CA2762446C - Use of the combination of semaphorin-4d inhibitory molecules and vegf inhibitory molecules to inhibit angiogenesis - Google Patents
Use of the combination of semaphorin-4d inhibitory molecules and vegf inhibitory molecules to inhibit angiogenesis Download PDFInfo
- Publication number
- CA2762446C CA2762446C CA2762446A CA2762446A CA2762446C CA 2762446 C CA2762446 C CA 2762446C CA 2762446 A CA2762446 A CA 2762446A CA 2762446 A CA2762446 A CA 2762446A CA 2762446 C CA2762446 C CA 2762446C
- Authority
- CA
- Canada
- Prior art keywords
- antibody
- vegf
- sema4d
- fragment
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108010056102 CD100 antigen Proteins 0.000 title claims abstract description 105
- 102100027744 Semaphorin-4D Human genes 0.000 title claims abstract description 103
- 230000002401 inhibitory effect Effects 0.000 title claims abstract description 15
- 230000033115 angiogenesis Effects 0.000 title claims description 35
- 101100372758 Danio rerio vegfaa gene Proteins 0.000 title 1
- 101150030763 Vegfa gene Proteins 0.000 title 1
- 230000027455 binding Effects 0.000 claims abstract description 236
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims abstract description 111
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 91
- 201000011510 cancer Diseases 0.000 claims abstract description 40
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims abstract 18
- 239000000427 antigen Substances 0.000 claims description 133
- 108091007433 antigens Proteins 0.000 claims description 133
- 102000036639 antigens Human genes 0.000 claims description 133
- 239000012634 fragment Substances 0.000 claims description 121
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 113
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 77
- 229920001184 polypeptide Polymers 0.000 claims description 71
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 71
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 63
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 29
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 claims description 17
- 239000003814 drug Substances 0.000 claims description 17
- 230000003993 interaction Effects 0.000 claims description 14
- 230000005764 inhibitory process Effects 0.000 claims description 11
- 102100034384 Plexin-B1 Human genes 0.000 claims description 10
- 101710100559 Plexin-B1 Proteins 0.000 claims description 7
- 206010027476 Metastases Diseases 0.000 claims description 6
- 238000004519 manufacturing process Methods 0.000 claims description 6
- 230000026731 phosphorylation Effects 0.000 claims description 6
- 238000006366 phosphorylation reaction Methods 0.000 claims description 6
- 208000002780 macular degeneration Diseases 0.000 claims description 5
- 206010039491 Sarcoma Diseases 0.000 claims description 3
- 208000000208 Wet Macular Degeneration Diseases 0.000 claims description 3
- 206010064930 age-related macular degeneration Diseases 0.000 claims description 3
- 230000001404 mediated effect Effects 0.000 claims description 3
- 230000014399 negative regulation of angiogenesis Effects 0.000 claims description 3
- 230000002611 ovarian Effects 0.000 claims description 3
- 210000004556 brain Anatomy 0.000 claims description 2
- 210000000481 breast Anatomy 0.000 claims description 2
- 230000002496 gastric effect Effects 0.000 claims description 2
- 210000003734 kidney Anatomy 0.000 claims description 2
- 210000004072 lung Anatomy 0.000 claims description 2
- 210000002307 prostate Anatomy 0.000 claims description 2
- 230000019491 signal transduction Effects 0.000 claims description 2
- 238000000034 method Methods 0.000 abstract description 97
- 230000005747 tumor angiogenesis Effects 0.000 abstract description 6
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 94
- 241000282414 Homo sapiens Species 0.000 description 93
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 67
- 235000001014 amino acid Nutrition 0.000 description 48
- 210000004027 cell Anatomy 0.000 description 44
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 41
- 108060003951 Immunoglobulin Proteins 0.000 description 32
- 102000018358 immunoglobulin Human genes 0.000 description 32
- 230000000694 effects Effects 0.000 description 31
- 238000006467 substitution reaction Methods 0.000 description 28
- 201000010099 disease Diseases 0.000 description 27
- 108090000623 proteins and genes Proteins 0.000 description 26
- 238000011282 treatment Methods 0.000 description 26
- 150000001413 amino acids Chemical class 0.000 description 25
- 229940024606 amino acid Drugs 0.000 description 24
- 230000035772 mutation Effects 0.000 description 24
- 102000005962 receptors Human genes 0.000 description 19
- 108020003175 receptors Proteins 0.000 description 19
- 238000002560 therapeutic procedure Methods 0.000 description 18
- 230000004048 modification Effects 0.000 description 17
- 238000012986 modification Methods 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- 125000000539 amino acid group Chemical group 0.000 description 16
- 210000003719 b-lymphocyte Anatomy 0.000 description 15
- 239000000203 mixture Substances 0.000 description 15
- 208000035475 disorder Diseases 0.000 description 14
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 13
- 241001465754 Metazoa Species 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 13
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 12
- 241001529936 Murinae Species 0.000 description 12
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 230000000903 blocking effect Effects 0.000 description 12
- 102000058223 human VEGFA Human genes 0.000 description 12
- 101150117115 V gene Proteins 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 11
- 239000008194 pharmaceutical composition Substances 0.000 description 11
- 230000009467 reduction Effects 0.000 description 11
- 230000007423 decrease Effects 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 10
- 238000011275 oncology therapy Methods 0.000 description 10
- 208000024891 symptom Diseases 0.000 description 10
- -1 IgM Chemical compound 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 210000001744 T-lymphocyte Anatomy 0.000 description 9
- 230000004071 biological effect Effects 0.000 description 9
- 210000004204 blood vessel Anatomy 0.000 description 9
- 239000011159 matrix material Substances 0.000 description 9
- 238000002703 mutagenesis Methods 0.000 description 9
- 231100000350 mutagenesis Toxicity 0.000 description 9
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 8
- 241000283984 Rodentia Species 0.000 description 8
- 230000000295 complement effect Effects 0.000 description 8
- 230000001976 improved effect Effects 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 230000004614 tumor growth Effects 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 7
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 7
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 7
- 230000004075 alteration Effects 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 230000006872 improvement Effects 0.000 description 7
- 230000007935 neutral effect Effects 0.000 description 7
- 230000001575 pathological effect Effects 0.000 description 7
- 235000002639 sodium chloride Nutrition 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 230000002792 vascular Effects 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 230000004913 activation Effects 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 230000004807 localization Effects 0.000 description 6
- 210000004379 membrane Anatomy 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 238000010369 molecular cloning Methods 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 6
- 101150013553 CD40 gene Proteins 0.000 description 5
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 5
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 108050003978 Semaphorin Proteins 0.000 description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 5
- 230000006907 apoptotic process Effects 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 210000004443 dendritic cell Anatomy 0.000 description 5
- 210000002744 extracellular matrix Anatomy 0.000 description 5
- 210000004408 hybridoma Anatomy 0.000 description 5
- 230000016784 immunoglobulin production Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 230000004797 therapeutic response Effects 0.000 description 5
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 4
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 4
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 102000014105 Semaphorin Human genes 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 4
- 230000021736 acetylation Effects 0.000 description 4
- 238000006640 acetylation reaction Methods 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 230000009260 cross reactivity Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000001212 derivatisation Methods 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 230000005714 functional activity Effects 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 208000027866 inflammatory disease Diseases 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 230000001613 neoplastic effect Effects 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 238000010845 search algorithm Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 208000016192 Demyelinating disease Diseases 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 102000003886 Glycoproteins Human genes 0.000 description 3
- 108090000288 Glycoproteins Proteins 0.000 description 3
- 101001067174 Homo sapiens Plexin-B1 Proteins 0.000 description 3
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 101710086070 Plexin-B Proteins 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 230000006052 T cell proliferation Effects 0.000 description 3
- 206010046865 Vaccinia virus infection Diseases 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 210000005220 cytoplasmic tail Anatomy 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 208000014829 head and neck neoplasm Diseases 0.000 description 3
- 230000002779 inactivation Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- 210000005210 lymphoid organ Anatomy 0.000 description 3
- 210000003563 lymphoid tissue Anatomy 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000006337 proteolytic cleavage Effects 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 208000007089 vaccinia Diseases 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 2
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 2
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 2
- 244000105975 Antidesma platyphyllum Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 230000003844 B-cell-activation Effects 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 206010012305 Demyelination Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 101100310048 Mus musculus Sema4d gene Proteins 0.000 description 2
- 102000002233 Myelin-Oligodendrocyte Glycoprotein Human genes 0.000 description 2
- 108010000123 Myelin-Oligodendrocyte Glycoprotein Proteins 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 2
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 2
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 2
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 2
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 2
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000002491 angiogenic effect Effects 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 238000003782 apoptosis assay Methods 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 230000003376 axonal effect Effects 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 238000009583 bone marrow aspiration Methods 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 150000001720 carbohydrates Chemical group 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 230000004041 dendritic cell maturation Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 239000003792 electrolyte Substances 0.000 description 2
- 230000013020 embryo development Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000013401 experimental design Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000022244 formylation Effects 0.000 description 2
- 238000006170 formylation reaction Methods 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 235000009424 haa Nutrition 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 238000001361 intraarterial administration Methods 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- 229940067606 lecithin Drugs 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 230000002297 mitogenic effect Effects 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 210000004248 oligodendroglia Anatomy 0.000 description 2
- 150000002482 oligosaccharides Polymers 0.000 description 2
- 230000006320 pegylation Effects 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 210000001428 peripheral nervous system Anatomy 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 108050009312 plexin Proteins 0.000 description 2
- 102000002022 plexin Human genes 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000000284 resting effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000004565 tumor cell growth Effects 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 210000005166 vasculature Anatomy 0.000 description 2
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 101100356682 Caenorhabditis elegans rho-1 gene Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 238000012752 Hepatectomy Methods 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001001487 Homo sapiens Phosphatidylinositol-glycan biosynthesis class F protein Proteins 0.000 description 1
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 1
- 101000686246 Homo sapiens Ras-related protein R-Ras Proteins 0.000 description 1
- 101000650822 Homo sapiens Semaphorin-4B Proteins 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 1
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 1
- 101100042271 Mus musculus Sema3b gene Proteins 0.000 description 1
- 208000022873 Ocular disease Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000016979 Other receptors Human genes 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 102100035194 Placenta growth factor Human genes 0.000 description 1
- 102100040681 Platelet-derived growth factor C Human genes 0.000 description 1
- 208000006994 Precancerous Conditions Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 101150111584 RHOA gene Proteins 0.000 description 1
- 102100024683 Ras-related protein R-Ras Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 102100027717 Semaphorin-4B Human genes 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 208000018359 Systemic autoimmune disease Diseases 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 101150003725 TK gene Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 102100021657 Tyrosine-protein phosphatase non-receptor type 6 Human genes 0.000 description 1
- 101710128901 Tyrosine-protein phosphatase non-receptor type 6 Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 241000282458 Ursus sp. Species 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 208000032594 Vascular Remodeling Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 229940124532 absorption promoter Drugs 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 150000008043 acidic salts Chemical class 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 150000001447 alkali salts Chemical class 0.000 description 1
- 230000002187 allostimulatory effect Effects 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 230000006427 angiogenic response Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000035578 autophosphorylation Effects 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 238000007469 bone scintigraphy Methods 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000012876 carrier material Substances 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- GXGAKHNRMVGRPK-UHFFFAOYSA-N dimagnesium;dioxido-bis[[oxido(oxo)silyl]oxy]silane Chemical compound [Mg+2].[Mg+2].[O-][Si](=O)O[Si]([O-])([O-])O[Si]([O-])=O GXGAKHNRMVGRPK-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 230000035194 endochondral ossification Effects 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 230000010595 endothelial cell migration Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 210000001280 germinal center Anatomy 0.000 description 1
- 210000001102 germinal center b cell Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 210000000020 growth cone Anatomy 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 238000002991 immunohistochemical analysis Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 208000023589 ischemic disease Diseases 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000035168 lymphangiogenesis Effects 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 230000037230 mobility Effects 0.000 description 1
- 238000002625 monoclonal antibody therapy Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 230000001002 morphogenetic effect Effects 0.000 description 1
- 230000008450 motivation Effects 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 108010017992 platelet-derived growth factor C Proteins 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000007542 postnatal development Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000001023 pro-angiogenic effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 108700015048 receptor decoy activity proteins Proteins 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000010911 splenectomy Methods 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 208000017572 squamous cell neoplasm Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 230000001296 transplacental effect Effects 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 230000005748 tumor development Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 229940036109 vaccinia immunoglobulin Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 230000006711 vascular endothelial growth factor production Effects 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 230000004862 vasculogenesis Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 230000007998 vessel formation Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Abstract
Provided herein are methods for inhibiting tumor angiogenesis in a cancer patient, the method comprising administering to the subject an effective amount of a first isolated binding molecule which specifically binds to semaphorin-4D (SEMA4D) and an effective amount of a second isolated binding molecule which specifically binds to VEGF.
Description
MOLECULES AND VEGF INHIBITORY MOLECULES TO INHIBIT
ANGIOGENESIS
[0001]
BACKGROUND OF THE INVENTION
ANGIOGENESIS
[0001]
BACKGROUND OF THE INVENTION
[0002] Semaphorin 4D (SEMA4D), also known as CD100, is a transmembrane protein (e.g., SEQ ID NO: I (human); SEQ ID NO: 2 (murine)) that belongs to the semaphorin gene family. SEMA4D is expressed on the cell surface as a homodimer, but upon cell activation SEMA4D can be released from the cell surface via proteolytic cleavage to generate sSEMA4D, a soluble form of the protein, which is also biologically active. See Suzuki et al.. Nature Rev. Inununol. 3:159-167 (2003); Kikutaniet al., Nature Immunol.
9:17-23 (2008).
9:17-23 (2008).
[0003] Immunohistochemical analysis of SEMA4D in a large tumor sample collection revealed that SEMA4D overexpression is a very frequent event in head and neck, prostate, ovarian, pancreatic, colon, breast, and lung cancers as well as being significantly expressed in other tumor types. SEMA4D is a potent pro-angiogenic molecule. Activation through a SEMA4D receptor, Plexin-B I promotes angiogenesis both in vitro and in vivo.
See, e.g., Sierra JR, etal. J Exp Med 205:1673-1685(2008). Plexin-Bl is referred to here and in the scientific literature interchangeably as, Plexin-B1, plexin-B1, Plexin BI or plexin BI.
See, e.g., Sierra JR, etal. J Exp Med 205:1673-1685(2008). Plexin-Bl is referred to here and in the scientific literature interchangeably as, Plexin-B1, plexin-B1, Plexin BI or plexin BI.
[0004] The angiogenic response elicited by SEMA4D is comparable to that elicited by other angiogenic molecules, such as vascular endothelial growth factor (VEGF). It is well established that VEGF and its receptors are key regulators of new blood vessel formation, or angiogenesis. The VEGF gene family has several members, including VEGF-A
(also referred to herein as -VEGF"), VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. See, Date Recue/Date Received 2020-11-06 Ho and Kuo, Jut. J. Biochein Cell Biol. 2007; 39(7-8): 1349-1357. There are numerous alternatively spliced isoforms of human VEGF. including VEGF165, VEGF121, VEGF189, and VEGF206. See, Ho and Kuo, Int. J. Biochent Cell Biol. 2007; 39(7-8): 1349-1357;
Ferraraet al., Nature Med. 2003; 9 (6):669-676. The VEGF165 isoform is the most prevalent and mitogenic and is most similar in properties to the 45kDa native VEGF. See, Ho and Kuo, Int. J. Biochern Cell Biol. 2007; 39(7-8): 1349-1357; Ferraraet al., Nature Med. 2003; 9 (6):669-676.
100051 VEGF exists as a 45kD homodimeric glycoprotein which binds to two related tyrosine kinase receptors. Ferraraet al., Nature Med. 2003; 9 (6):669-676. VEGFR-1 (also known as Flt-1), is a high affinity receptor for VEGF whose function is not fully understood.
VEGFR-2 (also known as KDR or Flkl), is the other high affinity receptor for VEGF, and is the receptor through which the pro-angiogeneic activity of VEGF is believed to be induced. See Ferrara et al., Nature Med. 2003; 9 (6):669-676. VEGFR2 forms a dimer and autophosphorylates when bound to VEGF. Dougher and Terman, Oncogene. 1999;
18: 1619-1627. This, in turn, activates several signaling cascades that promote endothelial cell growth and migration, and which, ultimately, lead to angiogenesis. See Hicklin and Ellis, J. Clin. Oncol. 2005; 23(5): 1011-1027.
[0006] During embryonic and postnatal development, VEGF participates in angiogenesis, vasculogenesis, and lymphangiogenesis. VEGF has also been found to play a role in adult processes, as well, including ovarian angiogenesis, endochondral bone formation, tissue regeneration, survival of hematopoietic stem cells, and regulation of erythropoietin.
See, Ho and Kuo, Int. J. Biochern Cell Biol. 2007; 39(7-8): 1349-1357. It is the involvement of VEGF in disease processes such as cancer and other neoplastic conditions, inflammatory disease, ocular disease, and ischemic disease that makes it a potential target for treatment.
100071 Angiogenesis is a requirement for a tumor to grow beyond 1 to 2 mm. The formation of new vasculature is a result of the tumor environment "switching" on several pathways that promote tumor angiogenesis. Inhibition of VEGF-induced angiogenesis by a monoclonal antibody that specifically binds to VEGF was shown to suppress tumor growth in vivo. See Kim et al., Nature 1993; 362: 841-844. This observation was the motivation for development of a therapeutic antibody, bevacizumab, to neutralize VEGF
and slow the progression of cancer.
_ [0008] There is significant toxicity associated with clinical use of ant-VEGF
antibodies. There remains, therefore, a need for cancer treatments, and in particular therapeutics that inhibit, suppress, prevent, slow the progression of, shrink, or directly attack angiogenesis.
BRIEF SUMMARY OF THE INVENTION
[0009] Methods for inhibiting tumor angiogenesis in a cancer patient are disclosed herein.
According to aspects of the invention illustrated herein, the method includedadministering to the subject an effective amount of a first isolated binding molecule which specifically binds to semaphorin-4D (SEMA4D) and an effective amount of a second isolated binding molecule which specifically binds to VEGF.
[0010] According to aspects illustrated herein, there is provided a method of treating cancer in a subject, includingadministering to the subject an effective amount of a first isolated binding molecule which specifically binds to semaphorin-4D (SEMA4D) and an effective amount of a second isolated binding molecule which specifically binds to VEGF, wherein the first isolated binding molecule and second isolated binding molecule act to inhibit angiogenesis.
[0011] According to aspects illustrated herein, there is provided a method for inhibiting angiogenesis in a subject, includingadministering to the subject an effective amount of a first isolated binding molecule which inhibits interaction of semaphorin-4D
(SEMA4D) with Plexin-Bl and an effective amount of a second isolated binding molecule which inhibits interaction of VEGF with VEGFR2.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0012] FIGURES 1: Measurement of tumor volume in tumor grafted mice showing mean tumor volume among the four groups.
[0013] FIGURE 2: Photographs for the extracted tumors. "S4D antibody" is VX15/2503.
"VEGF antibody" is Mouse IgG2A MAb 2931.
[0014] FIGURE 3: Measurement of vascular density in tumor grafted mice. "Anti-antibody" is VX15/2503. "Anti-VEGF antibody" is Mouse IgG2A MAb 2931.
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions 100151 It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "an anti-SEMA4D antibody" is understood to represent one or more anti-SEMA4D antibodies. As such, the terms "a" (or "an"), "one or more," and "at least one"
can be used interchangeably herein.
[0016] As used herein, the terms "cancer' and "cancerous" refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, gastric, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, brain cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, esophageal cancer, salivary gland carcinoma, sarcoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers.
[0017] "Invasive angiogenesis" refers to the formation of blood vessels for the support of pathological conditions, including malignant and non-malignant tumors as well as the abnormal formation of new blood vessels in macular degeneration.
100181 The terms "proliferative disorder" and "proliferative disease" refer to disorders associated with abnormal cell proliferation such as cancer.
[0019] "Tumor" and -neoplasm" as used herein refer to any mass of tissue that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions. In certain embodiments, tumors described herein express Plexin-B1, and can express SEMA4B and activated Met.
100201 The term "therapeutically effective amount" refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to "treat" a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; retard or stop cancer cell division, reduce or retard an increase in tumor size; inhibit, e.g., suppress, retard, prevent, shrink, stop, or reverse tumor angiogenesis; inhibit, e.g., suppress, retard,
(also referred to herein as -VEGF"), VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. See, Date Recue/Date Received 2020-11-06 Ho and Kuo, Jut. J. Biochein Cell Biol. 2007; 39(7-8): 1349-1357. There are numerous alternatively spliced isoforms of human VEGF. including VEGF165, VEGF121, VEGF189, and VEGF206. See, Ho and Kuo, Int. J. Biochent Cell Biol. 2007; 39(7-8): 1349-1357;
Ferraraet al., Nature Med. 2003; 9 (6):669-676. The VEGF165 isoform is the most prevalent and mitogenic and is most similar in properties to the 45kDa native VEGF. See, Ho and Kuo, Int. J. Biochern Cell Biol. 2007; 39(7-8): 1349-1357; Ferraraet al., Nature Med. 2003; 9 (6):669-676.
100051 VEGF exists as a 45kD homodimeric glycoprotein which binds to two related tyrosine kinase receptors. Ferraraet al., Nature Med. 2003; 9 (6):669-676. VEGFR-1 (also known as Flt-1), is a high affinity receptor for VEGF whose function is not fully understood.
VEGFR-2 (also known as KDR or Flkl), is the other high affinity receptor for VEGF, and is the receptor through which the pro-angiogeneic activity of VEGF is believed to be induced. See Ferrara et al., Nature Med. 2003; 9 (6):669-676. VEGFR2 forms a dimer and autophosphorylates when bound to VEGF. Dougher and Terman, Oncogene. 1999;
18: 1619-1627. This, in turn, activates several signaling cascades that promote endothelial cell growth and migration, and which, ultimately, lead to angiogenesis. See Hicklin and Ellis, J. Clin. Oncol. 2005; 23(5): 1011-1027.
[0006] During embryonic and postnatal development, VEGF participates in angiogenesis, vasculogenesis, and lymphangiogenesis. VEGF has also been found to play a role in adult processes, as well, including ovarian angiogenesis, endochondral bone formation, tissue regeneration, survival of hematopoietic stem cells, and regulation of erythropoietin.
See, Ho and Kuo, Int. J. Biochern Cell Biol. 2007; 39(7-8): 1349-1357. It is the involvement of VEGF in disease processes such as cancer and other neoplastic conditions, inflammatory disease, ocular disease, and ischemic disease that makes it a potential target for treatment.
100071 Angiogenesis is a requirement for a tumor to grow beyond 1 to 2 mm. The formation of new vasculature is a result of the tumor environment "switching" on several pathways that promote tumor angiogenesis. Inhibition of VEGF-induced angiogenesis by a monoclonal antibody that specifically binds to VEGF was shown to suppress tumor growth in vivo. See Kim et al., Nature 1993; 362: 841-844. This observation was the motivation for development of a therapeutic antibody, bevacizumab, to neutralize VEGF
and slow the progression of cancer.
