enolase 1 and GADPH (glyceraldehydephosphate dehydrogenase), which acts in apoptotic processes and is also known to play a role in Alzheimer's disease. Annexin V is proposed to have anti-apoptotic and anti-inflammatory functions, comparison of immunoreactivities in our study revealed higher reactivity in the dry AMD-group. It could clearly be demonstrated that there are huge differences in the immunoreactivities in both wet and dry AMD groups. -
TABLE 3 ANOVA (Analysis of Variance) of the IgG immunoreactivities in patients with wet AMD, dry AMD, and compared to controls. The table reveals the most significant antigens and according p-values. CTR CTR AMDD AMDD AMDW AMDW ANOVA - L- AV L- SE RY- AV RY- SE ET- AV ET- SE P Alpha 6428 487 10667 1974 7221 251 0.003 Synuclein SELO 31155 1755 27412 1733 26330 397 0.01 SPRY 24905 1445 21287 808 22305 265 0.028 GAPDH - H2 11571 821 13277 1137 14926 360 0.031 Annexin V 14977 1821 18675 1422 15258 321 0.034 THAP 14422 1575 10767 715 11889 284 0.044 VTI-B 22121 1816 19333 1493 23773 512 0.065 HSP 1016099 1313 20613 1716 19235 385 0.071 ESD 29416 1393 24942 995 26008 424 0.082 PKC80 23592 1798 21236 1396 20575 335 0.082 ACO2 - C2 19238 1478 17569 1462 16185 376 0.089 OGFR 18774 2383 21865 3017 17521 516 0.115 PBP - I2 21243 1455 24279 1422 24944 467 0.119 CAZ - C3 5373 595 7534 1274 6402 196 0.148 EIFA1 26612 2773 21695 2045 21915 612 0.15 MAPK3 28505 1571 25186 1110 27123 315 0.15 ENO1 - H7 19297 1419 25493 2798 22685 594 0.15 Chromosome 1720439 1587 18881 1513 21993 455 0.16 Aconitate 20584 1720 18805 1622 17738 391 0.163 Hydratase GPX4 19207 1159 17929 1277 17190 283 0.177 (AV = average; SE = standard error; p = p-value) - II. Longitudinal Analysis of IgG Immunoreactivities in Wet AMD
- To answer the question if the injection of Lucentis which is basically a foreign protein to the body, is able to provoke a significant immune reaction, a longitudinal analysis of IgG immunoreactivities was performed.
FIG. 1 shows the IgG pattern analysis in wet AMD patients. The samples were taken before, and 2, 3, 4, 6, and 12 months after starting lucentis treatment. Table 4 reveals the most significant antibody reactivities changing after starting treatment with lucentis. Overall, no clear increase in immunoreactivities could be observed after the lucentis treatment. Most significant change is shown for MAPK3. No single antigen revealed significant changes in univariate ANOVA. However, the Mahalanobis distances could reveal several significant differences in multivariate analysis taken the complete antibody/antigen pattern simultaneously, especially between the later time points. Furthermore, no differentiation between the groups could be detected in multivariate canonical root analysis. -
TABLE 4 Longitudinal analysis over 12 months of IgG immunoreactivities in wet AMD patients, who started with lucentis treatment. Wilks' Lamda: values in the range of 0 (perfect discrimination) to 1 (no discrimination), Partial Lambda: The Wilks' Lambda associated with the unique contribution of the respective variable to the discriminatory power of the model. Wilks' - Partial - Lambda Lambda p-value TAU-n 0.793690 0.946549 0.143135 ACO2 - 0.802293 0.936398 0.084057 C2-n MAPK3-n 0.810685 0.926705 0.049457 ATP synthase-n 0.788763 0.952462 0.192688 GPD2-n 0.784479 0.957663 0.248013 AP1M1-n 0.777703 0.966006 0.364065 - III. Analysis of IgG Immunoreactivities in Wet AMD: Influence of Success of Treatment
- The immunoreactivities in patients suffering from wet AMD depending on success of treatment were compared. Based on visual acuity (log mar) the patients were divided into those showing vision loss during the 12 months treatment by lucentis (−1), no change in vision (0), or improvement of vision (1). Highly significant changes could be observed between those immunoreactivities from patients showing an improvement of vision during lucentis treatment and those who do not.