_ [0008] There is significant toxicity associated with clinical use of ant-VEGF
antibodies. There remains, therefore, a need for cancer treatments, and in particular therapeutics that inhibit, suppress, prevent, slow the progression of, shrink, or directly attack angiogenesis.
BRIEF SUMMARY OF THE INVENTION
[0009] Methods for inhibiting tumor angiogenesis in a cancer patient are disclosed herein.
According to aspects of the invention illustrated herein, the method includedadministering to the subject an effective amount of a first isolated binding molecule which specifically binds to semaphorin-4D (SEMA4D) and an effective amount of a second isolated binding molecule which specifically binds to VEGF.
[0010] According to aspects illustrated herein, there is provided a method of treating cancer in a subject, includingadministering to the subject an effective amount of a first isolated binding molecule which specifically binds to semaphorin-4D (SEMA4D) and an effective amount of a second isolated binding molecule which specifically binds to VEGF, wherein the first isolated binding molecule and second isolated binding molecule act to inhibit angiogenesis.
[0011] According to aspects illustrated herein, there is provided a method for inhibiting angiogenesis in a subject, includingadministering to the subject an effective amount of a first isolated binding molecule which inhibits interaction of semaphorin-4D
(SEMA4D) with Plexin-Bl and an effective amount of a second isolated binding molecule which inhibits interaction of VEGF with VEGFR2.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0012] FIGURES 1: Measurement of tumor volume in tumor grafted mice showing mean tumor volume among the four groups.
[0013] FIGURE 2: Photographs for the extracted tumors. "S4D antibody" is VX15/2503.
"VEGF antibody" is Mouse IgG2A MAb 2931.
[0014] FIGURE 3: Measurement of vascular density in tumor grafted mice. "Anti-antibody" is VX15/2503. "Anti-VEGF antibody" is Mouse IgG2A MAb 2931.
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions 100151 It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "an anti-SEMA4D antibody" is understood to represent one or more anti-SEMA4D antibodies. As such, the terms "a" (or "an"), "one or more," and "at least one"
can be used interchangeably herein.
[0016] As used herein, the terms "cancer' and "cancerous" refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, gastric, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, brain cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, esophageal cancer, salivary gland carcinoma, sarcoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers.
[0017] "Invasive angiogenesis" refers to the formation of blood vessels for the support of pathological conditions, including malignant and non-malignant tumors as well as the abnormal formation of new blood vessels in macular degeneration.
100181 The terms "proliferative disorder" and "proliferative disease" refer to disorders associated with abnormal cell proliferation such as cancer.
[0019] "Tumor" and -neoplasm" as used herein refer to any mass of tissue that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions. In certain embodiments, tumors described herein express Plexin-B1, and can express SEMA4B and activated Met.
100201 The term "therapeutically effective amount" refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to "treat" a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; retard or stop cancer cell division, reduce or retard an increase in tumor size; inhibit, e.g., suppress, retard, prevent, shrink, stop, or reverse tumor angiogenesis; inhibit, e.g., suppress, retard,
- 5 -prevent. stop, or reverse the formation of new blood vessels; relieve to some extent one or more of the symptoms associated with the cancer, reduce morbidity and mortality;
improve quality of life; or a combination of such effects. To the extent the drug prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
100211 Terms such as "treating" or "treatment" or "to treat" or "alleviating"
or "to alleviate" refer to both I) therapeutic measures that cure, slow down, lessen symptoms of, reverse, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. A subject is successfully "treated" according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of blood vessels; a reduction in the tumor size; or retardation or reversal of tumor growth;
inhibition, e.g., suppression, prevention, retardation, shrinkage, or reversal of angiogenesis, i.e., of formation of new blood vessels; inhibition of, e.g., suppression of, retardation of, prevention of, shrinkage of, reversal of or an absence of tumor growth;
relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; or some combination of effects.
Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
"Treatment" can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
100221 By "subject" or "individual" or "animal" or "patient" or "mammal," is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, bears, and so on.
improve quality of life; or a combination of such effects. To the extent the drug prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic.
100211 Terms such as "treating" or "treatment" or "to treat" or "alleviating"
or "to alleviate" refer to both I) therapeutic measures that cure, slow down, lessen symptoms of, reverse, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. A subject is successfully "treated" according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of blood vessels; a reduction in the tumor size; or retardation or reversal of tumor growth;
inhibition, e.g., suppression, prevention, retardation, shrinkage, or reversal of angiogenesis, i.e., of formation of new blood vessels; inhibition of, e.g., suppression of, retardation of, prevention of, shrinkage of, reversal of or an absence of tumor growth;
relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; or some combination of effects.
Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
"Treatment" can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
100221 By "subject" or "individual" or "animal" or "patient" or "mammal," is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, bears, and so on.
-6-100231 As used herein, phrases such as "a subject that would benefit from administration of an anti-SEMA4D antibodyand/or an anti-VEGF antibody" and "an animal in need of treatment" includes subjects, such as mammalian subjects, that would benefit from administration of an anti-SEMA4D antibodyand an anti-VEGF antibody and/or from treatment.
[0024] A "binding molecule" or "antigen binding molecule" of the present invention refers in its broadest sense to a molecule that specifically binds an antigenic determinant.ln one embodiment, the binding molecule specifically binds to SEMA4D, e.g., a transmembrane SEMA4D polypeptide of about 150 kDa or a soluble SEMA4D polypeptide of about kDa (commonly referred to as sSEMA4D). In another embodiment, the binding molecule specifically binds to native VEGF ("VEGF-A"), e.g., a 45 kDahomodimeric glycoprotein, or other allelic or variant forms of VEGF. In another embodiment, a binding molecule of the invention is an antibody or an antigen binding fragment thereof. In another embodiment, a binding molecule of the invention comprises at least one heavy or light chain CDR of an antibody molecule. In another embodiment, a binding molecule of the invention comprises at least two CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least three CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least four CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least five CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least six CDRs from one or more antibody molecules.
[0025] The present invention is directed to a method of inhibiting angiogenesis in a subject, e.g., cancer patient, comprising administering to the subject an anti-SEMA4D and/or anti-VEGF binding molecule, e.g,. an antibody, or antigen-binding fragment, variant, or derivative thereof. Unless specifically referring to full-sized antibodies such as naturally occurring antibodies, the terms "anti-SEMA4D antibody" and "anti-VEGF
antibody"
encompass full-sized antibodies as well as antigen-binding fragments, variants, analogs, or derivatives of such antibodies, e.g., naturally occurring antibody or immunoglobulin molecules or engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules.
[0024] A "binding molecule" or "antigen binding molecule" of the present invention refers in its broadest sense to a molecule that specifically binds an antigenic determinant.ln one embodiment, the binding molecule specifically binds to SEMA4D, e.g., a transmembrane SEMA4D polypeptide of about 150 kDa or a soluble SEMA4D polypeptide of about kDa (commonly referred to as sSEMA4D). In another embodiment, the binding molecule specifically binds to native VEGF ("VEGF-A"), e.g., a 45 kDahomodimeric glycoprotein, or other allelic or variant forms of VEGF. In another embodiment, a binding molecule of the invention is an antibody or an antigen binding fragment thereof. In another embodiment, a binding molecule of the invention comprises at least one heavy or light chain CDR of an antibody molecule. In another embodiment, a binding molecule of the invention comprises at least two CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least three CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least four CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least five CDRs from one or more antibody molecules. In another embodiment, a binding molecule of the invention comprises at least six CDRs from one or more antibody molecules.
[0025] The present invention is directed to a method of inhibiting angiogenesis in a subject, e.g., cancer patient, comprising administering to the subject an anti-SEMA4D and/or anti-VEGF binding molecule, e.g,. an antibody, or antigen-binding fragment, variant, or derivative thereof. Unless specifically referring to full-sized antibodies such as naturally occurring antibodies, the terms "anti-SEMA4D antibody" and "anti-VEGF
antibody"
encompass full-sized antibodies as well as antigen-binding fragments, variants, analogs, or derivatives of such antibodies, e.g., naturally occurring antibody or immunoglobulin molecules or engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules.
- 7 -[0026] As used herein, "human" or "fully human" antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and that do not express endogenous immunoglobulins, as described infra and, for example, in U.S. Pat. No. 5,939,598 by Kucherlapatiet al.
"Human" or "fully human" antibodies also include antibodies comprising at least the variable domain of a heavy chain, or at least the variable domains of a heavy chain and a light chain, where the variable domain(s) have the amino acid sequence of human immunoglobulin variable domain(s).
[0027] "Human" or "fully human" antibodies also include "human" or "fully human" antibodies, as described above, that comprise, consist essentially of, or consist of, variants (including derivatives) of antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies or fragments thereof immunospecifically bind to a SEMA4D or VEGF polypeptide or fragment or variant thereof. Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a human anti-SEMA4D antibody, including, but not limited to, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions.
Preferably, the variants (including derivatives) encode less than 50 amino acid substitutions, less than 40 amino acid substitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VHCDR1, VHCDR2, VHCDR3, VL
region, VLCDR I, VLCDR2, or VLCDR3.
[0028] In certain embodiments, the amino acid substitutions are conservative amino acid substitution, discussed further below. Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a SEMA4D or VEGF polypeptide, e.g., human, murine, or both human and murine SEMA4D or VEGF). Such variants (or derivatives thereof) of "human" or "fully human" antibodies can also be referred to as human or fully human
"Human" or "fully human" antibodies also include antibodies comprising at least the variable domain of a heavy chain, or at least the variable domains of a heavy chain and a light chain, where the variable domain(s) have the amino acid sequence of human immunoglobulin variable domain(s).
[0027] "Human" or "fully human" antibodies also include "human" or "fully human" antibodies, as described above, that comprise, consist essentially of, or consist of, variants (including derivatives) of antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies or fragments thereof immunospecifically bind to a SEMA4D or VEGF polypeptide or fragment or variant thereof. Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a human anti-SEMA4D antibody, including, but not limited to, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions.
Preferably, the variants (including derivatives) encode less than 50 amino acid substitutions, less than 40 amino acid substitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VHCDR1, VHCDR2, VHCDR3, VL
region, VLCDR I, VLCDR2, or VLCDR3.
[0028] In certain embodiments, the amino acid substitutions are conservative amino acid substitution, discussed further below. Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a SEMA4D or VEGF polypeptide, e.g., human, murine, or both human and murine SEMA4D or VEGF). Such variants (or derivatives thereof) of "human" or "fully human" antibodies can also be referred to as human or fully human
- 8 -antibodies that are "optimized" or "optimized for antigen binding" and include antibodies that have improved affinity to antigen.
[0029] The terms "antibody" and "immunoglobulin" are used interchangeably herein. An antibody or immunoglobulin comprises at least the variable domain of a heavy chain, and normally comprises at least the variable domains of a heavy chain and a light chain.
Basic immunoglobulin structures in vertebrate systems are relatively well understood.
See, e.g., Harlow et al. (1988) Antibodies: A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press).
100301 As used herein, the term "immunoglobulin" comprises various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon, (7, j.t, a, 6, c) with some subclasses among them (e.g., 71-74). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA IgG, or IgE, respectively. The immunoglobulin subclasses (isotypes) e.g., IgGI, IgG2, IgG3, IgG4, IgA I, etc.
are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypcs are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention. All immunoglobulin classes are clearly within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules. With regard to IgG, a standard immunoglobulin molecule comprises two identical light chain polypeptides of molecular weight approximately 23.000 Daltons, and two identical heavy chain polypeptides of molecular weight 53,000-70,000. The four chains are typically joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y" and continuing through the variable region.
100311 Light chains are classified as either kappa or lambda (lc, X). Each heavy chain class may be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
[0029] The terms "antibody" and "immunoglobulin" are used interchangeably herein. An antibody or immunoglobulin comprises at least the variable domain of a heavy chain, and normally comprises at least the variable domains of a heavy chain and a light chain.
Basic immunoglobulin structures in vertebrate systems are relatively well understood.
See, e.g., Harlow et al. (1988) Antibodies: A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press).
100301 As used herein, the term "immunoglobulin" comprises various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon, (7, j.t, a, 6, c) with some subclasses among them (e.g., 71-74). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA IgG, or IgE, respectively. The immunoglobulin subclasses (isotypes) e.g., IgGI, IgG2, IgG3, IgG4, IgA I, etc.
are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypcs are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention. All immunoglobulin classes are clearly within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules. With regard to IgG, a standard immunoglobulin molecule comprises two identical light chain polypeptides of molecular weight approximately 23.000 Daltons, and two identical heavy chain polypeptides of molecular weight 53,000-70,000. The four chains are typically joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y" and continuing through the variable region.
100311 Light chains are classified as either kappa or lambda (lc, X). Each heavy chain class may be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
- 9 -[0032] Both the light and heavy chains arc divided into regions of structural and functional homology. The terms "constant" and "variable" are used functionally. In this regard, it will be appreciated that the variable domains of both the light (VL or VK) and heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CL) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fe receptor binding, complement binding, and the like. By convention the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody. The N-terminal portion is a variable region and at the C-terminal portion is a constant region; the C113 and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
[0033] As indicated above, the variable region allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain, or subset of the complementarity determining regions (CDRs) within these variable domains, of an antibody combine to form the variable region that defines a three dimensional antigen binding site. This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three CDRs on each of the VH and VL chains. In some instances, e.g., certain immunoglobulin molecules derived from camelid species or engineered based on camelidimmunoglobulins, a complete immunoglobulin molecule may consist of heavy chains only, with no light chains. See, e.g., Hamers-Castermanet a/., Nature 363:446-448 (1993).
[0034] In naturally occurring antibodies, the six "complementarity determining regions" or "CDRs" present in each antigen binding domain are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding domain as the antibody assumes its three dimensional configuration in an aqueous environment. The remainder of the amino acids in the antigen binding domains, referred to as "framework"
regions, show less inter-molecular variability. The framework regions largely adopt a 3-sheet conformation and the CDRs form loops that connect, and in some cases form part of, the n-sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions. The antigen binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope. The amino acids comprising the CDRs and the framework regions, respectively, can be readily identified for any given heavy or light chain variable domain by one of ordinary skill in the art, since they have been precisely defined (see below).
[0035] In the case where there are two or more definitions of a term that is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term "complementarity determining region" ("CDR") to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. This particular region has been described by Kabat et al. (1983) U.S. Dept.
of Health and Human Services, "Sequences of Proteins of Immunological Interest" and by Chothia and Lesk, J. Mol. Biol. /96:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues that encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. The exact residue numbers that encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.
Table 1. CDR Definitions I
Kabat Chothia ___________________ VI-! CDR I 31-35 26-32 VH CDR2 50-65 ____ 52-58 VH CDR3 95-102 95-102 __ INumbering of all CDR definitions in I ablu I is aceolding to the numbering conventions set forth by Kabat et al. (see below).
[0036] Kabatet al. also defined a numbering system for variable domain sequences that is applicable to any antibody. One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any - H
experimental data beyond the sequence itself. As used herein, "Kabat numbering" refers to the numbering system set forth by Kabatet al. (1983) U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest." Unless otherwise specified, references to the numbering of specific amino acid residue positions in an anti-SEMA4D
antibody or antigen-binding fragment, variant, or derivative thereof of the present invention are according to the Kabat numbering system.
10037] Antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, bispecific, human.
humanized, primatized, or chimeric antibodies, single-chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab.)2, Fd, Fvs, single-chain Fvs (scFv), disulfide-linked Fvs (scIFv), fragments comprising either a VI, or VH domain, fragments produced by a Fab expression library, and anti-idiotypic (anti-Id) antibodies (including.
e.g., anti-Id antibodies to anti-SEMA4D antibodies disclosed herein). ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019. Immunoglobulin or antibody molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG I, IgG2, IgG3, IgG4, IgAl , and IgA2, etc.), or subclass of immunoglobulin molecule.
100381 As used herein, the term "heavy chain portion" includes amino acid sequences derived from an immunoglobulin heavy chain. In certain embodiments, a polypeptide comprising a heavy chain portion comprises at least one of: a VH domain, a CHI domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof. For example, a binding polypeptide for use in the invention may comprise a polypeptide chain comprising a CHI domain; a polypeptide chain comprising a CHI domain, at least a portion of a hinge domain, and a CH2 domain;
a polypeptide chain comprising a CHI domain and a CII3 domain; a polypeptide chain comprising a CH1 domain, at least a portion of a hinge domain, and a CH3 domain, or a polypeptide chain comprising a CHI domain, at least a portion of a hinge domain, a CH2 domain. and a CH3 domain. In another embodiment, a polypeptide of the invention comprises a polypeptide chain comprising a CH3 domain. Further, a binding polypeptide for use in the invention may lack at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). As set forth above, it will be understood by one of ordinary skill in the art that these domains (e.g., the heavy chain portions) may be modified such that they vary in amino acid sequence from the naturally occurring immunoglobulin molecule.
[0039J In certain anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein, the heavy chain portions of one polypeptide chain of a multimer are identical to those on a second polypeptide chain of the multhner.
Alternatively, heavy chain portion-containing monomers of the invention are not identical. For example, each monomer may comprise a different target binding site, forming, for example, a bispecific antibody.
100401 The heavy chain portions of a binding molecule for use in the methods disclosed herein may be derived from different immunoglobulin molecules. For example, a heavy chain portion of a polypeptide can comprise a CHI domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule. In another example, a heavy chain portion can comprise a hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. In another example, a heavy chain portion can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.
100411 As used herein, the term "light chain portion" includes amino acid sequences derived from an immunoglobulin light chain, e.g., a kappa or lambda light chain.
Preferably, the light chain portion comprises at least one of a VL or CL domain.
100421 Anti-SEMA4D or anti-VEGF antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein may be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polypeptide disclosed herein (e.g., SEMA4D or VEGF) that they recognize or specifically bind. The portion of a target polypeptide that specifically interacts with the antigen binding domain of an antibody is an "epitope," or an "antigenic determinant." A target polypeptide can comprise a single epitope. but typically comprises at least two epitopes, and can include any number of epitopes, depending on the size, conformation, and type of antigen.
Furthermore, it should be noted that an "epitope" on a target polypeptide may be or may include non-polypeptide elements, e.g., an epitope may include a carbohydrate side chain.
100431 The minimum size of a peptide or polypeptide epitope for an antibody is thought to be about four to five amino acids. Peptide or polypeptide epitopes preferably contain at least seven, more preferably at least nine and most preferably between at least about 15 to about 30 amino acids. Since a CDR can recognize an antigenic peptide or polypeptide in its tertiary form, the amino acids comprising an epitope need not be contiguous, and in some cases, may not even be on the same peptide chain. A peptide or polypeptide epitope recognized by anti-SEMA4D antibodies of the present invention may contain a sequence of at least 4, at least 5, at least 6, at least 7, more preferably at least 8, at least 9, at least
[0033] As indicated above, the variable region allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain, or subset of the complementarity determining regions (CDRs) within these variable domains, of an antibody combine to form the variable region that defines a three dimensional antigen binding site. This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three CDRs on each of the VH and VL chains. In some instances, e.g., certain immunoglobulin molecules derived from camelid species or engineered based on camelidimmunoglobulins, a complete immunoglobulin molecule may consist of heavy chains only, with no light chains. See, e.g., Hamers-Castermanet a/., Nature 363:446-448 (1993).
[0034] In naturally occurring antibodies, the six "complementarity determining regions" or "CDRs" present in each antigen binding domain are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding domain as the antibody assumes its three dimensional configuration in an aqueous environment. The remainder of the amino acids in the antigen binding domains, referred to as "framework"
regions, show less inter-molecular variability. The framework regions largely adopt a 3-sheet conformation and the CDRs form loops that connect, and in some cases form part of, the n-sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions. The antigen binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope. The amino acids comprising the CDRs and the framework regions, respectively, can be readily identified for any given heavy or light chain variable domain by one of ordinary skill in the art, since they have been precisely defined (see below).
[0035] In the case where there are two or more definitions of a term that is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term "complementarity determining region" ("CDR") to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. This particular region has been described by Kabat et al. (1983) U.S. Dept.
of Health and Human Services, "Sequences of Proteins of Immunological Interest" and by Chothia and Lesk, J. Mol. Biol. /96:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues that encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. The exact residue numbers that encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.
Table 1. CDR Definitions I
Kabat Chothia ___________________ VI-! CDR I 31-35 26-32 VH CDR2 50-65 ____ 52-58 VH CDR3 95-102 95-102 __ INumbering of all CDR definitions in I ablu I is aceolding to the numbering conventions set forth by Kabat et al. (see below).
[0036] Kabatet al. also defined a numbering system for variable domain sequences that is applicable to any antibody. One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any - H
experimental data beyond the sequence itself. As used herein, "Kabat numbering" refers to the numbering system set forth by Kabatet al. (1983) U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest." Unless otherwise specified, references to the numbering of specific amino acid residue positions in an anti-SEMA4D
antibody or antigen-binding fragment, variant, or derivative thereof of the present invention are according to the Kabat numbering system.
10037] Antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, bispecific, human.
humanized, primatized, or chimeric antibodies, single-chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab.)2, Fd, Fvs, single-chain Fvs (scFv), disulfide-linked Fvs (scIFv), fragments comprising either a VI, or VH domain, fragments produced by a Fab expression library, and anti-idiotypic (anti-Id) antibodies (including.
e.g., anti-Id antibodies to anti-SEMA4D antibodies disclosed herein). ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019. Immunoglobulin or antibody molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG I, IgG2, IgG3, IgG4, IgAl , and IgA2, etc.), or subclass of immunoglobulin molecule.
100381 As used herein, the term "heavy chain portion" includes amino acid sequences derived from an immunoglobulin heavy chain. In certain embodiments, a polypeptide comprising a heavy chain portion comprises at least one of: a VH domain, a CHI domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof. For example, a binding polypeptide for use in the invention may comprise a polypeptide chain comprising a CHI domain; a polypeptide chain comprising a CHI domain, at least a portion of a hinge domain, and a CH2 domain;
a polypeptide chain comprising a CHI domain and a CII3 domain; a polypeptide chain comprising a CH1 domain, at least a portion of a hinge domain, and a CH3 domain, or a polypeptide chain comprising a CHI domain, at least a portion of a hinge domain, a CH2 domain. and a CH3 domain. In another embodiment, a polypeptide of the invention comprises a polypeptide chain comprising a CH3 domain. Further, a binding polypeptide for use in the invention may lack at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). As set forth above, it will be understood by one of ordinary skill in the art that these domains (e.g., the heavy chain portions) may be modified such that they vary in amino acid sequence from the naturally occurring immunoglobulin molecule.
[0039J In certain anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein, the heavy chain portions of one polypeptide chain of a multimer are identical to those on a second polypeptide chain of the multhner.
Alternatively, heavy chain portion-containing monomers of the invention are not identical. For example, each monomer may comprise a different target binding site, forming, for example, a bispecific antibody.
100401 The heavy chain portions of a binding molecule for use in the methods disclosed herein may be derived from different immunoglobulin molecules. For example, a heavy chain portion of a polypeptide can comprise a CHI domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule. In another example, a heavy chain portion can comprise a hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. In another example, a heavy chain portion can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.
100411 As used herein, the term "light chain portion" includes amino acid sequences derived from an immunoglobulin light chain, e.g., a kappa or lambda light chain.
Preferably, the light chain portion comprises at least one of a VL or CL domain.
100421 Anti-SEMA4D or anti-VEGF antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein may be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polypeptide disclosed herein (e.g., SEMA4D or VEGF) that they recognize or specifically bind. The portion of a target polypeptide that specifically interacts with the antigen binding domain of an antibody is an "epitope," or an "antigenic determinant." A target polypeptide can comprise a single epitope. but typically comprises at least two epitopes, and can include any number of epitopes, depending on the size, conformation, and type of antigen.
Furthermore, it should be noted that an "epitope" on a target polypeptide may be or may include non-polypeptide elements, e.g., an epitope may include a carbohydrate side chain.
100431 The minimum size of a peptide or polypeptide epitope for an antibody is thought to be about four to five amino acids. Peptide or polypeptide epitopes preferably contain at least seven, more preferably at least nine and most preferably between at least about 15 to about 30 amino acids. Since a CDR can recognize an antigenic peptide or polypeptide in its tertiary form, the amino acids comprising an epitope need not be contiguous, and in some cases, may not even be on the same peptide chain. A peptide or polypeptide epitope recognized by anti-SEMA4D antibodies of the present invention may contain a sequence of at least 4, at least 5, at least 6, at least 7, more preferably at least 8, at least 9, at least
10, at least 15, at least 20, at least 25, or between about 15 to about 30 contiguous or non-contiguous amino acids of SEMA4D or VEGF.
[0044] By "specifically binds," it is generally meant that an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind" to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term "specificity" is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody "A" may be deemed to have a higher specificity for a given epitope than antibody "B," or antibody "A" may be said to bind to epitope "C" with a higher specificity than it has for related epitope "D."
[0045] By "preferentially binds," it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
'Thus, an antibody that "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
[0046] By way of non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds said first epitope with a dissociation constant (1(0) that is less than the antibody's K0 for the second epitope. In another non-limiting example, an antibody may be considered to bind a first antigen preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's KU
for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's KID for the second epitope.
[0047] In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an off rate (k(off)) that is less than the antibody's k(off) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's k(off) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's k(off) for the second epitope.
100481 An antibody is said to competitively inhibit binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope. Competitive inhibition may be determined by any method known in the art, for example, competition ELISA
assays. An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
[0049] As used herein, the term "affinity" refers to a measure of the strength of the binding of an individual epitope with the CDR of an immunoglobulin molecule. See, e.g., Harlow et al.
(1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 2nd ed.) pages 27-28. As used herein, the term "avidity" refers to the overall stability of the complex between a population of immunoglobulins and an antigen, that is, the functional combining strength of an immunoglobulin mixture with the antigen. See, e.g., Harlow at pages 29-34. Avidity is related to both the affinity of individual immunoglobulin molecules in the population with specific epitopes, and also the valencies of the immunoglobulins and the antigen. For example, the interaction between a bivalent monoclonal antibody and an antigen with a highly repeating epitope structure, such as a polymer, would be one of high avidity.
[0050] Anti-SEMA4D and anti-VEGF antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention may also be described or specified in terms of their cross-reactivity. As used herein, the term "cross-reactivity" refers to the ability of an antibody, specific for one antigen, to react with a second antigen; a measure of relatedness between two different antigenic substances. Thus, an antibody is cross reactive if it binds to an epitope other than the one that induced its formation. The cross reactive epitope generally contains many of the same complementary structural features as the inducing epitope, and in some cases, may actually fit better than the original.
[0051] For example, certain antibodies have some degree of cross-reactivity, in that they bind related, but non-identical epitopes, eg, epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be said to have little or no cross-reactivity if it does not bind epitopes with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be deemed "highly specific" for a certain epitope, if it does not bind any other analog, ortholog, or homolog of that epitope.
10052] Anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or antigen-binding fragments, variants or derivatives thereof, of the invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention, e.g., SEMA4D or VEGF, e.g., human, murine, or both human and murine SEMA4D or VEGF.
Preferred binding affinities include those with a dissociation constant or Kd less than 5 x 10-2 M, 1012 M, 5 x 10-3 M, 10-3 M, 5 x 10-4 M, 10-4 M, 5 x 10-5 M, 10-5 M, 5 x l0 M, 10-M, 5 x i0 TA, I0 M, 5 x 10-8 M, 1(18 M, 5 x 10-9 M, 10-9 M, 5 x 100 M, 100 M, 5 x 10-" M, 10-11M, 5 x 102 M, 10-12M, 5 x 10-13M, 10-13M, 5 x 10-14 M, 10-14 M, 5 x 10-15 M, or 10-15 M. In certain embodiments, the anti-SEMA4D binding molecule, e.g., an antibody or antigen binding fragment thereof, of the invention binds human SEMA4D or VEGF with a Kd of about 5 x 10-9 to about 6 x 10-9. In another embodiment, the anti-SEMA4D or VEGF binding molecule, e.g., an antibody or antigen binding fragment thereof, of the invention binds murine SEMA4D or VEGF with a Kd of about 1 x 10-9 to about 2 x 1 0-9.
100531 As used herein, the term "chimeric antibody" will be held to mean any antibody wherein the immunoreactive region or site is obtained or derived from a first species and the constant region (which may be intact, partial or modified in accordance with the instant invention) is obtained from a second species. In preferred embodiments the target binding region or site will be from a non-human source (e.g., mouse or primate) and the constant region is human.
[0054] As used herein, the term "engineered antibody" refers to an antibody in which the variable domain in either the heavy or light chain or both is altered by at least partial replacement of one or more CDRs from an antibody of known specificity and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs may be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and preferably from an antibody from a different species. An engineered antibody in which one or more "donor" CDRs from a non-human antibody of known specificity is grafted into a human heavy or light chain framework region is referred to herein as a "humanized antibody." It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable domain to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the target binding site.
100551 It is further recognized that the framework regions within the variable domain in a heavy or light chain, or both, of a humanized antibody may comprise solely residues of human origin, in which case these framework regions of the humanized antibody are referred to as "fully human framework regions" (for example, MAb VX15/2503, disclosed in U.S.
Patent Appl. Publication No. US 2010/0285036 Al as MAb 2503).
Alternatively, one or more residues of the framework region(s) of the donor variable domain can be engineered within the corresponding position of the human framework region(s) of a variable domain in a heavy or light chain, or both, of a humanized antibody if necessary to maintain proper binding or to enhance binding to the SEMA4D antigen. A human framework region that has been engineered in this manner would thus comprise a mixture of human and donor framework residues, and is referred to herein as a "partially human framework region."
[0056] For example, humanization of an anti-SEMA4D antibody can be essentially performed following the method of Winter and co-workers (Jones etal., Nature 321:522-525 (1986);
Riechmannet al., Nature 332:323-327 (1988); Verhoeyenet al., Science 239:1534-(1988)), by substituting rodent or mutant rodent CDRs or CDR sequences for the coriesponding sequences of a human anti-SEMA4D antibody. See also U.S. Pat.
Nos.
5,225,539; 5,585,089; 5,693,761; 5,693,762; 5,859,205.
The resulting humanized anti-SEMA4D antibody would comprise at least one rodent or mutant rodent CDR within the fully human framework regions of the variable domain of the heavy and/or light chain of the humanized antibody. In some instances, residues within the framework regions of one or more variable domains of the humanized anti-SEMA4D antibody are replaced by corresponding non-human (for example, rodent) residues (see, for example, U.S. Pat. Nos. 5,585,089; 5,693,761; 5,693,762;
and 6,180,370), in which case the resulting humanized anti-SEMA4D antibody would comprise partially human framework regions within the variable domain of the heavy and/or light chain. Similar methods can be used for humanization of an anti-VEGF
antibody.
[0057] Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance (e.g., to obtain desired affinity). In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fe), typically that of a human immunoglobulin. For further details see Jones et al., Nature 33/:522-525 (1986);
Riechmannet al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct.
Biol. 2:593-596 (1992).
Accordingly, such "humanized" antibodies may include antibodies wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
In practice, humanized antibodies are typically human antibodies in which some CDR
residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies. See, for example, U.S. Pat. Nos.
5,225,539;
5,585,089; 5,693,761; 5,693,762; 5,859,205. See also U.S. Pat. No. 6,180,370, and International Publication No. WO 01/27160, where humanized antibodies and techniques for producing humanized antibodies having improved affinity for a predetermined antigen are disclosed.
II. Target Polypeptide Description ¨ SEMA4D
[0058] As used herein, the terms "semaphorin-4D," "SEMA4D" and "SEMA4D
polypeptide'' are used interchangeably, as are ''SEMA4D" and "Sema4D." In certain embodiments, SEMA4D is expressed on the surface of or secreted by a cell. In another embodiment, SEMA4D is membrane bound. In another embodiment, SEMA4D is soluble, e.g., sSEMA4D. In another embodiment, SEMA4D may include a full-sized SEMA4D or a fragment thereof, or a SEMA4D variant polypeptide, wherein the fragment of , or SEMA4D variant polypeptide retains some or all functional properties of the full-sized SEMA4D.
100591 The full-sized human SEMA4D protein is a homodimerictransmembrane protein consisting of two polypeptide chains of 150 kDa. SEMA4D belongs to the semaphorin family of cell surface receptors and is also referred to as CD100. Both human and mouse SEMA4D/Sema4D are proteolytically cleaved from their transmembrane form to generate 120-kDa soluble forms, indicating the existence of two Sema4D
isoforms (Kumanogohet al., I Cell Science 1/6(7):3464 (2003)). Semaphorins consist of soluble and membrane-bound proteins that were originally defined as axonal-guidance factors which play an important role in establishing precise connections between neurons and their appropriate target. Structurally considered a class IV semaphorin, consists of an amino-terminal signal sequence followed by a characteristic 'Sema"
domain, which contains 17 conserved cysteine residues, an Ig-like domain, a lysine-rich stretch, a hydrophobic transmembrane region, and a cytoplasmic tail.
100601 Each polypeptide chain of SEMA4D includes a signal sequence of about 13 amino acids followed by a semaphorin domain of about 512 amino acids, an immunoglobulin-like (1g-like) domain of about 65 amino acids, a lysine-rich stretch of 104 amino acids, a hydrophobic transmembrane region of about 19 amino acids, and a cytoplasmic tail of 110 amino acids. A consensus site for tyrosine phosphorylation in the cytoplasmic tail supports the predicted association of SEMA4D with a tyrosine kinase (Sehlossman, et al., Eds. (1995) Leucocyte Typing V (Oxford University Press, Oxford).
100611 SEMA4D is known to have at least two functional receptors. One of the receptors, Plexin-B1, is expressed in non-lymphoid tissues and has been shown to be a high affinity (1 nM) receptor for SEMA4D (Tamagnoneet al., Cell 99:71-80 (1999)). SEMA4D
stimulation of Plexin B1 signaling has been shown to induce growth cone collapse of ncurons, and to induce process extension collapse and apoptosis of oligodendrocytes (Giraudonet al., J. Immunol. /72:1246-1255 (2004); Giraudonet al., NeuroMolecular Med. 7:207-216 (2005)). After binding to SEMA4D, Plexin B1 signaling mediates the inactivation of R-Ras, leading to a decrease in the integrin mediated attachment to the extracellular matrix, as well as to activation of RhoA, leading to cell collapse by reorganization of the cytoskeleton. See Kruger et al., Nature Rev. Mol. Cell Biol. 6:789-800 (2005); Pasterkamp, TRENDS in Cell Biology /5:61-64 (2005)).
100621 In lymphoid tissues, CD72 is utilized as a low affinity (300nM) SEMA4D
receptor (Kumanogohet aL, Immunity /3:621-631 (2000)). B cells and Antigen Presenting Cells (APC) express CD72, and anti-CD72 antibodies have many of the same effects as sSEMA4D, such as enhancement of CD40-induced B cell responses and B cell shedding of CD23. CD72 is thought to act as a negative regulator of B cell responses by recruiting the tyrosine phosphatasc SHP-I, which can associate with many inhibitory receptors.
Interaction of SEMA4D with CD72 results in the dissociation of SHP-1, and the loss of this negative activation signal. SEMA4D has been shown to promote T cell stimulation and B cell aggregation and survival in vitro. The addition of SEMA4D-expressing cells or sSEMA4D enhances CD40-induced B cell proliferation and immunoglobulin production in vitro, and accelerates in vivo antibody responses (Ishida et al., Inter.
Immunol. /5:1027-1034 (2003); Kumanogoh and H. Kukutani, Trends in Immunol.
22:670-676 (2001)). sSEMA4D enhances the CD40 induced maturation of DCs, including up-regulation of costimulatory molecules and increased secretion of IL-12. In addition, sSEMA4D can inhibit immune cell migration, which can be reversed by addition of blocking anti-SEMA4D mouse antibodies (Elhabaziet al.. J. Immunol.
166:4341-4347 (2001); Delaireet al., J. Immunol. 166:4348-4354 (2001)).
[0063] Sema4D is expressed at high levels in lymphoid organs, including the spleen, thymus, and lymph nodes, and in non-lymphoid organs, such as the brain, heart, and kidney.
In lymphoid organs, Sema4D is abundantly expressed on resting T cells but only weakly expressed on resting B cells and antigen-presenting cells (APCs), such as dendritic cells (DCs).
[00641 Cellular activation increases the surface expression of SEMA4D as well as the generation of soluble SEMA4D (sSEMA4D). The expression pattern of SEMA4D suggests that it plays an important physiological as well as pathological role in the immune system.
SEMA4D has been shown to promote B cell activation, aggregation and survival;
enhance CD40-induced proliferation and antibody production; enhance antibody response to T cell dependent antigens; increase T cell proliferation; enhance dendritic cell maturation and ability to stimulate T cells; and is directly implicated in demyelination and axonal degeneration (Shi et al., Immunity /3:633-642 (2000); Kumanogohet al., J
Immunol 169:1175-1181(2002); and Watanabe et al., J Immunol 167:432 1-4328 (2001)).
10065] SEMA4D knock out (SEMA4D-/-) mice have provided additional evidence that SEMA4D plays an important role in both humoral and cellular immune responses.
There are no known abnormalities of non-lymphoid tissues in SEMA4D-/- mice.
Dendritic cells (DCs) from the SEMA4D-/- mice have poor allostimulatory ability and show defects in expression of costimulatory molecules, which can be rescued by the addition of sSEMA4D. Mice deficient in SEMA4D (SEMA4D-/-) fail to develop experimental autoimmune encephalomyelitis induced by myelin oligodendrocyte glycoprotein peptide, because myelin oligodendrocyte glycoprotein-specific T cells are poorly generated in the absence of SEMA4D (Kumanogohet al., J Immunol 169:1175-1181 (2002)). A
significant amount of soluble SEMA4D is also detected in the sera of autoimmunity-prone MRL/lpr mice (model of systemic autoimmune diseases such as SLE), but not in normal mice. Further, the levels of sSEMA4D correlate with levels of auto-antibodies and increase with age (Wang et al., Blood 97:3498-3504 (2001)). Soluble SEMA4D
has also been shown to accumulate in the cerebral spinal fluid and sera of patients with demyelinating disease, and sSEMA4D induces apoptosis of human pluripotent neural precursors (Dev cells), and both inhibits process extension and induces apoptosis of rat oligodendrocytesin vitro (Giraudonet al., J Immunol 172(2):1246-1255 (2004)).
This apoptosis was blocked by an anti-SEMA4D monoclonal antibody (MAb).
III. Anti-SEMA4D Antibodies 10066] Antibodies that bind SEMA4D have been described in the art. See, for example, US
Publ. Nos. 2008/0219971 Al, US 2010/0285036 Al, and US 2006/0233793 Al, International Patent Applications WO 93/14125, WO 2008/100995, and WO
2010/129917, and Heroldet al.,Int. Immunol. 7(1): 1-8 (1995).
[006711 The invention generally relates to a method of inhibiting angiogenesis in a subject, e.g., a human cancer patient or a patient with wet age-related macular degeneration (AMD), comprising administration of an antibody which specifically binds to SEMA4D, or an antigen-binding fragment, variant, or derivative thereof. In certain embodiments, the antibody blocks the interaction of SEMA4D with one or more of its receptors, e.g., Plexin-Bl. In certain embodiments the cancer cells express Plexin-B1. Anti-antibodies having these properties can be used in the methods provided herein.
Antibodies that can be used include, but are not limited to MAbs VX15/2503, 67, and 76 =
and antigen-binding fragments, variants, or derivatives thereof which are fully described in US 2010/0285036 Al. Additional antibodies which can be used in the methods provided herein include the BD16 antibody described in US 2006/0233793 Al as well as antigen-binding fragments, variants, or derivatives thereof; or any of MAb 301, MAb 1893, MAb 657, MAb 1807, MAb 1656, MAb 1808, Mab 59. MAb 2191, MAb 2274, MAb 2275, MAb 2276, MAb 2277, MAb 2278, MAb 2279, MAb 2280, MAb 2281, MAb 2282, MAb 2283, MAb 2284, and MAb 2285, as well as any fragments, variants or derivatives thereof as described in US 2008/0219971 Al. In certain embodiments an anti-SEMA4D antibody for use in the methods provided herein binds human, murine, or both human and murine SEMA4D. Also useful are antibodies which bind to the same epitope as any of the aforementioned antibodies and/or antibodies which competitively inhibit binding or activity of any of the aforementioned antibodies.
[0068] In certain embodiments, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein has an amino acid sequence that has at least about 80%, about 85%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95% sequence identity to the amino acid sequence for a reference anti-SEMA4D antibody molecule, for example those described above. In a further embodiment, the binding molecule shares at least about 96%, about 97%, about 98%, about 99%, or 100% sequence identity to a reference antibody.
100691 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%. about 98%. about 99%, or identical to CDR1, CDR2 or CDR3 of SEQ ID NO: 9 or 10.
100701 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or identical to SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
100711 In another embodiment. an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VII domain), where at least one of the CDRs of the VH domain has an amino acid sequence identical, except for 1, 2, 3, 4, or 5 conservative amino acid substitutions, to SEQ ID NO: 6, SEQ ID
NO: 7, or SEQ
ID NO: 8.
100721 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of a VH domain that has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to SEQ ID NO: 9 or SEQ
ID
NO: 10, wherein an anti-SEMA4D antibody comprising the encoded VH domain specifically or preferentially binds to SEMA4D.
100731 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%. about 99%, or identical to CDR], CDR2 or CDR3 of SEQ ID NO: 17 or 18.
10074] In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or identical to SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16.
[0075] In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence identical, except for 1,2, 3, 4, or 5 conservative amino acid substitutions, to SEQ ID NO: 14, SEQ
ID NO: 15, or SEQ ID NO: 16.
[0076] In a further embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of a VL domain that has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to SEQ ID NO: 17 or SEQ ID
NO: 18, wherein an anti-SEMA4D antibody comprising the encoded VL domain specifically or preferentially binds to SE1VIA4D.
[00771 Also included for use in the methods provided herein are polypeptides encoding anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof as described herein, polynucleotides encoding such polypeptides, vectors comprising such polynucleotides, and host cells comprising such vectors or polynucleotides, all for producing anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof for use in the methods described herein.
10078] Suitable biologically active variants of the anti-SEMA4D antibodies of the invention can be used in the Methods of the present invention. Such variants will retain the desired binding properties of the parent anti-SEMA4D antibody. Methods for making antibody variants are generally available in the art.
[00791 Methods for mutagenesis and nucleotide sequence alterations are well known in the art.
See, for example, Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York); Kunkel, Proc. Natl. Acad. Sci. USA
82:488-492 (1985); Kunkel et al., Methods Enzymol. /54:367-382 (1987);
Sambrooket al.
(1989) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor, N.Y.); U.S.
Pat.
No. 4,873,192; and the references cited therein.
Guidance as to appropriate amino acid substitutions that do not affect biological activity of the polypeptide of interest may be found in the model of Dayhoffet al.
(1978) in Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), pp.
345-352. The model of Dayhoffet al. uses the Point Accepted Mutation (PAM) amino acid similarity matrix (PAM 250 matrix) to determine suitable conservative amino acid substitutions. Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be preferred.
Examples of conservative amino acid substitutions as taught by the PAM 250 matrix of the Dayhoffet al. model include, but are not limited to, Gly<-4A1a, Val4¨*Ile4-+Leu, Asp4-+G1u, Lys4-0,.rg, Asn4-+Gln, and Phe4¨;frpl--Jyr.
[0080] In constructing variants of the anti-SEMA4D binding molecule, e.g., an antibody or antigen-binding fragment thereof, polypeptides of interest, modifications are made such that variants continue to possess the desired properties, e.g., being capable of specifically binding to a SEMA4D, e.g., human, murine, or both human and murine SEMA4D, expressed on the surface of or secreted by a cell and having SEMA4D blocking activity, as described herein. Obviously, any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See EP
Patent Application Publication No. 75,444.
[0081] Methods for measuring anti-SEMA4D binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, binding specificity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobulin secretion by T cells or B cells, T cell proliferation assays, apoptosis assays, ELISA
assays, and the like. See, for example, such assays disclosed in WO 93/14125;
Shi et al., Immunity /3:633-642 (2000); Kumanogohet al., J Immunol /69:1175-1181 (2002);
Watanabe et al., J Immunol /67:4321-4328 (2001); Wang et al., Blood 97:3498-(2001); and Giraudonet al., J Immunol I72(2):1246-1255 (2004).
[0082] Methods for measuring the anti-angiogenic ability of an anti-SEMA4D
antibody or antigen-binding fragment, variant, or derivative thereof are describe herein and are also well known in the art.
[0083] When discussed herein whether any particular polypeptide, including the constant regions, CDRs, VH domains, or VL domains disclosed herein, is at least about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or even about 100% identical to another polypeptide, the % identity can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis.
53711).
BESTFIT uses the local homology algorithm of Smith and Waterman (1981) Adv.
Appl.
Math. 2:482-489, to find the best segment of homology between two sequences.
When using BESTFIT or any other sequence alignment program to determine whether a particular sequence is, for example, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
[0084] For purposes of the present invention, percent sequence identity may be determined using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. The Smith-Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv.
App!. Math. 2:482-489. A variant may, for example, differ from a reference anti-SEMA4D antibody (e.g.. MAb VX15/2503, 67 or 76) by as few as 1 to 15 amino acid residues, as few as 1 to 10 amino acid residues, such as 6-10, as few as 5, as few as 4, 3, 2, or even 1 amino acid residue.
[0085] The constant region of an anti-SEMA4D antibody can be mutated to alter effector function in a number of ways. For example, see U.S. Pat. No. 6,737,056B1 and U.S.
Patent Application Publication No. 2004/0132101A1, which disclose Fe mutations that optimize antibody binding to Fe receptors.