FIG. 4 andFIG. 5 compare the IgG reactivities and reveal the most significant changes. Furthermore, ANOVA could demonstrate highly significant changes in a large number of antigens (Table 5 and Table 6). Multivariate canonical root analysis could reveal a good differentiation between the groups. -
TABLE 5 ANOVA of Immunoreactivities in wet AMD patients depending on treatment. The patients were divided into those showing vision loss (−1), no change in vision (0), or improvement of vision (1). 0-AV 0- SE 1-AV 1- SE -1-AV -1- SE ANOVA - P Cyclopilin B 33179 949 32345 1463 33452 1221 0.813 HSP 10 19235 579 19821 837 18591 704 0.496 HSP70 7866 341 7942 501 8207 492 0.837 Fibronektin 27083 472 26845 512 26608 656 0.816 Alpha-1- 13139 552 12626 725 12866 675 0.853 Antitrypsin Annexin V 15507 487 15107 620 15243 633 0.879 Ubiquitin 17679 597 17507 504 16529 616 0.332 PKC Inhibitor 12519 587 12385 857 13294 669 0.615 PreAlbumin 15562 873 17430 962 12944 756 0.003 Gamma-synuclein 22228 618 23983 746 20546 600 0.003 GFAP 35195 783 34749 1139 35638 1126 0.839 Calretikulin 32672 877 30756 640 33606 945 0.094 Spektrin 24946 619 24708 670 23095 730 0.107 Jo-1 27542 590 31206 1049 30400 892 0.003 HSP 60 23144 988 27559 1267 23609 1274 0.022 Beta-L-Chrystalin 11728 478 10959 666 11006 605 0.538 GST 16706 684 15214 830 15230 811 0.259 Actin 23996 958 26141 1356 24624 1187 0.421 GLUL - A2 19825 607 20624 546 20164 614 0.66 ACO2 - C2 15714 601 16579 781 16185 675 0.665 DBYSL2 - E2 19515 748 21426 1050 19609 732 0.228 VCHC1 - G2 11973 608 10395 722 12151 678 0.164 PBP - I2 24591 697 26074 1009 23293 718 0.069 CAZ - C3 6615 341 5919 300 6646 378 0.306 CKB - K1 4835 167 4906 267 5269 294 0.375 GNB1 - A3 7772 329 6949 320 8550 456 0.021 ENO1 - H7 19856 753 22785 935 23954 1210 0.005 GAPDH - H2 15272 614 15041 719 14734 597 0.826 EIFA1 25391 1158 19280 745 20476 1000 0 PKC80 20766 484 21545 741 20276 588 0.359 PolyRp2 15683 385 14937 350 18082 549 0 CLK3 28064 571 27181 646 27717 639 0.612 THAP 11395 386 12273 567 12608 586 0.178 AP1M1 10985 346 10519 408 12470 482 0.004 pp2A 24322 591 23963 598 22493 655 0.085 OGFR 16924 804 22120 1178 15111 691 0 PRG2 26929 1146 30959 1337 25169 1230 0.008 Catepsin 24577 707 23876 584 24513 778 0.774 TUBB3 12899 382 12244 415 14315 693 0.021 SRP14 25498 1073 20329 692 21662 1301 0.002 HUWE1 25755 585 23901 645 25528 716 0.119 Chromosom X 11364 483 12210 612 11548 497 0.522 jumonji 18742 344 18098 491 18518 442 0.559 Chromosome 17 20052 584 20932 667 24848 1044 0 ICA1 16622 618 17327 725 19514 1099 0.033 ESD 25863 580 25324 700 26872 978 0.38 MSI 2 26033 684 25447 733 24186 586 0.13 MAPK3 28919 577 23712 375 27368 470 0 GPD2 20415 526 20057 731 23181 852 0.003 GPX4 16304 277 16926 435 18737 728 0.001 VTI-B 23423 828 24339 1089 23596 882 0.777 SELO 27500 632 25618 749 25330 735 0.046 SPRX 22907 463 21735 452 21944 457 0.15 Adduccin 12874 419 13792 797 13348 558 0.522 Aconitate 16576 509 18093 817 17913 746 0.193 Hydratase ATP synthase 27814 440 25813 469 27848 601 0.011 Malat 27349 844 25088 847 26175 984 0.216 Dehydrogenase Alpha Synuclein 7553 398 8008 694 6464 231 0.056 TAU 12493 374 13288 576 13714 663 0.219 Beta-Amyloid 8235 161 8344 246 8042 198 0.576 DUSP2 12211 725 13610 856 12014 721 0.33 TTLL2 16754 1387 19730 1426 16204 1103 0.18 SOD 1361 728 287 892 1460 659 ENO2 9538 13415 9267 16430 27101 12134 (AV = average, SE = standard error, p = p-value) -
TABLE 6 ANOVA of immunoreactivities in wet AMD patients depending on treatment. The patients were divided into those showing vision loss (−1), no change in vision (0), or improvement of vision (1). 0-AV 0- SE 1-AV 1- SE -1-AV -1- SE ANOVA - P MAPK3 28919 577 23712 375 27368 470 6 OGFR 16924 804 22120 1178 15111 691 0 PolyRp2 15683 385 14937 350 18082 549 0 Chromosome 20052 584 20932 667 24848 1044 0 17 EIFA1 25391 1158 19280 745 20476 1000 0 GPX4 16304 277 16926 435 18737 728 0.001 SRP14 25498 1073 20329 692 21662 1301 0.002 Gamma- 22228 618 23983 746 20546 600 0.003 synuclein Jo-1 27542 590 31206 1049 30400 892 0.003 PreAlbumin 15562 873 17430 962 12944 756 0.003 GPD2 20415 526 20057 731 23181 852 0.003 AP1M1 10985 346 10519 408 12470 482 0.004 ENO1 - H7 19856 753 22785 935 23954 1210 0.005 PRG2 26929 1146 30959 1337 25169 1230 0.008 ATP 27814 440 25813 469 27848 601 0.011 synthase GNB1 - A3 7772 329 6949 320 8550 456 0.021 TUBB3 12899 382 12244 415 14315 693 0.021 HSP 6023144 988 27559 1267 23609 1274 0.022 ICA1 16622 618 17327 725 19514 1099 0.033 SELO 27500 632 25618 749 25330 735 0.046 (AV = average, SE = standard error, p = p-value) - Additionally, a general regression model (GRM) was performed to analyze if there is a longitudinal effect on the antibody patterns depending on success of treatment. Several antigens could be detected which show significant longitudinal effects.
- Thus, the immunoreactivities could have predictive value to determine the treatment effect of lucentis in AMD patients. Involved are antigens such as MAPK3, Gamma-synuclein, different heat shock proteins and many others. Several of the immunoreactivities are regulated in opposed directions. E.g. immunoreactivities against OGFR, Gamma-synuclein, pre-albumin, and PRG2 are up-regulated in patients improving vision during 12 months under lucentis therapy and down-regulated in those who do not. Furthermore, e.g. immunoreactivities against PolyRp2, GNB1-A3, and TUBB3 are down-regulated in patients improving vision during 12 months under lucentis treatment and up-regulated in those who do not. Furthermore, e.g. some heat shock proteins show huge difference in IgG immunoreactivities against them.
- Pathway analysis showed that nine proteins were associated with cellular growth and proliferation, namely ATP synthase, eukaryotic translation initiation factor 4A1 (EIFA1),
enolase 1, glutathione peroxidase 4 (GPX4), HSP60, MAPK3, Opioid growth factor receptor (OGFR), Gamma-Synuclein and beta Tubulin (TUBB3). Immunoreactivities against OGFR were up-regulated in patients improving in vision under lucentis therapy, whereas a down-regulation was observed in case of vision loss. - IV. Predictive Value of Immunoreactivities on Success of Treatment
- Based on visual acuity (log mar) the patients were divided into those showing vision loss during the 12 months treatment by lucentis (−1), no change in vision (0), or improvement of vision (1). Highly significant changes could be observed between those immunoreactivities from patients showing an improvement of vision during lucentis treatment and those who do not. If the immunoreactivities might have predictive value on lucentis treatment, data mining models could be useful to distinguish between those patients just based on their antibody patterns.
- C&RT models (general classification/regression tree models) were performed. Furthermore, an artificial neural network was trained to recognize those antibody patterns which are correlated with a successful treatment with lucentis. After training, those patterns could be recognized with a sensitivity and specificity of about 95%. Nevertheless, it is important to consider that the number of patients in this pilot study is small and further validation studies in larger cohorts are needed to address the predictive value in detail. The most discrimination power was attributed to e.g. OGFR, SPR14, pre-albumin etc. which also were important immunoreactivities in the preceding analyses.
- V. Predictive Value of Immunoreactivities on Course of Vision Loss
- The results of the data mining procedures (C&RT and artificial neural networks) were used as input for this analysis. A survival analysis (Kaplan-Meier analysis, Cumulative proportion surviving) was performed to assess how strongly the classification of the data mining procedures influence the survival time (time to vision loss) in this 12 months study.