[0086] In certain anti-SEMA4D antibodies or fragments, variants or derivatives thereof useful in the methods provided herein, the Fe portion can be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fe receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases, constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half-life. Yet other modifications of the constant region can be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. The resulting physiological profile, bioavailability and other biochemical effects of the modifications, such as tumor localization, biodistribution and serum half-life, can easily be measured and quantified using well known immunological techniques without undue experimentation.
10087] Anti-SEMA4D antibodies for use in the methods provided herein include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate cpitope. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by Llycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular liganci or other protein, etc. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, etc.
Additionally, the derivative can contain one or more non-classical amino acids.
10088] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e g the ability to bind an anti-SEMA4D polypeptide, to block SEMA4D interaction with its receptor, or to inhibit angiogenesis in a subject. e.g., a cancer patient).
100891 For example, it is possible to introduce mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations can be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen.
These types of mutations can be useful to optimize codon usage, or improve a hybridoma's antibody production. Alternatively, non-neutral missense mutations may alter an antibody's ability to bind antigen. One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity). Following mutagenesis, the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of a polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
[0090] In certain embodiments, the anti-SEMA4D antibodies for use in the methods provided herein comprise at least one optimized complementarity-determining region (CDR). By "optimized CDR" is intended that the CDR has been modified and optimized to improve binding affinity and/or anti-SEMA4D activity that is imparted to an anti-antibody comprising the optimized CDR. "Anti-SEMA4D activity" or "SEMA4D
blocking activity" can include activity which modulates one or more of the following activities associated with SEMA4D: B cell activation, aggregation and survival; CD40-induced proliferation and antibody production; antibody response to T cell dependent antigens; T cell or other immune cell proliferation; dendritic cell maturation;
demyelination and axonal degeneration; apoptosis of pluripotent neural precursors and/or oligodendrocytes; induction of endothelial cell migration; inhibition of spontaneous monocyte migration; inhibition of tumor cell metastasis, binding to cell surface plexin B1 or other receptor, or any other activity association with soluble SEMA4D or that is expressed on the surface of SEMA4D+ cells. In a particular embodiment, anti-SEMA4D activity includes the ability to inhibit tumor angiogenesis, either in combination with inhibition of primary tumor cell growth and tumor metastases, or independently of primary tumor cell growth and tumor metastases. Anti-SEMA4D activity can also be attributed to a decrease in incidence or severity of diseases associated with expression, including, but not limited to, certain types of cancers including lymphomas, autoimmune diseases, inflammatory diseases including central nervous system (CNS) and peripheral nervous system (PNS) inflammatory diseases, transplant rejections, and invasive angiogenesis. Examples of optimized antibodies based on murine anti-MAb BD16 were described in US Publ. No. 2008/0219971 Al, International Patent Application W093/14125 and Heroldet al., Int. Immunol, 7(1): 1-8 (1995).
The modifications may involve replacement of amino acid residues within the CDR such that an anti-SEMA4D
antibody retains specificity for the SEMA4D antigen and has improved binding affinity and/or improved anti-SEMA4D activity.
IV. Target Polypeptide Description - VEGF
[0091] As used herein, the terms "VEGF" and "VEGF polypeptide" are used interchangeably. In certain embodiments, VEGF is secreted by a cell. In another embodiment, VEGF
is membrane-bound or bound to the extracellular matrix. In another embodiment, VEGF is soluble. In other embodiments, VEGF may include a full-sized VEGF polylpeptide or a fragment thereof, or a VEGF variant polypeptide (including VEGF isoforms and splice variants), wherein the fragment of VEGF or VEGF variant polypeptide retains some or all functional properties of the full-sized, native VEGF.
[0092] The full-sized, native human VEGF protein is a homodimeric glycoprotein consisting of two identical 23 kDa polypeptide subunits. See, Ho and Kuo, Int. .1 Biochem Cell Biol.
2007; 39(7-8): 1349-1357. The VEGF gene family has several members, including VEGF-A (also referred to herein as "VEGF"), VEGF-B, VEGF-C, VEGF-D. and PI GF.
See, Ho and Kuo, Int. .1 Biochem Cell Biol. 2007; 39(7-8): 1349-1357. There are numerous alternatively spliced isoforms of human VEGF, including VEGF165, VEGFizi, VEGF189, and VEGF106, which have different bioavailabilities, bioactivities, and receptor specificities. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357:
Ferraraet al., Nature Med. 2003; 9 (6):669-676. The VEGF165 isofonn is the most prevalent and mitogenic and is most similar in properties to the 45kDa native VEGF. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357; Ferraraet al., Nature Med. 2003; 9 (6):669-676.
[0093] VEGF expression and activity is modulated by a number of factors, including hypoxia, mechanical forces, dysregulation of tumor suppressors and oncogenes, inflammatory mediators (e.g., cytokines), and other growth factors. See, Ho and Kuo, hit.
J. Biochetn Cell Biol. 2007; 39(7-8): 1349-1357. Once expressed, some secreted VEGF is sequestered by the extracellular matrix, which can act as a reservoir that releases VEGF
through proteolysis. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357.
[0094] VEGF binds two receptor tyrosine kinases with high affinity--VEGFR1 (Flt-1) and VEGFR2 (KDR, FlkI)--which are found mainly on the surface of vascular endothelial cells. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680. It is thought that only VEGFR-2 activation induces angiogenesis, mitogenesis, and increased vascular permeability through a process of autophosphorylation that activates downstream signaling pathways such as phosphatidylinositol 3'-OH kinase/Akt. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680. VEGFR1 is thought to act as a decoy receptor that suppresses the availability of VEGF to VEGFR2, and may be important in hematopoiesis, matrix metalloproteinase development, and release of growth factors from endothelial cells. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
[0095] Antagonism of VEGF with monoclonal antibodies has been shown to inhibit primary tumor growth, primarily by disrupting the blood supply to tumors and to inhibit tumor angiogenesis. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
[0096] For reviews related to VEGF and VEGF inhibition, see Ferrara, Nature Reviews 2002; 2:
795-803; Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357;
Ferrara, et al., Nature Med. 2003; 9:669-676; Pander et al., Drug Discovery Today 2007;
12: 1054-1060; Hicklin and Ellis, J. Clin, Oncol. 2005; 5:1011-1027; and Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
V. Anti-VEGF Antibodies [0097] Antibodies that bind VEGF have been described the art. See, for example, US Pat. No.
6,884,879 and Prestaet al.,Cancer Res. 57: 4593-4599 (1997).
[0098] The invention generally relates to a method of inhibiting angiogenesis in a subject, e.g., a human cancer patient, comprising administration of an antibody which specifically binds to VEGF or its VEGFR2 receptor, or an antigen-binding fragment, variant, or derivative thereof. In certain embodiments, the antibody blocks the interaction of VEGF
with one or more of its receptors, e.g., VEGFR1 and VEGFR2. Anti-VEGF antibodies having these properties can be used in the methods provided herein.
[0099] The antibodies according to the invention comprise anti-VEGF or anti-antibodies or antigen-binding fragments, variants, or derivatives thereof that bind to VEGF or its VEGFR2 receptor, e.g., MAb 7392 as described herein, and in International Patent Appl. No. PCT/US2011/040361.
In certain embodiments the anti-VEGF antibodies bind human VEGF. In other embodiments, the anti-VEGF antibodies block VEGF binding to its receptor, e.g., VEGFR I or VEGFR2. In certain embodiments, the anti-VEGF or anti-VEGFR2 antibodies block phosphorylation of VEGFR2 by VEGF.
[0100] In one embodiment, the present invention provides an isolated binding molecule, e.g., an antibody or antigen binding fragment thereof, which specifically binds to the same VEGF
epitope as MAb7392. In another embodiment, the present invention provides an isolated binding molecule, e.g., an antibody or antigen binding fragment thereof that specifically binds to VEGF, and competitively inhibits MAb 7392 from specifically binding to VEGF.
In certain embodiments, the antibody specifically binds VEGF with an affinity of less than about 3.9 x 10-9 M. In another embodiment, the antibody specifically binds VEGF
with an affinity of less than about 9.1 x 10-10 M.
[0191] In one embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is identical to CDR I, CDR2 or CDR3 of SEQ ID NO:41.
[0102] In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is identical to SEQ ID
NO: 43, SEQ ID NO: 44, or SEQ ID NO: 45.
101031 In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH
domain that has an amino acid sequence that is identical to SEQ ID NO:41, wherein an anti-VEGF antibody comprising the encoded VH domain specifically or preferentially binds to VEGF, more specifically, human VEGF.
[0104] In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is identical to CDR I, CDR2 or CDR3 of SEQ ID NO:42.
101051 In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is identical to SEQ ID
NO:46, SEQ ID NO: 47, or SEQ ID NO:48.
[0106] In a further embodiment, the present invention includes an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL
domain that has an amino acid sequence that is identical to SEQ ID NO:42, wherein an anti-VEGF antibody comprising the encoded VL domain specifically or preferentially binds to VEGF, more specifically, human VEGF.
[0107] Polypeptide sequences of the anti-VEGF antibodies or antigen binding molecules thereof including the following:
[0108] The 1-17230 and L7104 variable regions thathave the following amino acid sequences (CDRs are underlined):
[0109] H7230 (SEQ ID NO:41):
QVQLVQSGAELRKPGASVKI SCKASGYSLTYYGMNWVRQAPGQGLEWMG
WINTFTGDSTYAQDFTGRFVFSLDTSVSTAYLQI SSLKAEDMAMYYCAK
YPHYYGSSHWYFDVWGQGTTVTVSS
L7104 (SEQ ID NO:42):
EIVLTQSPATLSVS PGERATL S CRASQSVNSNLAWYQQKPGQAPRVL Y
GASTRATGIPARFSGSGSGTE FTLT IS SLQSEDEAVYYCQQYSDIPWTF
GQGT KLE K
[01101 The CDRs of MAb 7392 (comprising H7230 and L7104 variable regions) thathave the following amino acid sequences:
VH-CDR1 (SEQ ID NO:43):
GYSLTYYGMN
VH-CDR2 (SEQ ID NO:44):
WINTFTGDSTYAQDFTG
VH-CDR3 (SEQ ID NO:45):
YEHYYGSSHWYF DV
VL-CDR I (SEQ ID NO:46):
RASQSVNSNLA
VL-CDR2 (SEO ID NO:47):
GASTRAT
VL-CDR3 (SEO II) NO:48):
QQYSD I PWT
[01111 Suitable biologically active variants of the anti-VEGF antibodies of the invention can be used in the methods of the present invention. Such variants will retain the desired binding properties of the parent anti-VEGF antibody. Methods for making antibody variants are generally available in the art.
[0112] Methods for mutagenesis and nucleotide sequence alterations are well known in the art.
See, for example, Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York); Kunkel, Proc. Natl. Acad. Sc!. USA
82:488-492 (1985); Kunkel et at, Methods Enzymot /54:367-382 (1987);
Sambrooket al.
(1989) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor, N.Y.); U.S.
Pat.
No. 4,873,192; and the references cited therein.
Guidance as to appropriate amino acid substitutions that do not affect biological activity of the polypeptide of interest may be found in the model of Dayhoffet al.
(1978) in Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), pp.
345-352, herein incorporated by reference in its entirety. The model of Dayhoffet al. uses the Point Accepted Mutation (PAM) amino acid similarity matrix (PAM 250 matrix) to determine suitable conservative amino acid substitutions. Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be preferred.
Examples of conservative amino acid substitutions as taught by the PAM 250 matrix of the Dayhoffet al. model include, but are not limited to, Glyi-,Ala, Asp4-)-Glu, Lysi-,Arg, Asni-Gln, and Phe4--)Trp4-Jyr. Modifications are made such that variants continue to possess the desired properties, e.g., being capable of specifically binding to a VEGF, more specifically, human VEGF, e.g., secreted by a cell or attached by a membrane or extracellular matrix component and having VEGF blocking activity, as described herein. Any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See EP Patent Application Publication No. 75,444.
[0113] Methods for measuring anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment thereof, binding specificity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobulin secretion by T cells or B
cells, T
cell proliferation assays, apoptosis assays, ELISA assays, and the like. See, for example, such assays disclosed in WO 93/14125; Shi el al., Immunity /3:633-642 (2000);
Kumanogohet al., J Immunol /69:1175-1181 (2002); Watanabe et al., J Immunol /67:4321-4328 (2001); Wang et al., Blood 97:3498-3504 (2001); and Giraudonet al., J
Immunol 172(2):1246-1255 (2004).
[0114] The % identity of a polypeptide discussed herein can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT
program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711).
BESTFIT
uses the local homology algorithm of Smith and Waterman (1981) Adv. App!.
Math.
2:482-489, to find the best segment of homology between two sequences. When using BESTFIT or any other sequence alignment program to determine whether a particular sequence is, for example, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
[0115] For purposes of the present invention, percent sequence identity may be determined using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. The Smith-Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv.
App!. Math. 2:482-489. A variant may, for example, differ from a reference anti-VEGF
antibody (e.g, 1VIAb 7392, comprising the variable region sequences of SEQ ID
NO:41 and SEQ ID NO:42) by 5 or fewer amino acid residues, e.g., in the light or heavy chain framework regions.
[0116] The precise chemical structure of a polypeptide capable of specifically binding VEGF and retaining the desired VEGF blocking activity depends on a number of factors.
As ionizable amino and carboxyl groups are present in the molecule, a particular polypeptide may be obtained as an acidic or basic salt, or in neutral form. All such preparations that retain their biological activity when placed in suitable environmental conditions are included in the definition of anti-VEGF antibodies as used herein. Further, the primary amino acid sequence of the polypeptide may be augmented by derivatization using sugar moieties (glycosylation) or by other supplementary molecules such as lipids, phosphate, acetyl groups and the like. It may also be augmented by conjugation with saccharides.
Certain aspects of such augmentation are accomplished through post-translational processing systems of the producing host; other such modifications may be introduced in vitro. In any event, such modifications are included in the definition of an anti-VEGF
antibody used herein so long as the desired properties of the anti-VEGF
antibody are not destroyed. It is expected that such modifications may quantitatively or qualitatively affect the activity, either by enhancing or diminishing the activity of the polypeptide, in the various assays. Further, individual amino acid residues in the chain may be modified by oxidation, reduction, or other derivatization, and the polypeptide may be cleaved to obtain fragments that retain activity. Such alterations that do not destroy the desired properties (e.g., binding specificity for VEGF, binding affinity, and VEGF
blocking activity) do not remove the polypeptide sequence from the definition of anti-VEGF
antibodies of interest as used herein.
[0117] The art provides substantial guidance regarding the preparation and use of polypeptide variants. In preparing the anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment thereof, variants, one of skill in the art can readily determine which modifications to the native protein's nucleotide or amino acid sequence will result in a variant that is suitable for use as a therapeutically active component of a pharmaceutical composition used in the methods of the present invention.
[0118] The constant region of an anti-VEGF antibody may be mutated to alter effector function in a number of ways. For example, see U.S. Pat. No. 6,737,05681 and U.S.
Patent Application Publication No. 2004/0132101A1, which disclose Fc mutations that optimize antibody binding to Fc receptors.
[0119] In certain anti-VEGF antibodies, the Fc portion may be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region may be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. The resulting physiological profile, bioavailability and other biochemical effects of the modifications, such as tumor localization, biodistribution and serum half-life, may easily be measured and quantified using well known immunological techniques without undue experimentation.
[0120] Anti-VEGF antibodies of the invention also include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate epitope.
For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, etc. Additionally, the derivative may contain one or more non-classical amino acids.
[0121] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid. glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a VEGF polypeptide).
[01221 For example, it is possible to introduce mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations may be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen.
These types of mutations may be useful to optimize codon usage, or improve a hybridoma's antibody production. Alternatively, non-neutral missense mutations may alter an antibody's ability to bind antigen. The location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement. One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity). Following mutagenesis, the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of a VEGF polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
[0123] In certain embodiments, the anti-VEGF antibodies of the invention are generated, e.g., by V-gene replacement. V-gene replacement involves the use of a human monoclonal antibody discover platform, e.g., as described in US 2002-0123057 Al, based on the monoclonal expression of recombinant antibodies in mammalian cells. As described in US 2002-0123057 Al, separate libraries of human heavy and light chain immunoglobulin variable genes have been constructed in a vaccinia virus-based vector by the method of "Trimolecular Recombination."
Plasmid vectors incorporating constant regions of human heavy chain secreted gamma 1, human heavy chain membrane bound gamma 1, or human light chain were constructed to accommodate cloning human Ig variable region gene segments (VI-1, Vic and Vk) in frame. These vectors are based on the plasmid pH5/tk, in which a vaccinia early/late promoter and multiple cloning sites were inserted into the viral tk gene. The multiple cloning sites were modified appropriately in order to clone in a modified Ig secretory signal peptide and the constant regions of yl- secreted or yl- membrane immunoglobulin heavy chains, and x immunoglobulin light chains. The resulting vectors retain unique cloning sites for inserting the VH and Vic variable region genes. Throughout this description Vie is referred to as VL.
[01241 In order to take advantage of the increased diversity generated by random pairing of different heavy and light chains, independent libraries of heavy and light chains were constructed, allowing generation of libraries of sufficient complexity that appropriate VH/VL combinations would occur at a frequency that permits efficient isolation of antibodies with a desired specificity and affinity. The independent assortment of germline V (D) and J segments, as well as the random combinatorial association of VL
and VH, provides substantial diversity. Further diversification occurs during the response to antigen by the process of somatic mutation. To take advantage of all diversification processes, libraries produced from four different human B cell sources can be used: 1) commercially obtained bone marrow-derived mRNA from large donor pools, 2) commercially available peripheral blood B cells isolated from cancer patients 3) commercially available peripheral blood B cells, and Bone Marrow from autoimmune patients (ex. Lupus), and 4) tonsil-derived germinal center B cells. Because heavy and light chains are randomly re-assorted in this system, it is possible to generate novel specificities that are more diverse than those of the antigen-driven B cells from which these V genes derive. Somatic hypermutation in the germinal centers and selection resulting from the disease states of the B cell donors contributes greatly to V gene diversity.
101251 Mammalian cells infected with vaccinia immunoglobulin gene recombinant vectors produce fully functional, bivalent antibodies. As outlined above, Ig-H
libraries have been generated in a vaccinia expression vector that encodes the secretory form of the human gamma 1 heavy chain constant region. Co-infection of cells with these immunoglobulin heavy chain gene libraries and light chain libraries results in expression, assembly and secretion of bivalent IaGI/L antibodies, permitting screening by ELISA. By infecting host cells with multiplicity of infection (moi) 1 for both Ig-H and Ig-L vaccinia recombinants, each cell is on average infected with one Ig-11 and one Ig-L
recombinant vaccinia virus and thus expresses a single monoclonal antibody.
[0126] Hybridoma technology has been used to identify a number of rodent antibodies with specificity, affinity and functional activity towards important drug targets.
For drug development these antibodies are often chimerized or humanized, with the attendant risk of immunogenicity and potential loss of affinity. The V gene replacement strategy has been applied to use of vaecinia virus expressed antibody libraries for conversion of rodent antibodies into fully human or mostly human antibodies.
101271 The concept of V gene replacement in this application is to use a non-human antibody as a template and, through a two-step process, to identify human V genes that can replace the non-human V genes, while still retaining affinity and epitope specificity.
The V gene replacement method is thus an alternative to traditional CDR grafted humanization. This method has several advantages compared to the more traditional humanization methods:
(i) V gene replacement results in the selection of fully human antibodies, while retaining the epitope specificity of the non-human MAb. In principle, these antibodies should have a lower risk of immunogenicity compared to CDR grafted and framework modified antibodies that retain significant amounts of marine sequences.
(ii) V gene replacement results in the selection of multiple antibodies.
This allows for the selection of lead antibodies derived from distinct VII
and VL germline genes with different biochemical properties including CDR sequences, expression levels, pl, etc.
(iii) V gene replacement can result in the selection of antibodies with better affinity and functional activity than the original non-human antibody.
[01281 In the first step of the V gene replacement method, the V genes from the non-human antibody are isolated and engineered to create chimeric heavy and light chains. The non-human Ig-H is paired with a library of human lg-L and screened for specific binding to antigen. This initial selection yields a panel of hybrid antibodies comprising chimeric Ig-H and human Ig-L. The selected human Ig-Ls are then paired with a library of human Ig-H and selected for binding to antigen. Parallel selections can also be carried out starting with the non-human Ig-L to select human Ig-I-I, and then using the selected Ig-H to select human Ig-L. The human Ig-L selected with the chimeric Ig-H, and the human Ig-H
selected with the chimeric Ig-L can also be cross-paired. The end result of these selection strategies is that panels of human antibodies that bind to the same antigen as the original non-human antibody are isolated. In most cases, the selected human antibodies recognize the same epitope as the original non-human antibody. If necessary, the first generation human antibodies can be affinity improved through either additional rounds of V gene replacement, or through mutagenesis 101291 Anti-VEGF antibodies (e.g., MAb 7392) may be selected based on the sustained or improved binding affinity and/or anti-VEGF activity that is imparted to an anti-VEGF
antibody compared to a humanized or murine antibody to VEGF. "Anti-VEGF
activity"
or "VEGF blocking activity" can include activity that modulates one or more of the following activities associated with VEGF: angiogenesis; binding to cell VEGF
receptors, including VEGFR1 and VEGFR2; modulating phosphorylation of VEGFR2; or any other activity association with soluble VEGF or VEGF that is bound, e.g., to the extracellular matrix. Anti-VEGF activity can also be attributed to a decrease in incidence or severity of diseases associated with VEGF expression, including, but not limited to, various types of neoplastic disorders, including solid tumors and hematological malignancies, autoimmune diseases, intraocular diseases, and inflammatory diseases.
Further optimizing modifications may involve replacement of amino acid residues within one or more CDR and/or framework region such that an anti-VEGF antibody retains specificity for the VEGF antigen and has improved binding affinity and/or improved anti-VEGF
activity.
VI. Treatment Methods Using Therapeutic Anti-SEMA4D and Anti-VEGF Antibodies [01301 Methods of the invention are directed to the use of anti-SEMA4D or anti-Plexin-BI and anti-VEGF or anti-VEGFR2 binding molecules, e.g., antibodies, including antigen-binding fragments, variants, and derivatives thereof, to inhibit angiogenesis in a subject in need of such inhibition, i.e., a cancer patient or patient with wet age-related macular degeneration (AMD). Though the following discussion refers to administration of an anti-SEMA4D and anti-VEGF antibody, the methods described herein are equally applicable to the antigen-binding fragments, variants, and derivatives of these antibodies that retain the desired properties of the antibodies of the invention, e.g., capable of specifically binding SEMA4D or VEGF, human, mouse, or human and mouse SEMA4D or VEGF, having SEMA4D or VEGF neutralizing activity, and/or blocking the interaction of SEMA4D and VEGF with its receptors. In some embodiments, bispecific antibodies may be used. A bispecific antibody is an artificial protein that is composed of fragments of two different monoclonal antibodies and consequently binds to two different types of antigen. In an embodiment, one arm (i.e., Fab region) of the antibody is capable of specifically binding SEMA4D and the other arm is capable of specifically binding VEGF. Variations on the bispecific antibody format are contemplated within the scope of the present invention. Bispccific antibodies may be generated using techniques that are well known in the art for example, see, for example, Ghayur et at., Expert Review of Clinical Pharmacology3.4 (July 2010): p491;Lu et al., J. Biological Chemistry Vol. 280, No. 20, p. 19665-19672 (2005); Marvin et at., Acta Pharmacologic Sinica 26(6):649-658 (2005); and Milstein C, et at., Nature 1983; 305: 537-40; 30 Brennan M, et at., Science 1985; 229: 81-3; Thakur et al., CurrOpinMolTher. 2010 Jun;12(3):340-9; and U.S.