- The Kaplan-Meier plot demonstrates the huge impact this a priori classification based on their antibody patterns has on the outcome of lucentis treatment over time.
- Whereas those patients classified as good lucentis responder show nearly no vision loss in survival analysis, the other group (bad lucentis responder) reveal strong vision loss.
- VI. Influence of Other Clinical Parameter on Immunoreactivities
- A component of variance analysis was performed to assess the effect of the parameters vision change, retinal hemorrhage, macular edema, and choroidal neovascularization (CNV) on immunoreactivities. There are no very clear singular effects of these clinical parameters on the immunoreactivity levels for each antigen. For all of the antigens, the effect of change in vision, retinal hemorrhage, macular edema, or CNV are very small and not significant. However, the interaction between those (e.g. 1*2*3*4) can have a larger impact on the antibody patterns.
- Mass Spectrometric Analysis
- The analysis of antigen-antibody profiles can be done in a reliable and sensitive manner using a recently developed proteomics technology: protein G Dynabeads combined with a ProteinChip system based on SELDI-TOF (=surface enhanced laser desorption/ionization-time of flight) mass spectrometry (MS) or Maldi-TOF or ESI-MSMS. The magnetic beads are designed to capture immunoglobulins via a cell wall component, binding a wide range of IgG antibodies during incubation with various body fluids, such as sera. During a subsequent incubation with homogenized antigens it is possible to capture relevant antigens by secondary binding to the antibodies. After elution antigens can be analyzed by SELDI-TOF MS using ProteinChips with different, separating chip surfaces e.g. cationic and anionic exchangers, hydrophobic surfaces and metal-ion affinity-chromatographic surfaces. Resulting mass spectra can be statistically analyzed and compared to gain significantly higher or lower antigen-antibody-reactivity peaks according to the study groups. The identification of potential biomarkers will be done using highly sensitive MALDI-TOF/TOF (=matrix assisted laser desorption/ionization-time of flight) MS.
- Protagen Arrays
- For the analysis of antibody patterns and identification of potential autoantibody biomarker candidates we chose a highly sensitive antigen microarray, which is a promising approach in this field of interest. This method has already been successfully used for the discovery of autoantibodies targeting prostate cancer specific biomarkers and to screen sera of patients with, e.g. different pathological subtypes of multiple sclerosis or autoimmune hepatitis for autoreactive antibodies. To screen autoantibody reactivities in study sera we used an advanced high density microarray approach. Sera of patients before treatment with lucentis (n=10) were compared with sera of the same patients after treatment with lucentis (n=10). Two pools of ten sera each were created for each group, which were incubated on nitrocellulose-coated slides with 3800 immobilized randomly selected human proteins from the UNIclone® library (UNIchip®, Protagen, Dortmund, Germany) as described below. Incubation and washing steps were performed at 4° C. n on an orbital shaker (Micromix 5, DPC, Los Angeles, Calif., USA). Slides were covered with one-pad FAST-frame hybridization chambers (Whatman, Maidstone, UK) and blocked with PBS containing 0.5% BSA for one hour. Afterwards slides were washed three times ten minutes each time with PBS containing 0.5% Tween 20 (PBS-T). Patients' sera were diluted 1:375 in PBS and incubated on the Protagen-Slides overnight. After three washing steps with PBS-T, each time for ten minutes, slides were treated with fluorescence labeled secondary antibody (1:500 diluted in PBS, goat anti-human IgG, Jackson ImmunoResearch Laboratories, West Grove, USA) for one hour in the dark. After three final washing steps, two with PBS-T and one with HPLC-grade ultra pure Water (ten minutes each time) slides were dried under vacuum. By using a high sensitive laser microarray scanner 16-bit TIFF (Tagged Information File Format) were generated. Spot intensities were quantified with ImaGene Software (ImaGene 5.5, Biodiscovery, CA, USA). After data normalization to internal standards with algorithm provided by Protagen, group differences were calculated and compared. For visualization of the resultant antigen-antibody complexes, slides were treated with a secondary fluorescence labeled antibody (Dylight 650) followed by confocal laser scanning. After data normalization spot intensities were compared and group differences were analyzed.