Patent Publication No. 2007/0004909.
101311 It should also be appreciated that the methods described herein are also applicable to the substitution of anti-Plexin-B1 binding molecules for anti-SEMA4D antibody and/or the substitution of anti-VEGFR2 binding molecules for anti-VEGF antibody. In some embodiments, an anti-Plexin-Bl binding molecule can be used to inhibit the interaction of SEMA4D with Plexin-B I by blocking binding of SEMA4D to Plexin-BI and/or by preventing activation of Plexin-B I by SEMA4D. In other embodiments, an anti-binding molecule can be used to inhibit the interaction of VEGF and VEGFR2 by blocking binding of VEGF to its receptor (i.e., VEGFR2). It should be noted that any combination of anti-SEMA4D or anti-Plexin-B I and anti-VEGF or anti-VEGFR2 binding molecules can be used to inhibit angiogenesis. In one embodiment, an anti-SEMA4D and anti-VEGF binding molecule can be used. In another embodiment, an anti-SEMA4D
and anti-VEGFR2 binding molecule can be used. In another embodiment, an anti-Plexin-B I
and anti-VEGFR2 binding molecule can be used. In another embodiment, an anti-Plexin-B1 and anti-VEGF binding molecule can be used. In each of the above embodiments, the two recited binding specificities may be combined either as separate bivalent antibodies or in the separate univalent arms of a bispecific antibody.
101321 In one embodiment, treatment includes the application or administration of an anti-SEMA4D and anti-VEGF binding molecule, e.g., an antibody or antigen binding fragment thereof as described herein to a patient, or application or administration of the anti-SEMA4D and anti-VEGF binding molecule to an isolated tissue or cell line from a patient, where the patient has a disease, a symptom of a disease, or a predisposition toward a disease. In another embodiment, treatment is also intended to include the application or administration of a pharmaceutical composition comprising the anti-SEMA4D and anti-VEGF binding molecules. e.g., an antibody or antigen binding fragment thereof to a patient, or application or administration of a pharmaceutical composition comprising the anti-SEMA4D and anti-VEGF binding molecule to an -4] -isolated tissue or cell line from a patient, where the patient has a disease, a symptom of a disease, or a predisposition toward a disease 101331 The anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or binding fragments thereof as described herein are useful for the treatment of various malignant and non-malignant tumors, inparticular the inhibition of angiogenesisthat supports growth of a primary tumor or inhibition of metastases. By "anti-tumor activity" is intended a reduction in the rate of SEMA4D and VEGF production or accumulation associated directly with the tumor or indirectly with stromal cells of the tumor environment, and hence a decline in growth rate of an existing tumor or in a tumor that arises during therapy, and/or destruction of existing neoplastic (tumor) cells or newly formed neoplastic cells, and hence a decrease in the overall size of a tumor and/or the number of metastatic sites during therapy. For example, therapy with at least one anti-SEMA4D and one anti-VEGF antibody causes a physiological response, for example, a reduction in angiogenesis, that is beneficial with respect to treatment of disease states associated with SEMA4D and VEGF-expressing cells in a human.
101341 In one embodiment, the invention relates to the use of anti-SEMA4D and anti-VEGF
binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, as a medicament, in particular for use in the treatment or prophylaxis of cancer or for use in a precancerous condition or lesion to inhibit, reduce, prevent, or minimalize the formation of new blood vessels. In certain embodiments, an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or binding fragment thereof, of thepresent invention can also be used to inhibit angiogenesis for the treatment of pathological conditions dependent upon the formation of new blood vessels, including tumor development and macular degeneration. Angiogenesis is a complex multistep morphogenetic event during which endothelial cells, stimulated by major determinants of vascular remodeling, dynamically modify their cell-to-cell and cell-to-matrix contacts and move directionally to be reorganized into a mature vascular tree (Bussolinoet al., Trends Biochem Sci. 22:251-256 (1997); Risau, Nature 386:671-674 (1997); Jain, Nat.
Med.
9:685-693 (2003)). The formation of new blood vessels is a key step during embryo development, but it also occurs in adults in physiologic and in pathologic conditions, such as retinopathy, rheumatoid arthritis, ischemia, and particularly tumor growth and metastasis (Camehet. Nat. Med. 9:653-660 (2003)). This pathological formation of new blood vessels is also herein referred to as "invasive angiogenesis."
101351 In accordance with the methods of the present invention, at least one anti-SEMA4D and one anti-VEGF binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof, as defined elsewhere herein can be used to promote a positive therapeutic response with respect to a malignant human cell. By "positive therapeutic response" with respect to cancer treatment is intended an improvement in the disease in association with the anti-tumor activity of these binding molecules, e.g., antibodies or fragments thereof, and/or an improvement in the symptoms associated with the disease.
That is, a decrease in tumor vasculature, a reduction in tumor size, an anti-proliferative effect, the prevention of further tumor outgrowths, a reduction in the number of cancer cells, and/or a decrease in one or more symptoms associated with the disease can be observed. In particular, the methods provided herein are directed to inhibiting, preventing, reducing, alleviating, or lessening the formation of new blood cellsand/or new metastatic sites in a patient. In addition to these positive therapeutic responses, the subject undergoing therapy with the anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, may experience the beneficial effect of an improvement in the symptoms associated with the disease.
101361 Tumor response can be assessed for changes in tumor morphology (i.e., overall tumor burden, tumor cell count, and the like) using screening techniques such as bioluminescent imaging, for example, luciferase imaging, bone scan imaging, and tumor biopsy sampling including bone marrow aspiration (BMA). In addition to these positive therapeutic responses, the subject undergoing therapy with the anti-SEMA4D and anti-VEGF
binding molecules, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, can experience the beneficial effect of an improvement in the symptoms associated with the disease.
[01371 Clinical response can be assessed using screening techniques such as magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, flow cytometry or fluorescence-activated cell sorter (FACS) analysis, histology, gross pathology, and blood chemistry, including but not limited to changes detectable by ELISA, RIA, chromatography, and the like.
(0138] The anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or antigen binding fragments, variants, or derivatives thereof can be used in combination with at least one or more other cancer therapy agents. including, but not limited to, surgery or surgical procedures (e.g. splenectomy, hepatectomy, lymphadenectomy, leukophoresis, bone marrow transplantation, and the like); radiation therapy; chemotherapy, optionally in combination with autologous bone marrow transplant, or other cancer therapy;
where the additional cancer therapy is administered prior to, during, or subsequent to the anti-SEMA4D and anti-VEGF binding molecules, e.g., antibody or antigen binding fragment, variant, or derivative thereof, therapy. Thus, where the combined therapies comprise administration of an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or antigen binding fragment, variant, or derivative thereof, in combination with administration of another therapeutic agent, as with chemotherapy, radiation therapy, other anti-cancer antibody therapy, small molecule-based cancer therapy, or vaccine/immunotherapy-based cancer therapy, the methods of the invention encompass co-administration, using separate formulations or a single pharmaceutical formulation, with simultaneous or consecutive administration in either order.
VII. Pharmaceutical Compositions and Administration Methods [0139] Methods of preparing and administering anti-SEMA4D and anti-VEGF
binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof to a subject in need thereof are well known to or are readily determined by those skilled in the art. The route of administration of the anti-SEMA4D binding molecule, e.g, antibody, or antigen-binding fragment, variant, or derivative thereof, can be, for example, oral, parenteral, by inhalation or topical. The term parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal administration. While all these forms of administration are clearly contemplated as being within the scope of the invention, an example of a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip.
A suitable pharmaceutical composition for injection can comprise a buffer (e.g. acetate, phosphate or citrate buffer), a surfactant (e.g. polysorbate), optionally a stabilizer agent (e.g. human albumin), etc. However, in other methods compatible with the teachings herein, anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
10140] As discussed herein, anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof can be administered in a pharmaceutically effective amount for the in vivo treatment of diseases such as neoplastic disorders, including solid tumors. In this regard, it will be appreciated that the disclosed binding molecules can be formulated so as to facilitate administration and promote stability of the active agent. In certain embodiments, pharmaceutical compositions in accordance with the present invention comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
For the purposes of the instant application, a pharmaceutically effective amount of an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody, or antigen-binding fragment, variant, or derivative thereof, shall be held to mean an amount sufficient to achieve effective binding to a target and to achieve a benefit, i.e., to inhibit angiogenesis in a cancer patient.
[0141] The pharmaceutical compositions used in this invention comprise pharmaceutically acceptable carriers, including, e.g., ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethyleellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, and wool fat.
101421 Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include, e.g., water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. In the subject invention, pharmaceutically acceptable carriers include, but are not limited to, 0.01-0.1 M and preferably 0.05 M phosphate buffer or 0.8% saline. Other common parenteral vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
101431 More particularly, pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In such cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
[01441 Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example. parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
[0145] In any ease, sterile injectable solutions can be prepared by incorporating an active compound (e.g., an anti-SEMA4D or anti-VEGF antibody, or antigen-binding fragment, variant, or derivative thereof, by itself or in combination with other active agents) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying, which yields a powder of an active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit. Such articles of manufacture can have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to a disease or disorder.
[0146] Parenteral formulations can be a single bolus dose, an infusion or a loading bolus dose followed with a maintenance dose. These compositions can be administered at specific fixed or variable intervals, e.g., once a day, or on an "as needed" basis.
101471 Certain pharmaceutical compositions used in this invention can be orally administered in an acceptable dosage form including, e.g., capsules, tablets, aqueous suspensions or solutions. Certain pharmaceutical compositions also can be administered by nasal aerosol or inhalation. Such compositions can be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
[0148] The amount of an anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody, or fragment, variant, or derivative thereof, to be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration. The composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
[0149] In keeping with the scope of the present disclosure, anti-SEMA4D
antibodies, or antigen-binding fragments, variants, or derivatives thereof can be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic effect. The anti-SEMA4D antibodies, or antigen-binding fragments, variants or derivatives thereof can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables. Those skilled in the art will further appreciate that a cocktail comprising one or more species of anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof, of the invention can be used.
[0150] By "therapeutically effective dose or amount'' or "effective amount" is intended an amount of anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or antigen binding fragment, variant, or derivative thereof, that when administered brings about a positive therapeutic response with respect to treatment of a patient with a disease to he treated, e.g., an inhibition of angiogenesis in the patient.
[0151] Therapeutically effective doses of the compositions of the present invention, for the inhibition of angiogenesis, vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In certain embodiments the patient is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages may be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
[01521 The amount of at least one anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or binding fragment, variant, or derivative thereof to be administered is readily determined by one of ordinary skill in the art without undue experimentation given the disclosure of the present invention. Factors influencing the mode of administration and the respective amount of at least one anti-SEMA4D and one anti-VEGF binding molecule, e.g., antibody, antigen-binding fragment, variant or derivative thereof include, but are not limited to, the severity of the disease, the history of the disease, the potential for angiogenesis, and the age, height, weight, health, and physical condition of the individual undergoing therapy. Similarly, the amount of anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody, or fragment, variant, or derivative thereof, to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent.
[01531 The invention also provides for the use of an anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody of the invention, or antigen-binding fragment, variant, or derivative thereof, in the manufacture of a medicament for treating a subject for treating a cancer, wherein the medicament is used in a subject that has been pretreated with at least one other therapy. By "pretreated" or "pretreatment" is intended the subject has received one or more other therapies (e.g., been treated with at least one other cancer therapy) prior to receiving the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or antigen-binding fragment, variant, or derivative thereof.
"Pretreated" or "pretreatment" includes subjects that have been treated with at least one other therapy within 2 years, within 18 months, within I year, within 6 months, within 2 months, within 6 weeks, within 1 month, within 4 weeks, within 3 weeks, within 2 weeks, within 1 week, within 6 days, within 5 days, within 4 days, within 3 days, within 2 days, or even within 1 day prior to initiation of treatment with the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, for example, the monoclonal antibody VX15/2503 disclosed herein, or antigen-binding fragment, variant, or derivative thereof.
It is not necessary that the subject was a responder to pretreatment with the prior therapy or therapies. Thus, the subject that receives the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof could have responded, or could have failed to respond (e.g., the cancer was refractory), to pretreatment with the prior therapy, or to one or more of the prior therapies where pretreatment comprised multiple therapies.
Examples of other cancer therapies for which a subject can have received pretreatment prior to receiving the medicament comprising the anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody or antigen-binding fragment. variant, or derivative thereof include, but are not limited to, surgery; radiation therapy; chemotherapy, optionally in combination with autologous bone marrow transplant, where suitable chemotherapeutic agents include, but are not limited to, those listed herein above; other anti-cancer monoclonal antibody therapy; small molecule-based cancer therapy, including, but not limited to, the small molecules listed herein above; vaccine/immunotherapy-based cancer therapies; steroid therapy; other cancer therapy; or any combination thereof.
101541 The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture. molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Sambrook et at., ed. (1989) Molecular Cloning A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press); Sambrook et at., ed. (1992) Molecular Cloning: A Laboratory Manual, (Cold Springs Harbor Laboratory, NY); D. N. Glover ed., (1985) DNA Cloning, Volumes I and II: Gait, ed. (1984) Oligonucleotide Synthesis; Mullis et at. U.S. Pat.
No. 4,683,195;
Hames and Higgins, eds. (1984) Nucleic Acid Hybridization; Hames and Higgins, eds.
(1984) Transcription And Translation; Freshney (1987) Culture Of Animal Cells (Alan R.
Liss, Inc.); Immobilized Cells And Enzymes (IRL Press) (1986): Perbal (1984) A
Practical Guide To Molecular Cloning; the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Miller and Cabs eds. (1987) Gene Transfer Vectors For Mammalian Cells, (Cold Spring Harbor Laboratory); Wu et at., eds., Methods In Enzymology, Vols.
154 and 155; Mayer and Walker, eds. (1987) Immunochemical Methods In Cell And Molecular Biology (Academic Press, London); Weir and Blackwell, eds., (1986) Handbook Of Experimental Immunology, Volumes I-1V; Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring harbor, N.Y., (1986);
and in Ausubel et at. (1989) Current Protocols in Molecular Biology (John Wiley and Sons, Baltimore, Md.).
[0155] General principles of antibody engineering are set forth in Borrebaeck, ed. (1995) Antibody Engineering (2nd ed.; Oxford Univ. Press). General principles of protein engineering are set forth in Rickwood et at., eds. (1995) Protein Engineering, A Practical Approach (IRL Press at Oxford Univ. Press, Oxford, Eng.). General principles of antibodies and antibody-hapten binding are set forth in: Nisonoff (1984) Molecular Immunology (2nd ed.; Sinauer Associates, Sunderland, Mass.); and Steward (1984) Antibodies, Their Structure and Function (Chapman and Hall, New York, N.Y.).
Additionally, standard methods in immunology known in the art and not specifically described are generally followed as in Current Protocols in Immunology, John Wiley &
Sons, New York; Stites et al.. eds. (1994) Basic and Clinical Immunology (8th ed:
Appleton & Lange, Norwalk, Conn.) and Mishell and Shiigi (eds) (1980) Selected Methods in Cellular Immunology (W.H. Freeman and Co.. NY).
[0156] Standard reference works setting forth general principles of immunology include Current Protocols in Immunology, John Wiley & Sons, New York; Klein (1982) J., Immunology:
The Science of Self-Nonself Discrimination (John Wiley & Sons, NY); Kennett et al., eds. (1980) Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses (Plenum Press, NY); Campbell (1984) "Monoclonal Antibody Technology"
in Laboratory Techniques in Biochemistry and Molecular Biology, ed. Burden et al., (Elsevere, Amsterdam); Goldsby et al., eds. (2000) KubyImmunnology (4th ed.;
H.
Freemand& Co.); Roitt et al. (2001) Immunology (6th ed.; London: Mosby); Abbas et al.
(2005) Cellular and Molecular Immunology (5th ed.; Elsevier Health Sciences Division);
Kontermann and Dubel (2001) Antibody Engineering (Springer Verlan); Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press);
Lewin (2003) Genes VIII (Prentice Hal12003); Harlow and Lane (1988) Antibodies: A
Laboratory Manual (Cold Spring Harbor Press); Dieffenbach and Dveksler (2003) PCR
Primer (Cold Spring Harbor Press).
[0157] DELETED
[0158] The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
[0159] The following examples demonstrate the efficacy of anti-SE1VIA4D
antibody VX15/2503 and anti-VEGF antibody on inhibiting the growth of H1\16 head and neck tumors in mice.
Example 1: Experimental Design [0160] The basic experimental design is as follows. Tumor cells were implanted subcutaneously into both flanks ofathymicnude mice. The tumor bearing nude micewere divided into four groups of seven mice each with each mouse having two tumors. The first group (control group) was treated with IgGisotype control MAb2955. The second group was treated withanti-SEMA4D antibody VX15/2503. The third group was treated with an anti-VEGF
antibody (Mouse IgG2A MAb 2931, which is a human VEGF MAb, Mouse IgG2A, Catalog # MAB2931; R&D Systems).The fourth group was treated with a combination of anti-SEMA4D antibody (VX15/2503) and anti-VEGF antibody (Mouse IgG2A MAb 2931). The treatment started two days post tumor graft. Mice were treated once a week with 1.0 mg (approximately 50 mg/kg) of monoclonal antibody via intraperitoneal (IP) injection for three weeks.
Example 2: Primary Tumor Growth [0161] Primary tumor growth was measured by calipers up to sacrifice, which measurements were used to calculate tumor volume. The animals treated with VX15/2503 alone showed a reduction in primary tumor volume at the time of sacrifice over the control animals, with the difference being statistically significant (P<0.0001). The animals treated with anti-VEGF(Mouse IgG2A MAb 2931) alone also showed a reduction in primary tumor volume at the time of sacrifice over the control animals, with the difference being statistically significant (P<0.0001). In addition, an additive effect on reduction of the tumor volume was seen when anti-SEMA4D antibody (VX15/2503) was used in combination with anti-VEGF antibody, with the difference being statistically significant (P<0.0001). Statistical analysis was conducted using Two-way Analysis of Variance (ANOVA), comparing tumor growth in each group to control antibody. T-test of final tumor volumes of resected tumors also resulted in statistically significant differences (P<0.0001). The results are shown in FIG. 1, which shows the mean tumor volume among the four groups. FIG. 2 shows representative photographs for the extracted tumors.
Example 3: Primary Tumor Vascular Density [0162] The vascular density of the tumors was also measured. Vascular density was measured as vessels per 10 hpf (high power field). Treatment with either VX15/2503 or anti-VEGF
(Mouse IgG2A MAb 2931) individually resulted in a decrease in vascular density, as compared to the control group. Treatment with anti-SEMA4D antibody (VX15/2503) in combination with anti-VEGF antibodyresulted in a greater reduction in vascular density ("P<0.01), as compared to the control group as well as either VX15/2503 (*P<0.05) or anti-VEGF (*P<0.05) alone. The results are shown graphically in FIG. 3.
[0163] Many modifications and other embodiments of the inventions set forth herein will come to mind to one skilled in the art to which these inventions pertain having the benefit of the teachings presented in the foregoing descriptions and the associated drawings.
Therefore, it is to be understood that the inventions are not to be limited to the specific embodiments disclosed and that modifications and other embodiments are intended to be included within the scope of the appended claims and list of embodiments disclosed herein.
Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
[0044] By "specifically binds," it is generally meant that an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind" to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term "specificity" is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody "A" may be deemed to have a higher specificity for a given epitope than antibody "B," or antibody "A" may be said to bind to epitope "C" with a higher specificity than it has for related epitope "D."
[0045] By "preferentially binds," it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
'Thus, an antibody that "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
[0046] By way of non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds said first epitope with a dissociation constant (1(0) that is less than the antibody's K0 for the second epitope. In another non-limiting example, an antibody may be considered to bind a first antigen preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's KU
for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's KID for the second epitope.
[0047] In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an off rate (k(off)) that is less than the antibody's k(off) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's k(off) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's k(off) for the second epitope.
100481 An antibody is said to competitively inhibit binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope. Competitive inhibition may be determined by any method known in the art, for example, competition ELISA
assays. An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
[0049] As used herein, the term "affinity" refers to a measure of the strength of the binding of an individual epitope with the CDR of an immunoglobulin molecule. See, e.g., Harlow et al.
(1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 2nd ed.) pages 27-28. As used herein, the term "avidity" refers to the overall stability of the complex between a population of immunoglobulins and an antigen, that is, the functional combining strength of an immunoglobulin mixture with the antigen. See, e.g., Harlow at pages 29-34. Avidity is related to both the affinity of individual immunoglobulin molecules in the population with specific epitopes, and also the valencies of the immunoglobulins and the antigen. For example, the interaction between a bivalent monoclonal antibody and an antigen with a highly repeating epitope structure, such as a polymer, would be one of high avidity.
[0050] Anti-SEMA4D and anti-VEGF antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention may also be described or specified in terms of their cross-reactivity. As used herein, the term "cross-reactivity" refers to the ability of an antibody, specific for one antigen, to react with a second antigen; a measure of relatedness between two different antigenic substances. Thus, an antibody is cross reactive if it binds to an epitope other than the one that induced its formation. The cross reactive epitope generally contains many of the same complementary structural features as the inducing epitope, and in some cases, may actually fit better than the original.
[0051] For example, certain antibodies have some degree of cross-reactivity, in that they bind related, but non-identical epitopes, eg, epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be said to have little or no cross-reactivity if it does not bind epitopes with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be deemed "highly specific" for a certain epitope, if it does not bind any other analog, ortholog, or homolog of that epitope.
10052] Anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or antigen-binding fragments, variants or derivatives thereof, of the invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention, e.g., SEMA4D or VEGF, e.g., human, murine, or both human and murine SEMA4D or VEGF.
Preferred binding affinities include those with a dissociation constant or Kd less than 5 x 10-2 M, 1012 M, 5 x 10-3 M, 10-3 M, 5 x 10-4 M, 10-4 M, 5 x 10-5 M, 10-5 M, 5 x l0 M, 10-M, 5 x i0 TA, I0 M, 5 x 10-8 M, 1(18 M, 5 x 10-9 M, 10-9 M, 5 x 100 M, 100 M, 5 x 10-" M, 10-11M, 5 x 102 M, 10-12M, 5 x 10-13M, 10-13M, 5 x 10-14 M, 10-14 M, 5 x 10-15 M, or 10-15 M. In certain embodiments, the anti-SEMA4D binding molecule, e.g., an antibody or antigen binding fragment thereof, of the invention binds human SEMA4D or VEGF with a Kd of about 5 x 10-9 to about 6 x 10-9. In another embodiment, the anti-SEMA4D or VEGF binding molecule, e.g., an antibody or antigen binding fragment thereof, of the invention binds murine SEMA4D or VEGF with a Kd of about 1 x 10-9 to about 2 x 1 0-9.
100531 As used herein, the term "chimeric antibody" will be held to mean any antibody wherein the immunoreactive region or site is obtained or derived from a first species and the constant region (which may be intact, partial or modified in accordance with the instant invention) is obtained from a second species. In preferred embodiments the target binding region or site will be from a non-human source (e.g., mouse or primate) and the constant region is human.
[0054] As used herein, the term "engineered antibody" refers to an antibody in which the variable domain in either the heavy or light chain or both is altered by at least partial replacement of one or more CDRs from an antibody of known specificity and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs may be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and preferably from an antibody from a different species. An engineered antibody in which one or more "donor" CDRs from a non-human antibody of known specificity is grafted into a human heavy or light chain framework region is referred to herein as a "humanized antibody." It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable domain to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the target binding site.
100551 It is further recognized that the framework regions within the variable domain in a heavy or light chain, or both, of a humanized antibody may comprise solely residues of human origin, in which case these framework regions of the humanized antibody are referred to as "fully human framework regions" (for example, MAb VX15/2503, disclosed in U.S.
Patent Appl. Publication No. US 2010/0285036 Al as MAb 2503).
Alternatively, one or more residues of the framework region(s) of the donor variable domain can be engineered within the corresponding position of the human framework region(s) of a variable domain in a heavy or light chain, or both, of a humanized antibody if necessary to maintain proper binding or to enhance binding to the SEMA4D antigen. A human framework region that has been engineered in this manner would thus comprise a mixture of human and donor framework residues, and is referred to herein as a "partially human framework region."
[0056] For example, humanization of an anti-SEMA4D antibody can be essentially performed following the method of Winter and co-workers (Jones etal., Nature 321:522-525 (1986);
Riechmannet al., Nature 332:323-327 (1988); Verhoeyenet al., Science 239:1534-(1988)), by substituting rodent or mutant rodent CDRs or CDR sequences for the coriesponding sequences of a human anti-SEMA4D antibody. See also U.S. Pat.
Nos.
5,225,539; 5,585,089; 5,693,761; 5,693,762; 5,859,205.
The resulting humanized anti-SEMA4D antibody would comprise at least one rodent or mutant rodent CDR within the fully human framework regions of the variable domain of the heavy and/or light chain of the humanized antibody. In some instances, residues within the framework regions of one or more variable domains of the humanized anti-SEMA4D antibody are replaced by corresponding non-human (for example, rodent) residues (see, for example, U.S. Pat. Nos. 5,585,089; 5,693,761; 5,693,762;
and 6,180,370), in which case the resulting humanized anti-SEMA4D antibody would comprise partially human framework regions within the variable domain of the heavy and/or light chain. Similar methods can be used for humanization of an anti-VEGF
antibody.
[0057] Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance (e.g., to obtain desired affinity). In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fe), typically that of a human immunoglobulin. For further details see Jones et al., Nature 33/:522-525 (1986);
Riechmannet al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct.
Biol. 2:593-596 (1992).
Accordingly, such "humanized" antibodies may include antibodies wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
In practice, humanized antibodies are typically human antibodies in which some CDR
residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies. See, for example, U.S. Pat. Nos.
5,225,539;
5,585,089; 5,693,761; 5,693,762; 5,859,205. See also U.S. Pat. No. 6,180,370, and International Publication No. WO 01/27160, where humanized antibodies and techniques for producing humanized antibodies having improved affinity for a predetermined antigen are disclosed.
II. Target Polypeptide Description ¨ SEMA4D
[0058] As used herein, the terms "semaphorin-4D," "SEMA4D" and "SEMA4D
polypeptide'' are used interchangeably, as are ''SEMA4D" and "Sema4D." In certain embodiments, SEMA4D is expressed on the surface of or secreted by a cell. In another embodiment, SEMA4D is membrane bound. In another embodiment, SEMA4D is soluble, e.g., sSEMA4D. In another embodiment, SEMA4D may include a full-sized SEMA4D or a fragment thereof, or a SEMA4D variant polypeptide, wherein the fragment of , or SEMA4D variant polypeptide retains some or all functional properties of the full-sized SEMA4D.
100591 The full-sized human SEMA4D protein is a homodimerictransmembrane protein consisting of two polypeptide chains of 150 kDa. SEMA4D belongs to the semaphorin family of cell surface receptors and is also referred to as CD100. Both human and mouse SEMA4D/Sema4D are proteolytically cleaved from their transmembrane form to generate 120-kDa soluble forms, indicating the existence of two Sema4D
isoforms (Kumanogohet al., I Cell Science 1/6(7):3464 (2003)). Semaphorins consist of soluble and membrane-bound proteins that were originally defined as axonal-guidance factors which play an important role in establishing precise connections between neurons and their appropriate target. Structurally considered a class IV semaphorin, consists of an amino-terminal signal sequence followed by a characteristic 'Sema"
domain, which contains 17 conserved cysteine residues, an Ig-like domain, a lysine-rich stretch, a hydrophobic transmembrane region, and a cytoplasmic tail.
100601 Each polypeptide chain of SEMA4D includes a signal sequence of about 13 amino acids followed by a semaphorin domain of about 512 amino acids, an immunoglobulin-like (1g-like) domain of about 65 amino acids, a lysine-rich stretch of 104 amino acids, a hydrophobic transmembrane region of about 19 amino acids, and a cytoplasmic tail of 110 amino acids. A consensus site for tyrosine phosphorylation in the cytoplasmic tail supports the predicted association of SEMA4D with a tyrosine kinase (Sehlossman, et al., Eds. (1995) Leucocyte Typing V (Oxford University Press, Oxford).
100611 SEMA4D is known to have at least two functional receptors. One of the receptors, Plexin-B1, is expressed in non-lymphoid tissues and has been shown to be a high affinity (1 nM) receptor for SEMA4D (Tamagnoneet al., Cell 99:71-80 (1999)). SEMA4D
stimulation of Plexin B1 signaling has been shown to induce growth cone collapse of ncurons, and to induce process extension collapse and apoptosis of oligodendrocytes (Giraudonet al., J. Immunol. /72:1246-1255 (2004); Giraudonet al., NeuroMolecular Med. 7:207-216 (2005)). After binding to SEMA4D, Plexin B1 signaling mediates the inactivation of R-Ras, leading to a decrease in the integrin mediated attachment to the extracellular matrix, as well as to activation of RhoA, leading to cell collapse by reorganization of the cytoskeleton. See Kruger et al., Nature Rev. Mol. Cell Biol. 6:789-800 (2005); Pasterkamp, TRENDS in Cell Biology /5:61-64 (2005)).
100621 In lymphoid tissues, CD72 is utilized as a low affinity (300nM) SEMA4D
receptor (Kumanogohet aL, Immunity /3:621-631 (2000)). B cells and Antigen Presenting Cells (APC) express CD72, and anti-CD72 antibodies have many of the same effects as sSEMA4D, such as enhancement of CD40-induced B cell responses and B cell shedding of CD23. CD72 is thought to act as a negative regulator of B cell responses by recruiting the tyrosine phosphatasc SHP-I, which can associate with many inhibitory receptors.
Interaction of SEMA4D with CD72 results in the dissociation of SHP-1, and the loss of this negative activation signal. SEMA4D has been shown to promote T cell stimulation and B cell aggregation and survival in vitro. The addition of SEMA4D-expressing cells or sSEMA4D enhances CD40-induced B cell proliferation and immunoglobulin production in vitro, and accelerates in vivo antibody responses (Ishida et al., Inter.
Immunol. /5:1027-1034 (2003); Kumanogoh and H. Kukutani, Trends in Immunol.
22:670-676 (2001)). sSEMA4D enhances the CD40 induced maturation of DCs, including up-regulation of costimulatory molecules and increased secretion of IL-12. In addition, sSEMA4D can inhibit immune cell migration, which can be reversed by addition of blocking anti-SEMA4D mouse antibodies (Elhabaziet al.. J. Immunol.
166:4341-4347 (2001); Delaireet al., J. Immunol. 166:4348-4354 (2001)).
[0063] Sema4D is expressed at high levels in lymphoid organs, including the spleen, thymus, and lymph nodes, and in non-lymphoid organs, such as the brain, heart, and kidney.
In lymphoid organs, Sema4D is abundantly expressed on resting T cells but only weakly expressed on resting B cells and antigen-presenting cells (APCs), such as dendritic cells (DCs).
[00641 Cellular activation increases the surface expression of SEMA4D as well as the generation of soluble SEMA4D (sSEMA4D). The expression pattern of SEMA4D suggests that it plays an important physiological as well as pathological role in the immune system.
SEMA4D has been shown to promote B cell activation, aggregation and survival;
enhance CD40-induced proliferation and antibody production; enhance antibody response to T cell dependent antigens; increase T cell proliferation; enhance dendritic cell maturation and ability to stimulate T cells; and is directly implicated in demyelination and axonal degeneration (Shi et al., Immunity /3:633-642 (2000); Kumanogohet al., J
Immunol 169:1175-1181(2002); and Watanabe et al., J Immunol 167:432 1-4328 (2001)).
10065] SEMA4D knock out (SEMA4D-/-) mice have provided additional evidence that SEMA4D plays an important role in both humoral and cellular immune responses.
There are no known abnormalities of non-lymphoid tissues in SEMA4D-/- mice.
Dendritic cells (DCs) from the SEMA4D-/- mice have poor allostimulatory ability and show defects in expression of costimulatory molecules, which can be rescued by the addition of sSEMA4D. Mice deficient in SEMA4D (SEMA4D-/-) fail to develop experimental autoimmune encephalomyelitis induced by myelin oligodendrocyte glycoprotein peptide, because myelin oligodendrocyte glycoprotein-specific T cells are poorly generated in the absence of SEMA4D (Kumanogohet al., J Immunol 169:1175-1181 (2002)). A
significant amount of soluble SEMA4D is also detected in the sera of autoimmunity-prone MRL/lpr mice (model of systemic autoimmune diseases such as SLE), but not in normal mice. Further, the levels of sSEMA4D correlate with levels of auto-antibodies and increase with age (Wang et al., Blood 97:3498-3504 (2001)). Soluble SEMA4D
has also been shown to accumulate in the cerebral spinal fluid and sera of patients with demyelinating disease, and sSEMA4D induces apoptosis of human pluripotent neural precursors (Dev cells), and both inhibits process extension and induces apoptosis of rat oligodendrocytesin vitro (Giraudonet al., J Immunol 172(2):1246-1255 (2004)).
This apoptosis was blocked by an anti-SEMA4D monoclonal antibody (MAb).
III. Anti-SEMA4D Antibodies 10066] Antibodies that bind SEMA4D have been described in the art. See, for example, US
Publ. Nos. 2008/0219971 Al, US 2010/0285036 Al, and US 2006/0233793 Al, International Patent Applications WO 93/14125, WO 2008/100995, and WO
2010/129917, and Heroldet al.,Int. Immunol. 7(1): 1-8 (1995).
[006711 The invention generally relates to a method of inhibiting angiogenesis in a subject, e.g., a human cancer patient or a patient with wet age-related macular degeneration (AMD), comprising administration of an antibody which specifically binds to SEMA4D, or an antigen-binding fragment, variant, or derivative thereof. In certain embodiments, the antibody blocks the interaction of SEMA4D with one or more of its receptors, e.g., Plexin-Bl. In certain embodiments the cancer cells express Plexin-B1. Anti-antibodies having these properties can be used in the methods provided herein.
Antibodies that can be used include, but are not limited to MAbs VX15/2503, 67, and 76 =
and antigen-binding fragments, variants, or derivatives thereof which are fully described in US 2010/0285036 Al. Additional antibodies which can be used in the methods provided herein include the BD16 antibody described in US 2006/0233793 Al as well as antigen-binding fragments, variants, or derivatives thereof; or any of MAb 301, MAb 1893, MAb 657, MAb 1807, MAb 1656, MAb 1808, Mab 59. MAb 2191, MAb 2274, MAb 2275, MAb 2276, MAb 2277, MAb 2278, MAb 2279, MAb 2280, MAb 2281, MAb 2282, MAb 2283, MAb 2284, and MAb 2285, as well as any fragments, variants or derivatives thereof as described in US 2008/0219971 Al. In certain embodiments an anti-SEMA4D antibody for use in the methods provided herein binds human, murine, or both human and murine SEMA4D. Also useful are antibodies which bind to the same epitope as any of the aforementioned antibodies and/or antibodies which competitively inhibit binding or activity of any of the aforementioned antibodies.
[0068] In certain embodiments, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein has an amino acid sequence that has at least about 80%, about 85%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95% sequence identity to the amino acid sequence for a reference anti-SEMA4D antibody molecule, for example those described above. In a further embodiment, the binding molecule shares at least about 96%, about 97%, about 98%, about 99%, or 100% sequence identity to a reference antibody.
100691 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%. about 98%. about 99%, or identical to CDR1, CDR2 or CDR3 of SEQ ID NO: 9 or 10.
100701 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or identical to SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
100711 In another embodiment. an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin heavy chain variable domain (VII domain), where at least one of the CDRs of the VH domain has an amino acid sequence identical, except for 1, 2, 3, 4, or 5 conservative amino acid substitutions, to SEQ ID NO: 6, SEQ ID
NO: 7, or SEQ
ID NO: 8.
100721 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of a VH domain that has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to SEQ ID NO: 9 or SEQ
ID
NO: 10, wherein an anti-SEMA4D antibody comprising the encoded VH domain specifically or preferentially binds to SEMA4D.
100731 In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%. about 99%, or identical to CDR], CDR2 or CDR3 of SEQ ID NO: 17 or 18.
10074] In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or identical to SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16.
[0075] In another embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence identical, except for 1,2, 3, 4, or 5 conservative amino acid substitutions, to SEQ ID NO: 14, SEQ
ID NO: 15, or SEQ ID NO: 16.
[0076] In a further embodiment, an anti-SEMA4D antibody or antigen-binding fragment, variant, or derivative thereof useful in the methods provided herein comprises, consists essentially of, or consists of a VL domain that has an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% identical to SEQ ID NO: 17 or SEQ ID
NO: 18, wherein an anti-SEMA4D antibody comprising the encoded VL domain specifically or preferentially binds to SE1VIA4D.
[00771 Also included for use in the methods provided herein are polypeptides encoding anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof as described herein, polynucleotides encoding such polypeptides, vectors comprising such polynucleotides, and host cells comprising such vectors or polynucleotides, all for producing anti-SEMA4D antibodies, or antigen-binding fragments, variants, or derivatives thereof for use in the methods described herein.
10078] Suitable biologically active variants of the anti-SEMA4D antibodies of the invention can be used in the Methods of the present invention. Such variants will retain the desired binding properties of the parent anti-SEMA4D antibody. Methods for making antibody variants are generally available in the art.
[00791 Methods for mutagenesis and nucleotide sequence alterations are well known in the art.
See, for example, Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York); Kunkel, Proc. Natl. Acad. Sci. USA
82:488-492 (1985); Kunkel et al., Methods Enzymol. /54:367-382 (1987);
Sambrooket al.
(1989) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor, N.Y.); U.S.
Pat.
No. 4,873,192; and the references cited therein.
Guidance as to appropriate amino acid substitutions that do not affect biological activity of the polypeptide of interest may be found in the model of Dayhoffet al.
(1978) in Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), pp.
345-352. The model of Dayhoffet al. uses the Point Accepted Mutation (PAM) amino acid similarity matrix (PAM 250 matrix) to determine suitable conservative amino acid substitutions. Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be preferred.
Examples of conservative amino acid substitutions as taught by the PAM 250 matrix of the Dayhoffet al. model include, but are not limited to, Gly<-4A1a, Val4¨*Ile4-+Leu, Asp4-+G1u, Lys4-0,.rg, Asn4-+Gln, and Phe4¨;frpl--Jyr.
[0080] In constructing variants of the anti-SEMA4D binding molecule, e.g., an antibody or antigen-binding fragment thereof, polypeptides of interest, modifications are made such that variants continue to possess the desired properties, e.g., being capable of specifically binding to a SEMA4D, e.g., human, murine, or both human and murine SEMA4D, expressed on the surface of or secreted by a cell and having SEMA4D blocking activity, as described herein. Obviously, any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See EP
Patent Application Publication No. 75,444.
[0081] Methods for measuring anti-SEMA4D binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, binding specificity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobulin secretion by T cells or B cells, T cell proliferation assays, apoptosis assays, ELISA
assays, and the like. See, for example, such assays disclosed in WO 93/14125;
Shi et al., Immunity /3:633-642 (2000); Kumanogohet al., J Immunol /69:1175-1181 (2002);
Watanabe et al., J Immunol /67:4321-4328 (2001); Wang et al., Blood 97:3498-(2001); and Giraudonet al., J Immunol I72(2):1246-1255 (2004).
[0082] Methods for measuring the anti-angiogenic ability of an anti-SEMA4D
antibody or antigen-binding fragment, variant, or derivative thereof are describe herein and are also well known in the art.
[0083] When discussed herein whether any particular polypeptide, including the constant regions, CDRs, VH domains, or VL domains disclosed herein, is at least about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or even about 100% identical to another polypeptide, the % identity can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis.
53711).
BESTFIT uses the local homology algorithm of Smith and Waterman (1981) Adv.
Appl.
Math. 2:482-489, to find the best segment of homology between two sequences.
When using BESTFIT or any other sequence alignment program to determine whether a particular sequence is, for example, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
[0084] For purposes of the present invention, percent sequence identity may be determined using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. The Smith-Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv.
App!. Math. 2:482-489. A variant may, for example, differ from a reference anti-SEMA4D antibody (e.g.. MAb VX15/2503, 67 or 76) by as few as 1 to 15 amino acid residues, as few as 1 to 10 amino acid residues, such as 6-10, as few as 5, as few as 4, 3, 2, or even 1 amino acid residue.
[0085] The constant region of an anti-SEMA4D antibody can be mutated to alter effector function in a number of ways. For example, see U.S. Pat. No. 6,737,056B1 and U.S.
Patent Application Publication No. 2004/0132101A1, which disclose Fe mutations that optimize antibody binding to Fe receptors.
[0086] In certain anti-SEMA4D antibodies or fragments, variants or derivatives thereof useful in the methods provided herein, the Fe portion can be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fe receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases, constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half-life. Yet other modifications of the constant region can be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. The resulting physiological profile, bioavailability and other biochemical effects of the modifications, such as tumor localization, biodistribution and serum half-life, can easily be measured and quantified using well known immunological techniques without undue experimentation.
10087] Anti-SEMA4D antibodies for use in the methods provided herein include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate cpitope. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by Llycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular liganci or other protein, etc. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, etc.
Additionally, the derivative can contain one or more non-classical amino acids.
10088] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e g the ability to bind an anti-SEMA4D polypeptide, to block SEMA4D interaction with its receptor, or to inhibit angiogenesis in a subject. e.g., a cancer patient).
100891 For example, it is possible to introduce mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations can be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen.
These types of mutations can be useful to optimize codon usage, or improve a hybridoma's antibody production. Alternatively, non-neutral missense mutations may alter an antibody's ability to bind antigen. One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity). Following mutagenesis, the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of a polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
[0090] In certain embodiments, the anti-SEMA4D antibodies for use in the methods provided herein comprise at least one optimized complementarity-determining region (CDR). By "optimized CDR" is intended that the CDR has been modified and optimized to improve binding affinity and/or anti-SEMA4D activity that is imparted to an anti-antibody comprising the optimized CDR. "Anti-SEMA4D activity" or "SEMA4D
blocking activity" can include activity which modulates one or more of the following activities associated with SEMA4D: B cell activation, aggregation and survival; CD40-induced proliferation and antibody production; antibody response to T cell dependent antigens; T cell or other immune cell proliferation; dendritic cell maturation;
demyelination and axonal degeneration; apoptosis of pluripotent neural precursors and/or oligodendrocytes; induction of endothelial cell migration; inhibition of spontaneous monocyte migration; inhibition of tumor cell metastasis, binding to cell surface plexin B1 or other receptor, or any other activity association with soluble SEMA4D or that is expressed on the surface of SEMA4D+ cells. In a particular embodiment, anti-SEMA4D activity includes the ability to inhibit tumor angiogenesis, either in combination with inhibition of primary tumor cell growth and tumor metastases, or independently of primary tumor cell growth and tumor metastases. Anti-SEMA4D activity can also be attributed to a decrease in incidence or severity of diseases associated with expression, including, but not limited to, certain types of cancers including lymphomas, autoimmune diseases, inflammatory diseases including central nervous system (CNS) and peripheral nervous system (PNS) inflammatory diseases, transplant rejections, and invasive angiogenesis. Examples of optimized antibodies based on murine anti-MAb BD16 were described in US Publ. No. 2008/0219971 Al, International Patent Application W093/14125 and Heroldet al., Int. Immunol, 7(1): 1-8 (1995).
The modifications may involve replacement of amino acid residues within the CDR such that an anti-SEMA4D
antibody retains specificity for the SEMA4D antigen and has improved binding affinity and/or improved anti-SEMA4D activity.
IV. Target Polypeptide Description - VEGF
[0091] As used herein, the terms "VEGF" and "VEGF polypeptide" are used interchangeably. In certain embodiments, VEGF is secreted by a cell. In another embodiment, VEGF
is membrane-bound or bound to the extracellular matrix. In another embodiment, VEGF is soluble. In other embodiments, VEGF may include a full-sized VEGF polylpeptide or a fragment thereof, or a VEGF variant polypeptide (including VEGF isoforms and splice variants), wherein the fragment of VEGF or VEGF variant polypeptide retains some or all functional properties of the full-sized, native VEGF.
[0092] The full-sized, native human VEGF protein is a homodimeric glycoprotein consisting of two identical 23 kDa polypeptide subunits. See, Ho and Kuo, Int. .1 Biochem Cell Biol.
2007; 39(7-8): 1349-1357. The VEGF gene family has several members, including VEGF-A (also referred to herein as "VEGF"), VEGF-B, VEGF-C, VEGF-D. and PI GF.
See, Ho and Kuo, Int. .1 Biochem Cell Biol. 2007; 39(7-8): 1349-1357. There are numerous alternatively spliced isoforms of human VEGF, including VEGF165, VEGFizi, VEGF189, and VEGF106, which have different bioavailabilities, bioactivities, and receptor specificities. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357:
Ferraraet al., Nature Med. 2003; 9 (6):669-676. The VEGF165 isofonn is the most prevalent and mitogenic and is most similar in properties to the 45kDa native VEGF. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357; Ferraraet al., Nature Med. 2003; 9 (6):669-676.
[0093] VEGF expression and activity is modulated by a number of factors, including hypoxia, mechanical forces, dysregulation of tumor suppressors and oncogenes, inflammatory mediators (e.g., cytokines), and other growth factors. See, Ho and Kuo, hit.