- Analysis
- Blood samples will be centrifuged at 1000 g for ten minutes and the supernatant will be stored at −80° C. for subsequent analysis. Magnetic protein G beads (Dynal, Oslo, Norway) will be incubated with the patient's sera. After several washings steps the patient's antibodies will be covalently bound to the beads using ethanolamine. The bead-antibody complexes will be incubated with homogenized retinal antigens. The antigens bound to the patient's autoantibodies will be eluted, concentrated, and analyzed by SELDI time-of-flight (TOF) MS ProteinChips with two different chromatographic surfaces (CM10 cation exchange and H50 reversed phase). The samples will be measured with a SELDI-TOF MS ProteinChip system (Biorad, Hercules) on a PBS-IIc ProteinChip Reader. Raw data will be transferred to CiphergenExpress 2.1 database software (Biorad, Hercules) for workup and analysis. A recently developed Proteomics Software Project (PSP) will statistically evaluate the spectra using different statistical approaches (trained neuronal networks, tree algorithms and multivariate statistics) to guarantee a high specificity and sensitivity of antibody patterns for the observed study groups. The PSP will additionally search for highly significant biomarkers directing a Statistical based analysis using above mentioned algorithms. The identification of biomarkers will be done by MALDI-TOF/TOF MS analysis. We aim to generate at least eight highly specific biomarkers (significance level α=0.05 and power (1-ß)=90%) for “wet” AMD.
- Statistical calculations of sample sizes were conducted in close cooperation with the Institute of Medical Biometry, Epidemiology and Informatics (IMBEI) at the University in Mainz and are also based on experiences from previous studies: the calculated number of cases (25) is sufficient to detect an effect on the serum antibody profiles, given a significance level α=0.05 and power (1-ß)=90%. The statistical analysis will demonstrate if the antibody composition against retinal antigens within sera changes. A comparison to the control group will show if the modifications are beneficial, i.e. the serum compositions become more similar to the serum of healthy subjects, or not. A subsequent biomarker identification using MALDI-TOF/TOF MS (Bruker) may reveal valuable hints on the systemic effects.
- After electrophoretic separation, proteins will be tryptically digested, crystallized on matrix, and analyzed on a MALDI target. The obtained peptide mass fingerprint data, will be exported into BioTools and used for an internal Mascot database search (SwissProt and NCBI), leading to protein identifications.
- Antigen Microarrays
- In this study, we used highly purified proteins, purchased at Sigma-Aldrich (Germany) and BioMol (Hamburg, Germany), as antigens. The antigen selection is based on previous autoantigen identifications in glaucoma patients by our group and survey of literature related to identifications of autoantigens in autoimmune diseases. Antigens were diluted to 1 μg/μl with PBS buffer optionally containing 1.5% Trehalose for optimal printing conditions. The spotting of antigens was performed with both a non-contact printing technology (sciFLEXARRAYER S3, Scienion, Berlin, Germany), based on piezo dispensing, and the commonly used pin based contact printing technique (OmniGrid100, Digilab Genomic Solutions, Ann Arbor, USA). Results were comparatively evaluated for spot morphology and spot to spot variability. For printing of the whole set of study microarrays the piezo based spotting technique was used. Each antigen was spotted in triplicate onto nitrocellulose-slides (Oncyte, nitrocellulose 16 multi-pad slides, Grace Bio-Labs, Bend, USA). As a positive and negative control we used mouse anti human IgG/A/M or human IgG (10 μg/μl) and spotting buffer. The spotting process was performed at RT and a humidity of 30%. Approximately 1 nl of each antigen-dilution was applied onto the nitrocellulose surface by spotting three times 330 μl on exactly the same position. The accurateness of the spotting volume and the correct positioning of the droplets were monitored prior and after the spotting process of each antigen using the sciDrop-VOLUME and autodrop-detection software (Scienion, Berlin, Germany).