J. Biochetn Cell Biol. 2007; 39(7-8): 1349-1357. Once expressed, some secreted VEGF is sequestered by the extracellular matrix, which can act as a reservoir that releases VEGF
through proteolysis. See, Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357.
[0094] VEGF binds two receptor tyrosine kinases with high affinity--VEGFR1 (Flt-1) and VEGFR2 (KDR, FlkI)--which are found mainly on the surface of vascular endothelial cells. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680. It is thought that only VEGFR-2 activation induces angiogenesis, mitogenesis, and increased vascular permeability through a process of autophosphorylation that activates downstream signaling pathways such as phosphatidylinositol 3'-OH kinase/Akt. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680. VEGFR1 is thought to act as a decoy receptor that suppresses the availability of VEGF to VEGFR2, and may be important in hematopoiesis, matrix metalloproteinase development, and release of growth factors from endothelial cells. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
[0095] Antagonism of VEGF with monoclonal antibodies has been shown to inhibit primary tumor growth, primarily by disrupting the blood supply to tumors and to inhibit tumor angiogenesis. Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
[0096] For reviews related to VEGF and VEGF inhibition, see Ferrara, Nature Reviews 2002; 2:
795-803; Ho and Kuo, Int. J. Biochem Cell Biol. 2007; 39(7-8): 1349-1357;
Ferrara, et al., Nature Med. 2003; 9:669-676; Pander et al., Drug Discovery Today 2007;
12: 1054-1060; Hicklin and Ellis, J. Clin, Oncol. 2005; 5:1011-1027; and Gerber and Ferrara, Cancer Res. 2005; 65: 671-680.
V. Anti-VEGF Antibodies [0097] Antibodies that bind VEGF have been described the art. See, for example, US Pat. No.
6,884,879 and Prestaet al.,Cancer Res. 57: 4593-4599 (1997).
[0098] The invention generally relates to a method of inhibiting angiogenesis in a subject, e.g., a human cancer patient, comprising administration of an antibody which specifically binds to VEGF or its VEGFR2 receptor, or an antigen-binding fragment, variant, or derivative thereof. In certain embodiments, the antibody blocks the interaction of VEGF
with one or more of its receptors, e.g., VEGFR1 and VEGFR2. Anti-VEGF antibodies having these properties can be used in the methods provided herein.
[0099] The antibodies according to the invention comprise anti-VEGF or anti-antibodies or antigen-binding fragments, variants, or derivatives thereof that bind to VEGF or its VEGFR2 receptor, e.g., MAb 7392 as described herein, and in International Patent Appl. No. PCT/US2011/040361.
In certain embodiments the anti-VEGF antibodies bind human VEGF. In other embodiments, the anti-VEGF antibodies block VEGF binding to its receptor, e.g., VEGFR I or VEGFR2. In certain embodiments, the anti-VEGF or anti-VEGFR2 antibodies block phosphorylation of VEGFR2 by VEGF.
[0100] In one embodiment, the present invention provides an isolated binding molecule, e.g., an antibody or antigen binding fragment thereof, which specifically binds to the same VEGF
epitope as MAb7392. In another embodiment, the present invention provides an isolated binding molecule, e.g., an antibody or antigen binding fragment thereof that specifically binds to VEGF, and competitively inhibits MAb 7392 from specifically binding to VEGF.
In certain embodiments, the antibody specifically binds VEGF with an affinity of less than about 3.9 x 10-9 M. In another embodiment, the antibody specifically binds VEGF
with an affinity of less than about 9.1 x 10-10 M.
[0191] In one embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is identical to CDR I, CDR2 or CDR3 of SEQ ID NO:41.
[0102] In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable domain (VH domain), where at least one of the CDRs of the VH domain has an amino acid sequence that is identical to SEQ ID
NO: 43, SEQ ID NO: 44, or SEQ ID NO: 45.
101031 In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH
domain that has an amino acid sequence that is identical to SEQ ID NO:41, wherein an anti-VEGF antibody comprising the encoded VH domain specifically or preferentially binds to VEGF, more specifically, human VEGF.
[0104] In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is identical to CDR I, CDR2 or CDR3 of SEQ ID NO:42.
101051 In another embodiment, the present invention provides an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable domain (VL domain), where at least one of the CDRs of the VL domain has an amino acid sequence that is identical to SEQ ID
NO:46, SEQ ID NO: 47, or SEQ ID NO:48.
[0106] In a further embodiment, the present invention includes an isolated antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL
domain that has an amino acid sequence that is identical to SEQ ID NO:42, wherein an anti-VEGF antibody comprising the encoded VL domain specifically or preferentially binds to VEGF, more specifically, human VEGF.
[0107] Polypeptide sequences of the anti-VEGF antibodies or antigen binding molecules thereof including the following:
[0108] The 1-17230 and L7104 variable regions thathave the following amino acid sequences (CDRs are underlined):
[0109] H7230 (SEQ ID NO:41):
QVQLVQSGAELRKPGASVKI SCKASGYSLTYYGMNWVRQAPGQGLEWMG
WINTFTGDSTYAQDFTGRFVFSLDTSVSTAYLQI SSLKAEDMAMYYCAK
YPHYYGSSHWYFDVWGQGTTVTVSS
L7104 (SEQ ID NO:42):
EIVLTQSPATLSVS PGERATL S CRASQSVNSNLAWYQQKPGQAPRVL Y
GASTRATGIPARFSGSGSGTE FTLT IS SLQSEDEAVYYCQQYSDIPWTF
GQGT KLE K
[01101 The CDRs of MAb 7392 (comprising H7230 and L7104 variable regions) thathave the following amino acid sequences:
VH-CDR1 (SEQ ID NO:43):
GYSLTYYGMN
VH-CDR2 (SEQ ID NO:44):
WINTFTGDSTYAQDFTG
VH-CDR3 (SEQ ID NO:45):
YEHYYGSSHWYF DV
VL-CDR I (SEQ ID NO:46):
RASQSVNSNLA
VL-CDR2 (SEO ID NO:47):
GASTRAT
VL-CDR3 (SEO II) NO:48):
QQYSD I PWT
[01111 Suitable biologically active variants of the anti-VEGF antibodies of the invention can be used in the methods of the present invention. Such variants will retain the desired binding properties of the parent anti-VEGF antibody. Methods for making antibody variants are generally available in the art.
[0112] Methods for mutagenesis and nucleotide sequence alterations are well known in the art.
See, for example, Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York); Kunkel, Proc. Natl. Acad. Sc!. USA
82:488-492 (1985); Kunkel et at, Methods Enzymot /54:367-382 (1987);
Sambrooket al.
(1989) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor, N.Y.); U.S.
Pat.
No. 4,873,192; and the references cited therein.
Guidance as to appropriate amino acid substitutions that do not affect biological activity of the polypeptide of interest may be found in the model of Dayhoffet al.
(1978) in Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), pp.
345-352, herein incorporated by reference in its entirety. The model of Dayhoffet al. uses the Point Accepted Mutation (PAM) amino acid similarity matrix (PAM 250 matrix) to determine suitable conservative amino acid substitutions. Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be preferred.
Examples of conservative amino acid substitutions as taught by the PAM 250 matrix of the Dayhoffet al. model include, but are not limited to, Glyi-,Ala, Asp4-)-Glu, Lysi-,Arg, Asni-Gln, and Phe4--)Trp4-Jyr. Modifications are made such that variants continue to possess the desired properties, e.g., being capable of specifically binding to a VEGF, more specifically, human VEGF, e.g., secreted by a cell or attached by a membrane or extracellular matrix component and having VEGF blocking activity, as described herein. Any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See EP Patent Application Publication No. 75,444.
[0113] Methods for measuring anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment thereof, binding specificity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobulin secretion by T cells or B
cells, T
cell proliferation assays, apoptosis assays, ELISA assays, and the like. See, for example, such assays disclosed in WO 93/14125; Shi el al., Immunity /3:633-642 (2000);
Kumanogohet al., J Immunol /69:1175-1181 (2002); Watanabe et al., J Immunol /67:4321-4328 (2001); Wang et al., Blood 97:3498-3504 (2001); and Giraudonet al., J
Immunol 172(2):1246-1255 (2004).
[0114] The % identity of a polypeptide discussed herein can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT
program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711).
BESTFIT
uses the local homology algorithm of Smith and Waterman (1981) Adv. App!.
Math.
2:482-489, to find the best segment of homology between two sequences. When using BESTFIT or any other sequence alignment program to determine whether a particular sequence is, for example, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
[0115] For purposes of the present invention, percent sequence identity may be determined using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. The Smith-Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv.
App!. Math. 2:482-489. A variant may, for example, differ from a reference anti-VEGF
antibody (e.g, 1VIAb 7392, comprising the variable region sequences of SEQ ID
NO:41 and SEQ ID NO:42) by 5 or fewer amino acid residues, e.g., in the light or heavy chain framework regions.
[0116] The precise chemical structure of a polypeptide capable of specifically binding VEGF and retaining the desired VEGF blocking activity depends on a number of factors.
As ionizable amino and carboxyl groups are present in the molecule, a particular polypeptide may be obtained as an acidic or basic salt, or in neutral form. All such preparations that retain their biological activity when placed in suitable environmental conditions are included in the definition of anti-VEGF antibodies as used herein. Further, the primary amino acid sequence of the polypeptide may be augmented by derivatization using sugar moieties (glycosylation) or by other supplementary molecules such as lipids, phosphate, acetyl groups and the like. It may also be augmented by conjugation with saccharides.
Certain aspects of such augmentation are accomplished through post-translational processing systems of the producing host; other such modifications may be introduced in vitro. In any event, such modifications are included in the definition of an anti-VEGF
antibody used herein so long as the desired properties of the anti-VEGF
antibody are not destroyed. It is expected that such modifications may quantitatively or qualitatively affect the activity, either by enhancing or diminishing the activity of the polypeptide, in the various assays. Further, individual amino acid residues in the chain may be modified by oxidation, reduction, or other derivatization, and the polypeptide may be cleaved to obtain fragments that retain activity. Such alterations that do not destroy the desired properties (e.g., binding specificity for VEGF, binding affinity, and VEGF
blocking activity) do not remove the polypeptide sequence from the definition of anti-VEGF
antibodies of interest as used herein.
[0117] The art provides substantial guidance regarding the preparation and use of polypeptide variants. In preparing the anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment thereof, variants, one of skill in the art can readily determine which modifications to the native protein's nucleotide or amino acid sequence will result in a variant that is suitable for use as a therapeutically active component of a pharmaceutical composition used in the methods of the present invention.
[0118] The constant region of an anti-VEGF antibody may be mutated to alter effector function in a number of ways. For example, see U.S. Pat. No. 6,737,05681 and U.S.
Patent Application Publication No. 2004/0132101A1, which disclose Fc mutations that optimize antibody binding to Fc receptors.
[0119] In certain anti-VEGF antibodies, the Fc portion may be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region may be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. The resulting physiological profile, bioavailability and other biochemical effects of the modifications, such as tumor localization, biodistribution and serum half-life, may easily be measured and quantified using well known immunological techniques without undue experimentation.
[0120] Anti-VEGF antibodies of the invention also include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate epitope.
For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, etc. Additionally, the derivative may contain one or more non-classical amino acids.
[0121] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid. glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a VEGF polypeptide).
[01221 For example, it is possible to introduce mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations may be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen.
These types of mutations may be useful to optimize codon usage, or improve a hybridoma's antibody production. Alternatively, non-neutral missense mutations may alter an antibody's ability to bind antigen. The location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement. One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity). Following mutagenesis, the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of a VEGF polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
[0123] In certain embodiments, the anti-VEGF antibodies of the invention are generated, e.g., by V-gene replacement. V-gene replacement involves the use of a human monoclonal antibody discover platform, e.g., as described in US 2002-0123057 Al, based on the monoclonal expression of recombinant antibodies in mammalian cells. As described in US 2002-0123057 Al, separate libraries of human heavy and light chain immunoglobulin variable genes have been constructed in a vaccinia virus-based vector by the method of "Trimolecular Recombination."
Plasmid vectors incorporating constant regions of human heavy chain secreted gamma 1, human heavy chain membrane bound gamma 1, or human light chain were constructed to accommodate cloning human Ig variable region gene segments (VI-1, Vic and Vk) in frame. These vectors are based on the plasmid pH5/tk, in which a vaccinia early/late promoter and multiple cloning sites were inserted into the viral tk gene. The multiple cloning sites were modified appropriately in order to clone in a modified Ig secretory signal peptide and the constant regions of yl- secreted or yl- membrane immunoglobulin heavy chains, and x immunoglobulin light chains. The resulting vectors retain unique cloning sites for inserting the VH and Vic variable region genes. Throughout this description Vie is referred to as VL.
[01241 In order to take advantage of the increased diversity generated by random pairing of different heavy and light chains, independent libraries of heavy and light chains were constructed, allowing generation of libraries of sufficient complexity that appropriate VH/VL combinations would occur at a frequency that permits efficient isolation of antibodies with a desired specificity and affinity. The independent assortment of germline V (D) and J segments, as well as the random combinatorial association of VL
and VH, provides substantial diversity. Further diversification occurs during the response to antigen by the process of somatic mutation. To take advantage of all diversification processes, libraries produced from four different human B cell sources can be used: 1) commercially obtained bone marrow-derived mRNA from large donor pools, 2) commercially available peripheral blood B cells isolated from cancer patients 3) commercially available peripheral blood B cells, and Bone Marrow from autoimmune patients (ex. Lupus), and 4) tonsil-derived germinal center B cells. Because heavy and light chains are randomly re-assorted in this system, it is possible to generate novel specificities that are more diverse than those of the antigen-driven B cells from which these V genes derive. Somatic hypermutation in the germinal centers and selection resulting from the disease states of the B cell donors contributes greatly to V gene diversity.
101251 Mammalian cells infected with vaccinia immunoglobulin gene recombinant vectors produce fully functional, bivalent antibodies. As outlined above, Ig-H
libraries have been generated in a vaccinia expression vector that encodes the secretory form of the human gamma 1 heavy chain constant region. Co-infection of cells with these immunoglobulin heavy chain gene libraries and light chain libraries results in expression, assembly and secretion of bivalent IaGI/L antibodies, permitting screening by ELISA. By infecting host cells with multiplicity of infection (moi) 1 for both Ig-H and Ig-L vaccinia recombinants, each cell is on average infected with one Ig-11 and one Ig-L
recombinant vaccinia virus and thus expresses a single monoclonal antibody.
[0126] Hybridoma technology has been used to identify a number of rodent antibodies with specificity, affinity and functional activity towards important drug targets.
For drug development these antibodies are often chimerized or humanized, with the attendant risk of immunogenicity and potential loss of affinity. The V gene replacement strategy has been applied to use of vaecinia virus expressed antibody libraries for conversion of rodent antibodies into fully human or mostly human antibodies.
101271 The concept of V gene replacement in this application is to use a non-human antibody as a template and, through a two-step process, to identify human V genes that can replace the non-human V genes, while still retaining affinity and epitope specificity.
The V gene replacement method is thus an alternative to traditional CDR grafted humanization. This method has several advantages compared to the more traditional humanization methods:
(i) V gene replacement results in the selection of fully human antibodies, while retaining the epitope specificity of the non-human MAb. In principle, these antibodies should have a lower risk of immunogenicity compared to CDR grafted and framework modified antibodies that retain significant amounts of marine sequences.
(ii) V gene replacement results in the selection of multiple antibodies.
This allows for the selection of lead antibodies derived from distinct VII
and VL germline genes with different biochemical properties including CDR sequences, expression levels, pl, etc.
(iii) V gene replacement can result in the selection of antibodies with better affinity and functional activity than the original non-human antibody.
[01281 In the first step of the V gene replacement method, the V genes from the non-human antibody are isolated and engineered to create chimeric heavy and light chains. The non-human Ig-H is paired with a library of human lg-L and screened for specific binding to antigen. This initial selection yields a panel of hybrid antibodies comprising chimeric Ig-H and human Ig-L. The selected human Ig-Ls are then paired with a library of human Ig-H and selected for binding to antigen. Parallel selections can also be carried out starting with the non-human Ig-L to select human Ig-I-I, and then using the selected Ig-H to select human Ig-L. The human Ig-L selected with the chimeric Ig-H, and the human Ig-H
selected with the chimeric Ig-L can also be cross-paired. The end result of these selection strategies is that panels of human antibodies that bind to the same antigen as the original non-human antibody are isolated. In most cases, the selected human antibodies recognize the same epitope as the original non-human antibody. If necessary, the first generation human antibodies can be affinity improved through either additional rounds of V gene replacement, or through mutagenesis 101291 Anti-VEGF antibodies (e.g., MAb 7392) may be selected based on the sustained or improved binding affinity and/or anti-VEGF activity that is imparted to an anti-VEGF
antibody compared to a humanized or murine antibody to VEGF. "Anti-VEGF
activity"
or "VEGF blocking activity" can include activity that modulates one or more of the following activities associated with VEGF: angiogenesis; binding to cell VEGF
receptors, including VEGFR1 and VEGFR2; modulating phosphorylation of VEGFR2; or any other activity association with soluble VEGF or VEGF that is bound, e.g., to the extracellular matrix. Anti-VEGF activity can also be attributed to a decrease in incidence or severity of diseases associated with VEGF expression, including, but not limited to, various types of neoplastic disorders, including solid tumors and hematological malignancies, autoimmune diseases, intraocular diseases, and inflammatory diseases.
Further optimizing modifications may involve replacement of amino acid residues within one or more CDR and/or framework region such that an anti-VEGF antibody retains specificity for the VEGF antigen and has improved binding affinity and/or improved anti-VEGF
activity.
VI. Treatment Methods Using Therapeutic Anti-SEMA4D and Anti-VEGF Antibodies [01301 Methods of the invention are directed to the use of anti-SEMA4D or anti-Plexin-BI and anti-VEGF or anti-VEGFR2 binding molecules, e.g., antibodies, including antigen-binding fragments, variants, and derivatives thereof, to inhibit angiogenesis in a subject in need of such inhibition, i.e., a cancer patient or patient with wet age-related macular degeneration (AMD). Though the following discussion refers to administration of an anti-SEMA4D and anti-VEGF antibody, the methods described herein are equally applicable to the antigen-binding fragments, variants, and derivatives of these antibodies that retain the desired properties of the antibodies of the invention, e.g., capable of specifically binding SEMA4D or VEGF, human, mouse, or human and mouse SEMA4D or VEGF, having SEMA4D or VEGF neutralizing activity, and/or blocking the interaction of SEMA4D and VEGF with its receptors. In some embodiments, bispecific antibodies may be used. A bispecific antibody is an artificial protein that is composed of fragments of two different monoclonal antibodies and consequently binds to two different types of antigen. In an embodiment, one arm (i.e., Fab region) of the antibody is capable of specifically binding SEMA4D and the other arm is capable of specifically binding VEGF. Variations on the bispecific antibody format are contemplated within the scope of the present invention. Bispccific antibodies may be generated using techniques that are well known in the art for example, see, for example, Ghayur et at., Expert Review of Clinical Pharmacology3.4 (July 2010): p491;Lu et al., J. Biological Chemistry Vol. 280, No. 20, p. 19665-19672 (2005); Marvin et at., Acta Pharmacologic Sinica 26(6):649-658 (2005); and Milstein C, et at., Nature 1983; 305: 537-40; 30 Brennan M, et at., Science 1985; 229: 81-3; Thakur et al., CurrOpinMolTher. 2010 Jun;12(3):340-9; and U.S.
Patent Publication No. 2007/0004909.
101311 It should also be appreciated that the methods described herein are also applicable to the substitution of anti-Plexin-B1 binding molecules for anti-SEMA4D antibody and/or the substitution of anti-VEGFR2 binding molecules for anti-VEGF antibody. In some embodiments, an anti-Plexin-Bl binding molecule can be used to inhibit the interaction of SEMA4D with Plexin-B I by blocking binding of SEMA4D to Plexin-BI and/or by preventing activation of Plexin-B I by SEMA4D. In other embodiments, an anti-binding molecule can be used to inhibit the interaction of VEGF and VEGFR2 by blocking binding of VEGF to its receptor (i.e., VEGFR2). It should be noted that any combination of anti-SEMA4D or anti-Plexin-B I and anti-VEGF or anti-VEGFR2 binding molecules can be used to inhibit angiogenesis. In one embodiment, an anti-SEMA4D and anti-VEGF binding molecule can be used. In another embodiment, an anti-SEMA4D
and anti-VEGFR2 binding molecule can be used. In another embodiment, an anti-Plexin-B I
and anti-VEGFR2 binding molecule can be used. In another embodiment, an anti-Plexin-B1 and anti-VEGF binding molecule can be used. In each of the above embodiments, the two recited binding specificities may be combined either as separate bivalent antibodies or in the separate univalent arms of a bispecific antibody.
101321 In one embodiment, treatment includes the application or administration of an anti-SEMA4D and anti-VEGF binding molecule, e.g., an antibody or antigen binding fragment thereof as described herein to a patient, or application or administration of the anti-SEMA4D and anti-VEGF binding molecule to an isolated tissue or cell line from a patient, where the patient has a disease, a symptom of a disease, or a predisposition toward a disease. In another embodiment, treatment is also intended to include the application or administration of a pharmaceutical composition comprising the anti-SEMA4D and anti-VEGF binding molecules. e.g., an antibody or antigen binding fragment thereof to a patient, or application or administration of a pharmaceutical composition comprising the anti-SEMA4D and anti-VEGF binding molecule to an -4] -isolated tissue or cell line from a patient, where the patient has a disease, a symptom of a disease, or a predisposition toward a disease 101331 The anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or binding fragments thereof as described herein are useful for the treatment of various malignant and non-malignant tumors, inparticular the inhibition of angiogenesisthat supports growth of a primary tumor or inhibition of metastases. By "anti-tumor activity" is intended a reduction in the rate of SEMA4D and VEGF production or accumulation associated directly with the tumor or indirectly with stromal cells of the tumor environment, and hence a decline in growth rate of an existing tumor or in a tumor that arises during therapy, and/or destruction of existing neoplastic (tumor) cells or newly formed neoplastic cells, and hence a decrease in the overall size of a tumor and/or the number of metastatic sites during therapy. For example, therapy with at least one anti-SEMA4D and one anti-VEGF antibody causes a physiological response, for example, a reduction in angiogenesis, that is beneficial with respect to treatment of disease states associated with SEMA4D and VEGF-expressing cells in a human.
101341 In one embodiment, the invention relates to the use of anti-SEMA4D and anti-VEGF
binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, as a medicament, in particular for use in the treatment or prophylaxis of cancer or for use in a precancerous condition or lesion to inhibit, reduce, prevent, or minimalize the formation of new blood vessels. In certain embodiments, an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or binding fragment thereof, of thepresent invention can also be used to inhibit angiogenesis for the treatment of pathological conditions dependent upon the formation of new blood vessels, including tumor development and macular degeneration. Angiogenesis is a complex multistep morphogenetic event during which endothelial cells, stimulated by major determinants of vascular remodeling, dynamically modify their cell-to-cell and cell-to-matrix contacts and move directionally to be reorganized into a mature vascular tree (Bussolinoet al., Trends Biochem Sci. 22:251-256 (1997); Risau, Nature 386:671-674 (1997); Jain, Nat.
Med.
9:685-693 (2003)). The formation of new blood vessels is a key step during embryo development, but it also occurs in adults in physiologic and in pathologic conditions, such as retinopathy, rheumatoid arthritis, ischemia, and particularly tumor growth and metastasis (Camehet. Nat. Med. 9:653-660 (2003)). This pathological formation of new blood vessels is also herein referred to as "invasive angiogenesis."
101351 In accordance with the methods of the present invention, at least one anti-SEMA4D and one anti-VEGF binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof, as defined elsewhere herein can be used to promote a positive therapeutic response with respect to a malignant human cell. By "positive therapeutic response" with respect to cancer treatment is intended an improvement in the disease in association with the anti-tumor activity of these binding molecules, e.g., antibodies or fragments thereof, and/or an improvement in the symptoms associated with the disease.
That is, a decrease in tumor vasculature, a reduction in tumor size, an anti-proliferative effect, the prevention of further tumor outgrowths, a reduction in the number of cancer cells, and/or a decrease in one or more symptoms associated with the disease can be observed. In particular, the methods provided herein are directed to inhibiting, preventing, reducing, alleviating, or lessening the formation of new blood cellsand/or new metastatic sites in a patient. In addition to these positive therapeutic responses, the subject undergoing therapy with the anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, may experience the beneficial effect of an improvement in the symptoms associated with the disease.
101361 Tumor response can be assessed for changes in tumor morphology (i.e., overall tumor burden, tumor cell count, and the like) using screening techniques such as bioluminescent imaging, for example, luciferase imaging, bone scan imaging, and tumor biopsy sampling including bone marrow aspiration (BMA). In addition to these positive therapeutic responses, the subject undergoing therapy with the anti-SEMA4D and anti-VEGF
binding molecules, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof, can experience the beneficial effect of an improvement in the symptoms associated with the disease.
[01371 Clinical response can be assessed using screening techniques such as magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, flow cytometry or fluorescence-activated cell sorter (FACS) analysis, histology, gross pathology, and blood chemistry, including but not limited to changes detectable by ELISA, RIA, chromatography, and the like.
(0138] The anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies or antigen binding fragments, variants, or derivatives thereof can be used in combination with at least one or more other cancer therapy agents. including, but not limited to, surgery or surgical procedures (e.g. splenectomy, hepatectomy, lymphadenectomy, leukophoresis, bone marrow transplantation, and the like); radiation therapy; chemotherapy, optionally in combination with autologous bone marrow transplant, or other cancer therapy;
where the additional cancer therapy is administered prior to, during, or subsequent to the anti-SEMA4D and anti-VEGF binding molecules, e.g., antibody or antigen binding fragment, variant, or derivative thereof, therapy. Thus, where the combined therapies comprise administration of an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody or antigen binding fragment, variant, or derivative thereof, in combination with administration of another therapeutic agent, as with chemotherapy, radiation therapy, other anti-cancer antibody therapy, small molecule-based cancer therapy, or vaccine/immunotherapy-based cancer therapy, the methods of the invention encompass co-administration, using separate formulations or a single pharmaceutical formulation, with simultaneous or consecutive administration in either order.
VII. Pharmaceutical Compositions and Administration Methods [0139] Methods of preparing and administering anti-SEMA4D and anti-VEGF
binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof to a subject in need thereof are well known to or are readily determined by those skilled in the art. The route of administration of the anti-SEMA4D binding molecule, e.g, antibody, or antigen-binding fragment, variant, or derivative thereof, can be, for example, oral, parenteral, by inhalation or topical. The term parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal administration. While all these forms of administration are clearly contemplated as being within the scope of the invention, an example of a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip.
A suitable pharmaceutical composition for injection can comprise a buffer (e.g. acetate, phosphate or citrate buffer), a surfactant (e.g. polysorbate), optionally a stabilizer agent (e.g. human albumin), etc. However, in other methods compatible with the teachings herein, anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
10140] As discussed herein, anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof can be administered in a pharmaceutically effective amount for the in vivo treatment of diseases such as neoplastic disorders, including solid tumors. In this regard, it will be appreciated that the disclosed binding molecules can be formulated so as to facilitate administration and promote stability of the active agent. In certain embodiments, pharmaceutical compositions in accordance with the present invention comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
For the purposes of the instant application, a pharmaceutically effective amount of an anti-SEMA4D and anti-VEGF binding molecules, e.g., an antibody, or antigen-binding fragment, variant, or derivative thereof, shall be held to mean an amount sufficient to achieve effective binding to a target and to achieve a benefit, i.e., to inhibit angiogenesis in a cancer patient.
[0141] The pharmaceutical compositions used in this invention comprise pharmaceutically acceptable carriers, including, e.g., ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethyleellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, and wool fat.
101421 Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include, e.g., water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. In the subject invention, pharmaceutically acceptable carriers include, but are not limited to, 0.01-0.1 M and preferably 0.05 M phosphate buffer or 0.8% saline. Other common parenteral vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
101431 More particularly, pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In such cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
[01441 Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example. parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
[0145] In any ease, sterile injectable solutions can be prepared by incorporating an active compound (e.g., an anti-SEMA4D or anti-VEGF antibody, or antigen-binding fragment, variant, or derivative thereof, by itself or in combination with other active agents) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying, which yields a powder of an active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit. Such articles of manufacture can have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to a disease or disorder.
[0146] Parenteral formulations can be a single bolus dose, an infusion or a loading bolus dose followed with a maintenance dose. These compositions can be administered at specific fixed or variable intervals, e.g., once a day, or on an "as needed" basis.
101471 Certain pharmaceutical compositions used in this invention can be orally administered in an acceptable dosage form including, e.g., capsules, tablets, aqueous suspensions or solutions. Certain pharmaceutical compositions also can be administered by nasal aerosol or inhalation. Such compositions can be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
[0148] The amount of an anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody, or fragment, variant, or derivative thereof, to be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration. The composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
[0149] In keeping with the scope of the present disclosure, anti-SEMA4D
antibodies, or antigen-binding fragments, variants, or derivatives thereof can be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic effect. The anti-SEMA4D antibodies, or antigen-binding fragments, variants or derivatives thereof can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables. Those skilled in the art will further appreciate that a cocktail comprising one or more species of anti-SEMA4D and anti-VEGF binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof, of the invention can be used.
[0150] By "therapeutically effective dose or amount'' or "effective amount" is intended an amount of anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or antigen binding fragment, variant, or derivative thereof, that when administered brings about a positive therapeutic response with respect to treatment of a patient with a disease to he treated, e.g., an inhibition of angiogenesis in the patient.
[0151] Therapeutically effective doses of the compositions of the present invention, for the inhibition of angiogenesis, vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In certain embodiments the patient is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages may be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
[01521 The amount of at least one anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or binding fragment, variant, or derivative thereof to be administered is readily determined by one of ordinary skill in the art without undue experimentation given the disclosure of the present invention. Factors influencing the mode of administration and the respective amount of at least one anti-SEMA4D and one anti-VEGF binding molecule, e.g., antibody, antigen-binding fragment, variant or derivative thereof include, but are not limited to, the severity of the disease, the history of the disease, the potential for angiogenesis, and the age, height, weight, health, and physical condition of the individual undergoing therapy. Similarly, the amount of anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody, or fragment, variant, or derivative thereof, to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent.
[01531 The invention also provides for the use of an anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody of the invention, or antigen-binding fragment, variant, or derivative thereof, in the manufacture of a medicament for treating a subject for treating a cancer, wherein the medicament is used in a subject that has been pretreated with at least one other therapy. By "pretreated" or "pretreatment" is intended the subject has received one or more other therapies (e.g., been treated with at least one other cancer therapy) prior to receiving the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, e.g., antibody or antigen-binding fragment, variant, or derivative thereof.
"Pretreated" or "pretreatment" includes subjects that have been treated with at least one other therapy within 2 years, within 18 months, within I year, within 6 months, within 2 months, within 6 weeks, within 1 month, within 4 weeks, within 3 weeks, within 2 weeks, within 1 week, within 6 days, within 5 days, within 4 days, within 3 days, within 2 days, or even within 1 day prior to initiation of treatment with the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, for example, the monoclonal antibody VX15/2503 disclosed herein, or antigen-binding fragment, variant, or derivative thereof.
It is not necessary that the subject was a responder to pretreatment with the prior therapy or therapies. Thus, the subject that receives the medicament comprising the anti-SEMA4D and anti-VEGF binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof could have responded, or could have failed to respond (e.g., the cancer was refractory), to pretreatment with the prior therapy, or to one or more of the prior therapies where pretreatment comprised multiple therapies.
Examples of other cancer therapies for which a subject can have received pretreatment prior to receiving the medicament comprising the anti-SEMA4D and anti-VEGF
binding molecule, e.g., antibody or antigen-binding fragment. variant, or derivative thereof include, but are not limited to, surgery; radiation therapy; chemotherapy, optionally in combination with autologous bone marrow transplant, where suitable chemotherapeutic agents include, but are not limited to, those listed herein above; other anti-cancer monoclonal antibody therapy; small molecule-based cancer therapy, including, but not limited to, the small molecules listed herein above; vaccine/immunotherapy-based cancer therapies; steroid therapy; other cancer therapy; or any combination thereof.
101541 The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture. molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Sambrook et at., ed. (1989) Molecular Cloning A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press); Sambrook et at., ed. (1992) Molecular Cloning: A Laboratory Manual, (Cold Springs Harbor Laboratory, NY); D. N. Glover ed., (1985) DNA Cloning, Volumes I and II: Gait, ed. (1984) Oligonucleotide Synthesis; Mullis et at. U.S. Pat.
No. 4,683,195;
Hames and Higgins, eds. (1984) Nucleic Acid Hybridization; Hames and Higgins, eds.
(1984) Transcription And Translation; Freshney (1987) Culture Of Animal Cells (Alan R.
Liss, Inc.); Immobilized Cells And Enzymes (IRL Press) (1986): Perbal (1984) A
Practical Guide To Molecular Cloning; the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Miller and Cabs eds. (1987) Gene Transfer Vectors For Mammalian Cells, (Cold Spring Harbor Laboratory); Wu et at., eds., Methods In Enzymology, Vols.
154 and 155; Mayer and Walker, eds. (1987) Immunochemical Methods In Cell And Molecular Biology (Academic Press, London); Weir and Blackwell, eds., (1986) Handbook Of Experimental Immunology, Volumes I-1V; Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring harbor, N.Y., (1986);
and in Ausubel et at. (1989) Current Protocols in Molecular Biology (John Wiley and Sons, Baltimore, Md.).
[0155] General principles of antibody engineering are set forth in Borrebaeck, ed. (1995) Antibody Engineering (2nd ed.; Oxford Univ. Press). General principles of protein engineering are set forth in Rickwood et at., eds. (1995) Protein Engineering, A Practical Approach (IRL Press at Oxford Univ. Press, Oxford, Eng.). General principles of antibodies and antibody-hapten binding are set forth in: Nisonoff (1984) Molecular Immunology (2nd ed.; Sinauer Associates, Sunderland, Mass.); and Steward (1984) Antibodies, Their Structure and Function (Chapman and Hall, New York, N.Y.).
Additionally, standard methods in immunology known in the art and not specifically described are generally followed as in Current Protocols in Immunology, John Wiley &
Sons, New York; Stites et al.. eds. (1994) Basic and Clinical Immunology (8th ed:
Appleton & Lange, Norwalk, Conn.) and Mishell and Shiigi (eds) (1980) Selected Methods in Cellular Immunology (W.H. Freeman and Co.. NY).
[0156] Standard reference works setting forth general principles of immunology include Current Protocols in Immunology, John Wiley & Sons, New York; Klein (1982) J., Immunology:
The Science of Self-Nonself Discrimination (John Wiley & Sons, NY); Kennett et al., eds. (1980) Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses (Plenum Press, NY); Campbell (1984) "Monoclonal Antibody Technology"
in Laboratory Techniques in Biochemistry and Molecular Biology, ed. Burden et al., (Elsevere, Amsterdam); Goldsby et al., eds. (2000) KubyImmunnology (4th ed.;
H.
Freemand& Co.); Roitt et al. (2001) Immunology (6th ed.; London: Mosby); Abbas et al.
(2005) Cellular and Molecular Immunology (5th ed.; Elsevier Health Sciences Division);
Kontermann and Dubel (2001) Antibody Engineering (Springer Verlan); Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press);
Lewin (2003) Genes VIII (Prentice Hal12003); Harlow and Lane (1988) Antibodies: A
Laboratory Manual (Cold Spring Harbor Press); Dieffenbach and Dveksler (2003) PCR
Primer (Cold Spring Harbor Press).
[0157] DELETED
[0158] The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
[0159] The following examples demonstrate the efficacy of anti-SE1VIA4D
antibody VX15/2503 and anti-VEGF antibody on inhibiting the growth of H1\16 head and neck tumors in mice.
Example 1: Experimental Design [0160] The basic experimental design is as follows. Tumor cells were implanted subcutaneously into both flanks ofathymicnude mice. The tumor bearing nude micewere divided into four groups of seven mice each with each mouse having two tumors. The first group (control group) was treated with IgGisotype control MAb2955. The second group was treated withanti-SEMA4D antibody VX15/2503. The third group was treated with an anti-VEGF
antibody (Mouse IgG2A MAb 2931, which is a human VEGF MAb, Mouse IgG2A, Catalog # MAB2931; R&D Systems).The fourth group was treated with a combination of anti-SEMA4D antibody (VX15/2503) and anti-VEGF antibody (Mouse IgG2A MAb 2931). The treatment started two days post tumor graft. Mice were treated once a week with 1.0 mg (approximately 50 mg/kg) of monoclonal antibody via intraperitoneal (IP) injection for three weeks.
Example 2: Primary Tumor Growth [0161] Primary tumor growth was measured by calipers up to sacrifice, which measurements were used to calculate tumor volume. The animals treated with VX15/2503 alone showed a reduction in primary tumor volume at the time of sacrifice over the control animals, with the difference being statistically significant (P<0.0001). The animals treated with anti-VEGF(Mouse IgG2A MAb 2931) alone also showed a reduction in primary tumor volume at the time of sacrifice over the control animals, with the difference being statistically significant (P<0.0001). In addition, an additive effect on reduction of the tumor volume was seen when anti-SEMA4D antibody (VX15/2503) was used in combination with anti-VEGF antibody, with the difference being statistically significant (P<0.0001). Statistical analysis was conducted using Two-way Analysis of Variance (ANOVA), comparing tumor growth in each group to control antibody. T-test of final tumor volumes of resected tumors also resulted in statistically significant differences (P<0.0001). The results are shown in FIG. 1, which shows the mean tumor volume among the four groups. FIG. 2 shows representative photographs for the extracted tumors.
Example 3: Primary Tumor Vascular Density [0162] The vascular density of the tumors was also measured. Vascular density was measured as vessels per 10 hpf (high power field). Treatment with either VX15/2503 or anti-VEGF
(Mouse IgG2A MAb 2931) individually resulted in a decrease in vascular density, as compared to the control group. Treatment with anti-SEMA4D antibody (VX15/2503) in combination with anti-VEGF antibodyresulted in a greater reduction in vascular density ("P<0.01), as compared to the control group as well as either VX15/2503 (*P<0.05) or anti-VEGF (*P<0.05) alone. The results are shown graphically in FIG. 3.
[0163] Many modifications and other embodiments of the inventions set forth herein will come to mind to one skilled in the art to which these inventions pertain having the benefit of the teachings presented in the foregoing descriptions and the associated drawings.
Therefore, it is to be understood that the inventions are not to be limited to the specific embodiments disclosed and that modifications and other embodiments are intended to be included within the scope of the appended claims and list of embodiments disclosed herein.
Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
Claims (17)
OR PRIVILEGE IS CLAIMED ARE DEFINED AS FOLLOWS:
1. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which specifically binds to vascular endothelial growth factor (VEGF) and inhibits VEGF binding to the vascular endothelial growth factor receptor-2 (VEGFR2) for inhibiting angiogenesis in a subject.
2. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which specifically binds to vascular endothelial growth factor (VEGF) and inhibits VEGF binding to the vascular endothelial growth factor receptor-2 (VEGFR2), for treating cancer in a subject, wherein the first antibody or fragment thereof and second antibody or fragment thereof act to inhibit angiogenesis.
3. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which inhibits interaction of vascular endothelial growth factor (VEGF) with vascular endothelial growth factor receptor-2 (VEGFR2) for inhibiting angiogenesis in a subject.
4. The use of claim 3, wherein the second antibody or fragment thereof is selected from the group consisting of an anti-VEGF and an anti-VEGFR2 antibody or fragment thereof.
5. The use of any one of claims 1 to 4, wherein the first antibody or fragment thereof inhibits SEMA4D interaction with plexin-B1.
6. The use of any one of claims 1 to 5, wherein the first antibody or fragment thereof inhibits SEMA4D-mediated plexin-B1 signal transduction.
7. The use of any one of claims 1 to 6, wherein the VH of the first antibody or fragment thereof comprises an amino acid sequence at least 90% identical to SEQ ID NO: 9 or SEQ ID NO: 10, and the VL of the first antibody or fragment thereof comprises an amino acid sequence at least 90% identical to SEQ ID NO: 17 or SEQ ID NO: 18.
8. The use of claim 7, wherein the VH of the first antibody or fragment thereof comprises the amino acid sequence SEQ ID NO: 9 or SEQ ID NO: 10, and the VL of the first antibody or fragment thereof comprises the amino acid sequence SEQ ID NO: 17 or SEQ ID
NO: 18.
NO: 18.
9. The use of any one of claims 1 to 8, wherein the second isolated antibody or antigen-binding fragment thereof inhibits phosphorylation of VEGFR2 by VEGF.
10. The use of any one of claims 1 to 9, wherein the inhibition of angiogenesis occurs independently of metastases inhibition.
11. The use of any one of claims 1 and 3 to 10, wherein the subject has cancer.
12. The use of claim 2 or claim 11, wherein the cancer is selected from the group consisting of sarcoma, breast, ovarian, head and neck, pancreatic, prostate, lung, kidney, colorectal, brain, gastric, bladder, esophageal and a combination thereof.
13. The use of any one of claims 1 and 3 to 10, wherein the subject has wet age-related macular degeneration (AMD).
14. The use of any one of claims 1 to 13, wherein the first antibody or fragment thereof and the second antibody or fragment thereof are for separate or concurrent administration.
15. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which specifically binds to vascular endothelial growth factor (VEGF) and inhibits VEGF binding to the vascular endothelial growth factor receptor-2 (VEGFR2) in the manufacture of a medicament for inhibiting angiogenesis in a subject.
16. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which specifically binds to vascular endothelial growth factor (VEGF) and inhibits VEGF binding to the vascular endothelial growth factor receptor-2 (VEGFR2), in the manufacture of a medicament for treating cancer in a subject, wherein the first antibody or fragment thereof and second antibody or fragment thereof act to inhibit angiogenesis.
17. Use of a first isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) polypeptide comprising VH-CDR1, VH-CDR2, and VH-CDR3 amino acid sequences comprising SEQ ID NOs: 6, 7, and 8, respectively, and a light chain variable region (VL) polypeptide comprising VL-CDR1, VL-CDR2, and VL-CDR3 amino acid sequences comprising SEQ ID NOs: 14, 15, and 16, respectively, wherein the first antibody or fragment thereof specifically binds to semaphorin-4D (SEMA4D), and an effective amount of a second isolated antibody or antigen-binding fragment thereof which inhibits interaction of vascular endothelial growth factor (VEGF) with vascular endothelial growth factor receptor-2 (VEGFR2) in the manufacture of a medicament for inhibiting angiogenesis in a subject.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161567531P | 2011-12-06 | 2011-12-06 | |
USUS61/567,531 | 2011-12-06 |
Publications (2)
Publication Number | Publication Date |
---|---|
CA2762446A1 CA2762446A1 (en) | 2013-06-06 |
CA2762446C true CA2762446C (en) | 2021-02-23 |
Family
ID=48570515
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA2762446A Active CA2762446C (en) | 2011-12-06 | 2011-12-15 | Use of the combination of semaphorin-4d inhibitory molecules and vegf inhibitory molecules to inhibit angiogenesis |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA2762446C (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
MX2015017485A (en) * | 2013-06-25 | 2016-03-31 | Vaccinex Inc | Use of semaphorin-4d inhibitory molecules in combination with an immune modulating therapy to inhibit tumor growth and metastases. |
WO2017148904A1 (en) * | 2016-02-29 | 2017-09-08 | Franz Grus | Predictive markers useful in the treatment of wet age-related macular degeneration |
-
2011
- 2011-12-15 CA CA2762446A patent/CA2762446C/en active Active
Also Published As
Publication number | Publication date |
---|---|
CA2762446A1 (en) | 2013-06-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8790652B2 (en) | Use of the combination of semaphorin-4D inhibitory molecules and VEGF inhibitory molecules to inhibit angiogenesis | |
JP7345578B2 (en) | Novel anti-PD-L1 antibody | |
US20240018257A1 (en) | Antibodies specific to human poliovirus receptor (pvr) | |
CA2916245C (en) | Use of semaphorin-4d inhibitory molecules in combination with an immune modulating therapy to inhibit tumor growth and metastases | |
US9676840B2 (en) | Anti-CD100 neutralizing antibodies and methods of using the same | |
JP7264592B2 (en) | IL13Rα2 BINDING AGENTS AND THEIR USE IN CANCER THERAPY | |
CN110914296B (en) | Engineered Fc fragments, antibodies comprising same and uses thereof | |
TWI774028B (en) | Anti-ALK2 antibody and its use | |
TW201834683A (en) | Combination therapy with targeted 4-1bb (cd137) agonists | |
JP5667067B2 (en) | Anti-TGF beta receptor II antibody | |
US8834883B2 (en) | Anti-VEGF antibodies and uses thereof | |
US9890213B2 (en) | Methods for the treatment of B cell-mediated inflammatory diseases | |
EP2638065A1 (en) | Actriia binding agents and uses thereof | |
JP2012508170A5 (en) | ||
WO2020006374A2 (en) | Anti-sirp-beta1 antibodies and methods of use thereof | |
CA2762446C (en) | Use of the combination of semaphorin-4d inhibitory molecules and vegf inhibitory molecules to inhibit angiogenesis | |
KR20220103709A (en) | Methods of treating cancer using an anti-OX40 antibody in combination with an anti-TIGIT antibody | |
JP7075135B2 (en) | How to Treat Cancer Using Bifunctional Molecules Targeting Growth Factors | |
US20220056120A1 (en) | Methods of treating ocular pathologies using bifunctional molecules that target growth factors | |
KR20220103105A (en) | Method for treating cancer using anti-OX40 antibody in combination with anti-TIM3 antibody | |
JP2024507124A (en) | Antibodies against CD112R and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request |
Effective date: 20161205 |