- Incubation and washing steps were performed at 4° C. on an orbital shaker (Titramax 100, Heidolph, Schwabach, Germany). Slides were covered with 16-pad FAST frame hybridization chambers (Whatmann, Maidstone, UK) and blocked with PBS containing 4% BSA or the Super G blocking buffer (Grace Biolabs) for one hour. Afterwards slides were washed three times with PBS containing 0.5% Tween (PBS-T). Patient sera were diluted 1:250 in PBS and aqueous humor in a ratio of 1:10 in PBS. 100-120 μl of these dilutions were randomly incubated on prepared antigen-slides overnight. After several washing steps with PBS-T, slides were incubated with a fluorescent Cy-5 labeled secondary antibody (1:500 diluted in PBS-T, goat anti-human IgG, Jackson ImmunoResearch Laboratories, West Grove, USA) for one hour in the dark. Two washing steps with PBS-T were followed by two final washing steps with HPLC-grade water. All microarrays were air dried before scanning, using a microarray scanner (Affymetrix 428™ Array Scanner, High Wycombe, UK). Generated 16-bit TIFF images (Tagged Information File Format) of slides were analyzed using the Spotfinder 3.1.1 software (TM4, Dana-Faber Cancer Institute, Boston, USA) or ImaGene5 software. Background substraction was performed according to the formula: spot intensity=mean intensity SP−((sumbkg−sumtop5 bkg)/(number of pixelSP−number of pixelstop5 bkg)) where SP represents any spot, bkg the corresponding background and top5 bkg the top five percent of background pixel. The coefficient of variance (CV) was calculated as follows: CV=SDSP3/meanSPX . . . SPn, where SDSP3 represents the standard deviation across three replicate spots of one antigen of one sample, and meanSPX . . . SPn the mean of all spot intensities.
- An artificial neural network was performed prior to the analysis in a study cohort as described above. The autoantibody reactivities were analysed as described above.
- These intensity values of antibody reactivities have been normalized and a calculation of the percentage difference of intensity values to reference values was calculated.
- Based on the algorithm from the artificial neural network, an individual scoring was performed for a single patient, which has not been included prior to this analysis in the training (calculation) of the artificial neural network.
- The different autoimmune reactivates were analysed for patient #22928 (from the study) in 1 μl of sera and used as input to the data mining algorithm trained prior to the study.
- For this individual patient, the confidence levels was calculated as 0.0087 (−1: vision loss); 0,156 (0: no vision change) and 0,835 (1: vision gain). Thus, based on autoreactivity, the patient will respond to the anti-VEGF treatment with highest probability.
- While there are shown and described presently preferred embodiments of the invention, it is to be distinctly understood that the invention is not limited thereto but may be otherwise variously embodied and practiced within the scope of the following claims.
Claims (5)
1-15. (canceled)
16. A method of determining whether an individual suffers from dry AMD and/or wet AMD, the method comprising:
(i) obtaining a sample from the individual
(ii) determining the quantity of at least one antibody selected from Group B antibodies directed against OGFR, alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome 17, Aconitate Hydratase, and GPX4; and
(iii) identifying the individual as suffering from dry AMD and/or wet AMD disease if the amount of the at least one antibody selected from Group B antibodies is increased by at least 20% or decreased by at least 20% compared to control values.
17. The method according to claim 16 , wherein the at least one antibody is selected from a subgroup B-1 of the Group B antibodies directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, and HSP10.
18. A method to determine that an individual with dry AMD is at risk of developing wet AMD, the method comprising:
(i) obtaining a sample from the individual with dry AMD;
(ii) determining the quantity of at least one antibody selected from autoantibodies which are members of Group A and/or Group B,
wherein Group A antibodies are directed against OGFR, MAPK3, PolyRp2, Chromosome 17, EIFA1, GPX4, SRP14, Gamma-synuclein, Jo-1, Pre-Albumin, GPD2, AP1M1, ENO1-H7, PRG2, ATP synthase, GNB1-A3, TUBB3, HSP60, ICA1, SELO, SOD, and ENO2, and
wherein Group B antibodies are directed against alpha-synuclein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, HSP10, ESD, PKC80, ACO2-C2, OGFR, PBP-I2, CAZ-C3, EIFA1, MAPK3, ENO1-H7, Chromosome 17, Aconitate Hydratase, and GPX4; and
(iii) identifying the individual as being at risk of developing wet AMD if the amount of the at least one antibody is increased by at least 20% or decreased by at least 20% compared to control values.
19. The method according to claim 18 , wherein the at least one antibody is selected from a subgroup A-1 of the Group A antibodies and/or a subgroup B-1 of the Group B antibodies,
wherein antibodies of subgroup A-1 are directed against OGFR, MAPK3, SRP14, ENO2, SOD, Pre-Albumin, Jo-1, PolyRp2, Chromosome 17, and EIFA1, and
wherein antibodies of subgroup B-1 are directed against alpha-synculein, SELO, SPRY, GAPDH-H2, Annexin-V, THAP, VTI-B, and HSP10.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/409,066 US20220155295A1 (en) | 2016-02-29 | 2021-08-23 | Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662300952P | 2016-02-29 | 2016-02-29 | |
PCT/EP2017/054579 WO2017148904A1 (en) | 2016-02-29 | 2017-02-28 | Predictive markers useful in the treatment of wet age-related macular degeneration |
US201816080628A | 2018-08-28 | 2018-08-28 | |
US17/409,066 US20220155295A1 (en) | 2016-02-29 | 2021-08-23 | Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2017/054579 Division WO2017148904A1 (en) | 2016-02-29 | 2017-02-28 | Predictive markers useful in the treatment of wet age-related macular degeneration |
US16/080,628 Division US11099185B2 (en) | 2016-02-29 | 2017-02-28 | Predictive markers useful in the treatment of wet age-related macular degeneration |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220155295A1 true US20220155295A1 (en) | 2022-05-19 |
Family
ID=58192281
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/080,628 Active 2037-05-19 US11099185B2 (en) | 2016-02-29 | 2017-02-28 | Predictive markers useful in the treatment of wet age-related macular degeneration |
US17/409,066 Pending US20220155295A1 (en) | 2016-02-29 | 2021-08-23 | Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/080,628 Active 2037-05-19 US11099185B2 (en) | 2016-02-29 | 2017-02-28 | Predictive markers useful in the treatment of wet age-related macular degeneration |
Country Status (4)
Country | Link |
---|---|
US (2) | US11099185B2 (en) |
EP (1) | EP3423835B1 (en) |
CN (2) | CN109073660B (en) |
WO (1) | WO2017148904A1 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111690729A (en) * | 2019-03-12 | 2020-09-22 | 上海市第一人民医院 | Method for diagnosing wet age-related macular degeneration by measuring NPVF protein in peripheral blood |
CN110632306B (en) * | 2019-10-25 | 2021-07-23 | 四川大学华西医院 | Application of ENO2 autoantibody detection reagent in preparation of lung cancer screening kit |
CN115060909A (en) * | 2021-07-01 | 2022-09-16 | 浙江大学 | Detection kit for detecting anti-aconitate hydratase-IgG antibody |
Family Cites Families (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7011952B2 (en) * | 2000-02-22 | 2006-03-14 | University Of Iowa Research Foundation | Diagnostics and therapeutics for macular degeneration-related disorders |
CA2815554A1 (en) * | 2004-03-12 | 2005-09-29 | Alnylam Pharmaceuticals, Inc. | Irna agents targeting vegf |
CN100396771C (en) * | 2004-05-10 | 2008-06-25 | 景岳生物科技股份有限公司 | New microbe gene stock similar to lactobacillus casei GM-O80, and application for treating disease related to irritability |
US7750138B2 (en) | 2004-06-08 | 2010-07-06 | Chengdu Kanghong Biotechnologies Co. Ltd. | Angiogenesis-inhibiting chimeric protein and the use |
US20060079494A1 (en) * | 2004-09-27 | 2006-04-13 | Santi Daniel V | Specific kinase inhibitors |
JP2009521506A (en) * | 2005-12-22 | 2009-06-04 | アルコン リサーチ, リミテッド | C3 convertase inhibitors for the prevention and treatment of age-related macular degeneration in patients with variants at risk for complement factor H |
US8821870B2 (en) * | 2008-07-18 | 2014-09-02 | Allergan, Inc. | Method for treating atrophic age related macular degeneration |
CA2742241C (en) | 2008-11-03 | 2019-12-10 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
DK2540843T3 (en) * | 2008-11-05 | 2014-09-01 | Genentech Inc | Genetic polymorphisms in age-related macular degeneration |
EP2483690A1 (en) | 2009-09-29 | 2012-08-08 | Protagen AG | Marker sequences for pancreatic cancer diseases, pancreatic carcinoma and use thereof |
EP2311823A1 (en) * | 2009-10-15 | 2011-04-20 | AC Immune S.A. | 2,6-Diaminopyridine compounds for treating diseases associated with amyloid proteins or for treating ocular diseases |
AU2010325908A1 (en) * | 2009-12-04 | 2012-06-07 | Euclid Systems Corporation | Composition and methods for the prevention and treatment of macular degeneration, diabetic retinopathy, and diabetic macular edema |
AR081361A1 (en) | 2010-04-30 | 2012-08-29 | Molecular Partners Ag | MODIFIED UNION PROTEINS THAT INHIBIT THE RECEPTOR INTERACTION OF THE VASCULAR ENDOTELIAL GROWTH FACTOR FROM GLICOPROTEIN TO VEGF-A |
KR101424217B1 (en) | 2011-05-18 | 2014-08-13 | 다이아텍코리아 주식회사 | Composition for the diagnosis, therapy and prophylaxis of age-realted macular deteneration and method for obtaining information on age-realted macular deteneration |
CA2762446C (en) * | 2011-12-06 | 2021-02-23 | Vaccinex, Inc. | Use of the combination of semaphorin-4d inhibitory molecules and vegf inhibitory molecules to inhibit angiogenesis |
AU2013243574B2 (en) * | 2012-04-03 | 2017-12-07 | Novelmed Therapeutics, Inc | Humanized and chimeric anti-factor C3 antibodies and uses thereof |
EP2735875A1 (en) * | 2012-11-27 | 2014-05-28 | Protagen AG | Marker sequences for Neuromyelitis Optica (NMO) and use thereof |
RU2015133252A (en) * | 2013-01-08 | 2017-02-10 | Бенитек Байофарма Лимитед | TREATMENT OF AGE-RELATED MACULAR DEGENERATION |
US10746735B2 (en) * | 2014-02-10 | 2020-08-18 | Oncimmune Germany Gmbh | Marker sequences for diagnosing and stratifying SLE patients |
GB201501613D0 (en) * | 2015-01-30 | 2015-03-18 | Ucb Biopharma Sprl | Treatment of autoimmune disorders with CD154 antibodies |
-
2017
- 2017-02-28 CN CN201780025616.6A patent/CN109073660B/en active Active
- 2017-02-28 US US16/080,628 patent/US11099185B2/en active Active
- 2017-02-28 WO PCT/EP2017/054579 patent/WO2017148904A1/en active Application Filing
- 2017-02-28 CN CN202211249000.6A patent/CN115951066A/en active Pending
- 2017-02-28 EP EP17708205.4A patent/EP3423835B1/en active Active
-
2021
- 2021-08-23 US US17/409,066 patent/US20220155295A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
EP3423835A1 (en) | 2019-01-09 |
CN109073660B (en) | 2022-10-28 |
CN115951066A (en) | 2023-04-11 |
CN109073660A (en) | 2018-12-21 |
WO2017148904A1 (en) | 2017-09-08 |
US20190072550A1 (en) | 2019-03-07 |
EP3423835B1 (en) | 2023-10-25 |
EP3423835C0 (en) | 2023-10-25 |
US11099185B2 (en) | 2021-08-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220155295A1 (en) | Predictive Markers Useful in the Treatment of Wet Age-Related Macular Degeneration | |
JP5893269B2 (en) | Methods and compositions for Alzheimer's disease | |
US11698378B2 (en) | Methods and compositions for tauopathy diagnosis and treatment | |
JP2009519460A (en) | Diagnosis and prognosis of colorectal cancer | |
JP2013092538A (en) | Diagnostic method for brain damage-related disorder | |
US20120094295A1 (en) | Neurodegenerative disease diagnostic compositions and methods of use | |
US20150192580A1 (en) | Biomarker for neurodegeneration in neurological disease | |
Hu et al. | Identification and validation of novel CSF biomarkers for early stages of Alzheimer's disease | |
Tremlett et al. | Serum proteomics in multiple sclerosis disease progression | |
EP2729810B1 (en) | Myositis | |
Obry et al. | Identification of 7 proteins in sera of RA patients with potential to predict ETA/MTX treatment response | |
KR102547505B1 (en) | Biomarker for early prediction of the treatment effect in major depressive disorder | |
WO2013124406A1 (en) | New dual biomarker of neurodegeneration and of neuroregeneration | |
KR102232200B1 (en) | Alzheimer’s disease diagnostic biomarker | |
US20160231335A1 (en) | Early Stage Parkinsons Disease Diagnostic Kits and Methods | |
WO2020032027A1 (en) | Diagnostic drug and diagnostic method for alzheimer's disease | |
KR101832039B1 (en) | Biomarker to predict target drug efficacy for hepatocellular carcinoma and its use | |
AU2021241773A1 (en) | Type XIX collagen assay | |
US20140087965A1 (en) | Marker for diagnosing diabetic retinopathy and use thereof | |
EP3115784A1 (en) | Polypeptide marker for analysis, diagnosis and therapy of eye-related diseases |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: MAINTECT GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GRUS, FRANZ;KORB, CHRISTINA;PFEIFFER, NORBERT;SIGNING DATES FROM 20170823 TO 20180823;REEL/FRAME:057270/0598 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |