US20210355483A1 - Methods and kits using nucleic acid encoding and/or label - Google Patents
Methods and kits using nucleic acid encoding and/or label Download PDFInfo
- Publication number
- US20210355483A1 US20210355483A1 US16/760,032 US201816760032A US2021355483A1 US 20210355483 A1 US20210355483 A1 US 20210355483A1 US 201816760032 A US201816760032 A US 201816760032A US 2021355483 A1 US2021355483 A1 US 2021355483A1
- Authority
- US
- United States
- Prior art keywords
- tag
- recording
- binding
- coding
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1065—Preparation or screening of tagged libraries, e.g. tagged microorganisms by STM-mutagenesis, tagged polynucleotides, gene tags
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6804—Nucleic acid analysis using immunogens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2458/00—Labels used in chemical analysis of biological material
- G01N2458/10—Oligonucleotides as tagging agents for labelling antibodies
Definitions
- the present disclosure relates to sample analysis methods and kits employing nucleic acid encoding and/or nucleic acid recording of a molecular interaction and/or reaction, such as recognition events.
- the methods and kits are used in high-throughput, multiplexed, and/or automated analysis, and are suitable for analysis of a proteome or subset thereof.
- the repertoire of different protein molecules is extensive, much more complex than the transcriptome, due to additional diversity introduced by post-translational modifications (PTMs).
- PTMs post-translational modifications
- proteins within a cell dynamically change (in expression level and modification state) in response to the environment, physiological state, and disease state.
- proteins contain a vast amount of relevant information that is largely unexplored, especially relative to genomic information.
- innovation has been lagging in proteomics analysis relative to genomics analysis.
- next-generation sequencing NGS
- NGS next-generation sequencing
- a method comprising: (a) contacting a set of proteins, wherein each protein is associated directly or indirectly with a recording tag, with a library of agents, wherein each agent comprises (i) a small molecule, a peptide or peptide mimetic, a peptidomimetic (e.g., a peptoid, a ⁇ -peptide, or a D-peptide peptidomimetic), a polysaccharide, or an aptamer (e.g., a nucleic acid aptamer, such as a DNA aptamer, or a peptide aptamer), and (ii) a coding tag comprising identifying information regarding the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer, wherein each protein
- each protein is spaced apart from other proteins on the support at an average distance equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, equal to or greater than about 500 nm, equal to or greater than about 550 nm, equal to or greater than about 600 nm, equal to or greater than about 650 nm, equal to or greater than about 700 nm, equal to or greater than about 750 nm, equal to or greater than about 800 nm, equal to or greater than about 850 nm, equal to or greater than about 900 nm, equal to or greater than about 950 nm, or equal to or greater than about
- each protein and its associated recording tag can be spaced apart from other proteins and their associated recording tags on the support at an average distance equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, equal to or greater than about 500 nm, equal to or greater than about 550 nm, equal to or greater than about 600 nm, equal to or greater than about 650 nm, equal to or greater than about 700 nm, equal to or greater than about 750 nm, equal to or greater than about 800 nm, equal to or greater than about 850 nm, equal to or greater than about 900 nm, equal to or greater
- the agent may comprise a polypeptide, a peptide or modified peptide, a polysaccharide, a peptoid, a peptidomimetic, an aptamer, a small molecule, or another protein binding molecule, or any combination thereof.
- one or more of the proteins and/or their associated recording tags can be covalently immobilized to the support (e.g., via a linker), or non-covalently immobilized to the support (e.g., via a binding pair).
- a subset of the proteins and/or their associated recording tags can be covalently immobilized to the support while another subset of the proteins and/or their associated recording tags can be non-covalently immobilized to the support.
- one or more of the recording tags can be immobilized to the support, thereby immobilizing the associated protein(s).
- one or more of the proteins can be immobilized to the support, thereby immobilizing the associated recording tag(s).
- At least one protein can co-localize with its associated recording tag, while each is independently immobilized to the support.
- At least one protein and/or its associated recording tag can associate directly or indirectly with an immobilizing linker, and the immobilizing linker can be immobilized directly or indirectly to the support, thereby immobilizing the at least one protein and/or its associated recording tag to the support.
- the density of immobilized recording tags can be equal to or greater than the density of immobilized proteins.
- the density of immobilized recording tags is at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 50-fold, at least about 100-fold, or more, of the density of immobilized proteins.
- each protein and/or its associated recording tag can be immobilized directly or indirectly to the support.
- each agent can be immobilized directly or indirectly to the support.
- each agent can be spaced apart from other agents immobilized on the support at an average distance equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, equal to or greater than about 500 nm, equal to or greater than about 550 nm, equal to or greater than about 600 nm, equal to or greater than about 650 nm, equal to or greater than about 700 nm, equal to or greater than about 750 nm, equal to or greater than about 800 nm, equal to or greater than about 850 nm, equal to or greater than
- a subset of the agents can be covalently immobilized to the support while another subset of the agents can be non-covalently immobilized to the support.
- the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer can be immobilized to the support, thereby immobilizing the coding tag.
- peptidomimetic e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic
- polysaccharide, or aptamer can be immobilized to the support, thereby immobilizing the coding tag.
- the coding tag can be immobilized to the support, thereby immobilizing the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer.
- peptide or peptide mimetic e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic
- polysaccharide e.g., aminometic
- aptamer e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic
- information can be transferred from at least one coding tag to at least one recording tag, thereby generating at least one extended recording tag.
- information can be transferred from at least one recording tag to at least one coding tag, thereby generating at least one extended coding tag.
- At least one di-tag construct can be generated comprising information from the coding tag and information from the recording tag.
- At least one of the proteins can bind and/or react with the small molecules, peptides or peptide mimetics, peptidomimetics (e.g., peptoids, ⁇ -peptides, or D-peptide peptidomimetics), polysaccharides, or aptamers of two or more agents.
- the extended recording tag or the extended coding tag comprises identifying information regarding the small molecules, peptides or peptide mimetics, peptidomimetics (e.g., peptoids, ⁇ -peptides, or D-peptide peptidomimetics), polysaccharides, or aptamers of the two or more agents.
- At least one of the proteins can be associated with two or more recording tags, wherein the two or more recording tags can be the same or different.
- At least one of the agents can comprise two or more coding tags, wherein the two or more coding tags can be the same or different.
- the transfer of information can be accomplished by ligation (e.g., an enzymatic or chemical ligation, a splint ligation, a sticky end ligation, a single-strand (ss) ligation such as a ssDNA ligation, or any combination thereof), a polymerase-mediated reaction (e.g., primer extension of single-stranded nucleic acid or double-stranded nucleic acid), or any combination thereof.
- ligation e.g., an enzymatic or chemical ligation, a splint ligation, a sticky end ligation, a single-strand (ss) ligation such as a ssDNA ligation, or any combination thereof
- a polymerase-mediated reaction e.g., primer extension of single-stranded nucleic acid or double-stranded nucleic acid
- the ligation and/or polymerase-mediated reaction have faster kinetics relative to the binding occupancy time or reaction time between the protein and the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer, optionally wherein a reagent for the ligation and/or polymerase-mediated reaction is present in the same reaction volume as the binding or reaction between the protein and the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer.
- a reagent for the ligation and/or polymerase-mediated reaction is present in the same reaction volume as the binding or reaction between the protein and the small molecule, peptide or peptide mimetic, peptido
- each protein can associate with its recording tag via individual attachment, and/or wherein each small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer can associate with its coding tag via individual attachment.
- the attachment occurs via ribosome or mRNA/cDNA display in which the recording tag and/or coding tag sequence information is contained in the mRNA sequence.
- the recording tag and/or coding tag comprise a universal primer sequence, a barcode, and/or a spacer sequence at the 3′ end of the mRNA sequence.
- the recording tag and/or coding tag, at the 3′ end further comprise a restriction enzyme digestion site.
- the set of proteins can be a proteome or subset thereof, optionally wherein the set of proteins are produced using in vitro transcription of a genome or subset thereof followed by in vitro translation, or produced using in vitro translation of a transcriptome or subset thereof.
- the set of proteins can be a kinome; a secretome; a receptome (e.g., GPCRome); an immunoproteome; a nutriproteome; a proteome subset defined by a post-translational modification (e.g., phosphorylation, ubiquitination, methylation, acetylation, glycosylation, oxidation, lipidation, and/or nitrosylation), such as a phosphoproteome (e.g., phosphotyrosine-proteome, tyrosine-kinome, and tyrosine-phosphatome), a glycoproteome, etc.; a proteome subset associated with a tissue or organ, a developmental stage, or a physiological or pathological condition; a proteome subset associated a cellular process, such as cell cycle, differentiation (or de-differentiation), cell death, senescence, cell migration, transformation, or metastasis; or any subset thereof,
- the set of proteins can be from a mammal such as human, a non-human animal, a fish, an invertebrate, an arthropod, an insect, or a plant, a fungus, e.g., a yeast, a bacterium, e.g., E. coli , a virus, e.g., HIV or HCV, or a combination thereof.
- the set of proteins can comprise a protein complex or subunit thereof.
- the recording tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the recording tag can comprise a universal priming site.
- the recording tag can comprise a priming site for amplification, sequencing, or both, for example, the universal priming site comprises a priming site for amplification, sequencing, or both.
- the recording tag can comprise a unique molecule identifier (UMI).
- UMI unique molecule identifier
- the recording tag can comprise a barcode.
- the recording tag can comprise a spacer at its 3′-terminus.
- the support can be a solid support, such as a rigid solid support, a flexible solid support, or a soft solid support, and including a porous support or a non-porous support.
- the support can comprise a bead, a porous bead, a magnetic bead, a paramagnetic bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticles), quantum dots, a nanoshell, a nanocage, a microsphere, or any combination thereof.
- a nanoparticle e.g., comprising a metal such as magnetic nanoparticles (
- the support can comprise a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- the method can be used for parallel analysis of the interaction between the set of proteins and the library of small molecules, and/or peptides or peptide mimetics, and/or peptidomimetics (e.g., peptoids, ⁇ -peptides, or D-peptide peptidomimetics), and/or polysaccharides, and/or aptamers, in order to create a small molecule-protein binding matrix, and/or a peptide/peptide mimetic-protein binding matrix, and/or a peptidomimetic-protein binding matrix (e.g., a peptoid-protein binding matrix, a ⁇ -peptide-protein binding matrix, or a D-peptide peptidomimetic-protein binding matrix), and/or a polysaccharide-protein binding matrix, and/or an aptamer-protein binding matrix.
- peptides or peptide mimetics e.g., peptoids, ⁇ -peptides, or D-peptide
- the matrix size is of about 10 2 , about 10 3 , about 10 4 , about 10 5 , about 10 6 , about 10 7 , about 10 8 , about 10 9 , about 10 10 , about 10 11 , about 10 12 , about 10 13 , about 10 14 , or more, for example, of about 2 ⁇ 10 13 .
- the coding tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the coding tag can comprise an encoder sequence that identifies the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer.
- the coding tag can comprise a spacer, a unique molecular identifier (UMI), a universal priming site, or any combination thereof.
- UMI unique molecular identifier
- the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer and the coding tag can be joined by a linker or a binding pair.
- the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer and the coding tag can be joined by a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties), a SpyTag/SpyCatcher, a SnoopTag/SnoopCatcher peptide-protein pair, a sortase, such as a LPXTG Tag/Sortase (e.g., Sortase A5, ActiveMotif, San Diego, or as disclosed in U.S. Pat. No. 9,267,127 B2 which is incorporated herein by reference), or a HaloTag/HaloTag
- a method for analyzing a polypeptide comprising: (a) contacting (i) a set of fragments of a polypeptide, wherein each fragment is associated directly or indirectly with a recording tag, with (ii) a library of binding agents, wherein each binding agent comprises a binding moiety and a coding tag comprising identifying information regarding the binding moiety, wherein the binding moiety is capable of binding to one or more N-terminal, internal, or C-terminal amino acids of the fragment, or capable of binding to the one or more N-terminal, internal, or C-terminal amino acids modified by a functionalizing reagent, and wherein each fragment and/or its associated recording tag, or each binding agent, is immobilized directly or indirectly to a support; (b) allowing transfer of information between (i) the recording tag associated with each fragment and (ii) the coding tag, upon binding between the binding moiety and the one or more N-terminal, internal, or C-terminal amino acids of the fragment, to generate
- the one or more N-terminal, internal, or C-terminal amino acids comprise: (i) an N-terminal amino acid (NTAA); (ii) an N-terminal dipeptide sequence; (iii) an N-terminal tripeptide sequence; (iv) an internal amino acid; (v) an internal dipeptide sequence; (vi) an internal tripeptide sequence; (vii) a C-terminal amino acid (CTAA); (viii) a C-terminal dipeptide sequence; or (ix) a C-terminal tripeptide sequence, or any combination thereof, optionally wherein any one or more of the amino acid residues in (i)-(ix) are modified or functionalized.
- the one or more N-terminal, internal, or C-terminal amino acids are selected, independently at each residue, from the group consisting of Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr), in any combination thereof.
- Alanine A or Ala
- Cysteine C or Cys
- Aspartic Acid D or Asp
- Glutamic Acid
- the binding moiety can comprise a polypeptide or fragment thereof, a protein or polypeptide chain or fragment thereof, or a protein complex or subunit thereof, such as an antibody or antigen binding fragment thereof.
- the binding moiety can comprise an anticalin or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof; a ClpS or variant, mutant, or modified protein thereof; a UBR box protein or variant, mutant, or modified protein thereof; or a modified small molecule that binds amino acid(s), i.e. vancomycin or a variant, mutant, or modified molecule thereof; or any combination thereof.
- the binding moiety may selectively and/or specifically bind to a functionalized N-terminal amino acid (NTAA), an N-terminal dipeptide sequence, or an N-terminal tripeptide sequence, or any combination thereof.
- NTAA N-terminal amino acid
- a method for analyzing a plurality of polypeptides comprising: (a) labeling each molecule of a plurality of polypeptides with a plurality of universal tags; (b) contacting the plurality of polypeptides with a plurality of compartment tags, under a condition suitable for annealing or joining of the plurality of universal tags with the plurality of compartment tags, thereby partitioning the plurality of polypeptides into a plurality of compartments (e.g., a bead surface, a microfluidic droplet, a microwell, or a separated region on a surface, or any combination thereof), wherein the plurality of compartment tags are the same within each compartment and are different from the compartment tags of other compartments; (c) fragmenting the polypeptide(s) in each compartment, thereby generating a set of polypeptide fragments each associated with a recording tag comprising at least one universal polynucleotide tag and at least one compartment tag; (d) immobilizing
- the plurality of polypeptides with the same compartment tag belong to the same protein. In some embodiments, the plurality of polypeptides with the same compartment tag belong to different proteins, for example, two, three, four, five, six, seven, eight, nine, ten, or more proteins.
- the plurality of compartment tags can be immobilized to a plurality of substrates, with each substrate defining a compartment.
- the plurality of substrates are selected from the group consisting of a bead, a porous bead, a magnetic bead, a paramagnetic bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticle
- a nanoparticle e.g
- each of the plurality of substrates can comprise a barcoded particle, such as a bar-coded bead, e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- a bar-coded bead such as a bar-coded bead, e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- the support can be selected from the group consisting of a bead, a porous bead, a magnetic bead, a paramagnetic bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticles), quantum dots, a nanoshell, a nanocage, a microsphere, or any combination thereof.
- a nanoparticle e.g., comprising a metal such
- the support comprises a sequencing bead, e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- a sequencing bead e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- each fragment and its associated recording tag can be spaced apart from other fragments and their associated recording tags on the support at an average distance equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, equal to or greater than about 500 nm, equal to or greater than about 550 nm, equal to or greater than about 600 nm, equal to or greater than about 650 nm, equal to or greater than about 700 nm, equal to or greater than about 750 nm, equal to or greater than about 800 nm, equal to or greater than about 850 nm, equal to or greater than about 900 nm, equal to or
- a method for analyzing a plurality of polypeptides comprising: (a) immobilizing a plurality of polypeptides to a plurality of substrates, wherein each substrate comprises a plurality of recording tags each comprising a compartment tag, optionally wherein each compartment is a bead, a microfluidic droplet, a microwell, or a separated region on a surface, or any combination thereof; (b) fragmenting (e.g., by a protease digestion) the polypeptide(s) immobilized on each substrate, thereby generating a set of polypeptide fragments immobilized to the substrate; (c) contacting the immobilized set of polypeptide fragments with a library of binding agents, wherein each binding agent comprises a binding moiety and a coding tag comprising identifying information regarding the binding moiety, wherein the binding moiety is capable of binding to one or more N-terminal, internal, or C-terminal amino acids of the fragment, or capable of
- the plurality of polypeptides with the same compartment tag belong to the same protein. In some embodiments, the plurality of polypeptides with the same compartment tag belong to different proteins, for example, two, three, four, five, six, seven, eight, nine, ten, or more proteins.
- each substrate may define a compartment.
- the plurality of substrates can be selected from the group consisting of a bead, a porous bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticles), quantum dots, a nanoshell, a nanocage, a microsphere, or any combination thereof.
- a nanoparticle e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4
- each of the plurality of substrates can comprise a bar-coded particle, such as a bar-coded bead, e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- a bar-coded bead such as a bar-coded bead, e.g., a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a magnetic bead, a paramagnetic bead, a glass bead, or a controlled pore bead, or any combination thereof.
- the functionalizing reagent can comprise a chemical agent, an enzyme, and/or a biological agent, such as an isothiocyanate derivative, 2,4-dinitrobenzenesulfonic (DNBS), 4-sulfonyl-2-nitrofluorobenzene (SNFB) 1-fluoro-2,4-dinitrobenzene, dansyl chloride, 7-methoxycoumarin acetic acid, a thioacylation reagent, a thioacetylation reagent, or a thiobenzylation reagent.
- DNBS 2,4-dinitrobenzenesulfonic
- SNFB 4-sulfonyl-2-nitrofluorobenzene 1-fluoro-2,4-dinitrobenzene
- dansyl chloride 7-methoxycoumarin acetic acid
- a thioacylation reagent a thioacetylation reagent
- thioacetylation reagent a thio
- the recording tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the recording tag can comprise a universal priming site; a priming site for amplification, sequencing, or both; optionally, a unique molecule identifier (UMI); a barcode; optionally, a spacer at its 3′-terminus; or a combination thereof.
- UMI unique molecule identifier
- the method can be used for determining the sequence(s) of the polypeptide or plurality of polypeptides.
- the coding tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the coding tag can comprise an encoder sequence, an optional spacer, an optional unique molecular identifier (UMI), a universal priming site, or any combination thereof.
- UMI unique molecular identifier
- the binding moiety and the coding tag can be joined by a linker or a binding pair.
- the binding moiety and the coding tag can be joined by a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties), a SpyTag/SpyCatcher, a SnoopTag/SnoopCatcher peptide-protein pair, a sortase, such as a LPXTG Tag/Sortase (e.g., Sortase A5, ActiveMotif, San Diego, or as disclosed in U.S. Pat. No. 9,267,127 B2 which is incorporated herein by reference), or a HaloTag/HaloTag ligand pair, or any combination thereof.
- a SpyTag-KTag/SpyLigase where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two
- the coding tag and/or the recording tag can comprise one or more error correcting codes, one or more encoder sequences, one or more barcodes, one or more UMIs, one or more compartment tags, or any combination thereof.
- the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- analyzing the extended recording tag and/or extended coding tag can comprise a nucleic acid sequence analysis.
- the nucleic acid sequence analysis comprises a nucleic acid sequencing method, such as sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, or pyrosequencing, or any combination thereof.
- the nucleic acid sequencing method is single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy.
- the method can further comprise one or more washing steps.
- the extended recording tag and/or extended coding tag can be amplified prior to analysis.
- the extended recording tag and/or extended coding tag can undergo a target enrichment assay prior to analysis.
- the extended recording tag and/or extended coding tag can undergo a subtraction assay prior to analysis.
- kits comprising: (a) a library of agents, wherein each agent comprises (i) a small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, and/or aptamer, and (ii) a coding tag comprising identifying information regarding the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer; and optionally (b) a set of proteins, wherein each protein is associated directly or indirectly with a recording tag, wherein each protein and/or its associated recording tag, or each agent, is immobilized directly or indirectly to a support, and wherein the set of proteins, the recording tags, and the library of agents are configured to allow
- kits for analyzing a polypeptide comprising: (a) a library of binding agents, wherein each binding agent comprises a binding moiety and a coding tag comprising identifying information regarding the binding moiety, wherein the binding moiety is capable of binding to one or more N-terminal, internal, or C-terminal amino acids of the fragment, or capable of binding to the one or more N-terminal, internal, or C-terminal amino acids modified by a functionalizing reagent; and optionally (b) a set of fragments of a polypeptide, wherein each fragment is associated directly or indirectly with a recording tag, or (b′) a means for fragmenting a polypeptide, such as a protease, wherein each fragment and/or its associated recording tag, or each binding agent, is immobilized directly or indirectly to a support, and wherein the set of fragments of a polypeptide, the recording tags, and the library of binding agents are configured to allow transfer of information between (i) the recording tag associated
- kits for analyzing a plurality of polypeptides comprising: (a) a library of binding agents, wherein each binding agent comprises a binding moiety and a coding tag comprising identifying information regarding the binding moiety, wherein the binding moiety is capable of binding to one or more N-terminal, internal, or C-terminal amino acids of the fragment, or capable of binding to the one or more N-terminal, internal, or C-terminal amino acids modified by a functionalizing reagent; and (b) a plurality of substrates, optionally with a plurality of polypeptides immobilized thereto, wherein each substrate comprises a plurality of recording tags each comprising a compartment tag, optionally wherein each compartment is a bead, a microfluidic droplet, a microwell, or a separated region on a surface, or any combination thereof, wherein the polypeptide(s) immobilized on each substrate are configured to be fragmented (e.g., by a prote
- kits and kit components in the following Embodiments.
- methods of using the kits and kit components in the following Embodiments are also disclosed herein.
- Embodiment 1 A kit, comprising: (a) a recording tag configured to associate directly or indirectly with an analyte; (b) (i) a coding tag which comprises identifying information regarding a binding moiety capable of binding to the analyte, and which is configured to associate directly or indirectly with the binding moiety to form a binding agent, and/or (ii) a label, wherein the recording tag and the coding tag are configured to allow transfer of information between them, upon binding between the binding agent and the analyte; and optionally (c) the binding moiety.
- Embodiment 2 The kit of Embodiment 1, wherein the recording tag and/or the analyte are configured to be immobilized directly or indirectly to a support.
- Embodiment 3 The kit of Embodiment 2, wherein the recording tag is configured to be immobilized to the support, thereby immobilizing the analyte associated with the recording tag.
- Embodiment 4 The kit of Embodiment 2, wherein the analyte is configured to be immobilized to the support, thereby immobilizing the recording tag associated with the analyte.
- Embodiment 5 The kit of Embodiment 2, wherein each of the recording tag and the analyte is configured to be immobilized to the support.
- Embodiment 6 The kit of Embodiment 5, wherein the recording tag and the analyte are configured to co-localize when both are immobilized to the support.
- Embodiment 7 The kit of any of Embodiments 1-6, further comprising an immobilizing linker configured to: (i) be immobilized directly or indirectly to a support, and (ii) associate directly or indirectly with the recording tag and/or the analyte.
- Embodiment 8 The kit of Embodiment 7, wherein the immobilizing linker is configured to associate with the recording tag and the analyte.
- Embodiment 9 The kit of Embodiment 7 or 8, wherein the immobilizing linker is configured to be immobilized directly to the support, thereby immobilizing the recording tag and/or the analyte which are associated with the immobilizing linker.
- Embodiment 10 The kit of any one of Embodiments 2-9, further comprising the support.
- Embodiment 11 The kit of any one of Embodiments 1-10, further comprising one or more reagents for transferring information between the coding tag and the recording tag, upon binding between the binding agent and the analyte.
- Embodiment 12 The kit of Embodiment 11, wherein the one or more reagents are configured to transfer information from the coding tag to the recording tag, thereby generating an extended recording tag.
- Embodiment 13 The kit of Embodiment 11, wherein the one or more reagents are configured to transfer information from the recording tag to the coding tag, thereby generating an extended coding tag.
- Embodiment 14 The kit of Embodiment 11, wherein the one or more reagents are configured to generate a di-tag construct comprising information from the coding tag and information from the recording tag.
- Embodiment 15 The kit of any one of Embodiments 1-14, which comprises at least two of the recording tags.
- Embodiment 16 The kit of any one of Embodiments 1-15, which comprises at least two of the coding tags each comprising identifying information regarding its associated binding moiety.
- Embodiment 17 The kit of any one of Embodiments 1-16, which comprises at least two of the binding agents.
- Embodiment 18 The kit of Embodiment 17, which comprises: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to the recording tag to generate a first order extended recording tag, upon binding between the first binding agent and the analyte, and/or (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to the first order extended recording tag to generate a second order extended recording tag, upon binding between the second binding agent and the analyte, wherein the one or more reagents of (i) and the one or more reagents of (ii) can be the same or different.
- Embodiment 19 The kit of Embodiment 18, which further comprises: (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to the second order extended recording tag to generate a third (or higher order) order extended recording tag, upon binding between the third (or higher order) binding agent and the analyte.
- Embodiment 20 The kit of Embodiment 17, which comprises: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to a first recording tag to generate a first extended recording tag, upon binding between the first binding agent and the analyte, and/or (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to a second recording tag to generate a second extended recording tag, upon binding between the second binding agent and the analyte, wherein the one or more reagents of (i) and the one or more reagents of (ii) can be the same or different.
- Embodiment 21 The kit of Embodiment 20, which further comprises: (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to a third (or higher order) recording tag to generate a third (or higher order) extended recording tag, upon binding between the third (or higher order) binding agent and the analyte.
- Embodiment 22 The kit of Embodiment 20 or 21, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to associate directly or indirectly with the analyte.
- Embodiment 23 The kit of any one of Embodiments 20-22, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to be immobilized on a support.
- Embodiment 24 The kit of any one of Embodiments 20-23, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to co-localize with the analyte, for example, to allow transfer of information between the first, second, or third (or higher order) coding tag and the first, second, or third (or higher order) recording tag, respectively, upon binding between the first, second, or third (or higher order) binding agent and the analyte.
- each of the first coding tag, the second coding tag, and/or the third (or higher order) coding tag comprises a binding cycle specific barcode, such as a binding cycle specific spacer sequence C n , and/or a coding tag specific spacer sequence C n , wherein n is an integer and C n indicates binding between the n th binding agent and the polypeptide; or wherein a binding cycle tag C n is added exogenously, for example, the binding cycle tag C n may be exogenous to the coding tag(s).
- Embodiment 26 The kit of any one of Embodiments 1-25, wherein the analyte comprises a polypeptide.
- Embodiment 27 The kit of Embodiment 26, wherein the binding moiety is capable of binding to one or more N-terminal or C-terminal amino acids of the polypeptide, or capable of binding to the one or more N-terminal or C-terminal amino acids modified by a functionalizing reagent.
- Embodiment 28 The kit of Embodiment 26 or 27, further comprising the functionalizing reagent.
- Embodiment 29 The kit of any one of Embodiments 26-28, further comprising an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the one or more N-terminal, internal, or C-terminal amino acids of the polypeptide, or removing the functionalized N-terminal, internal, or C-terminal amino acid(s), optionally wherein the eliminating reagent comprises a carboxypeptidase or an aminopeptidase or variant, mutant, or modified protein thereof; a hydrolase or variant, mutant, or modified protein thereof; a mild Edman degradation reagent; an Edmanase enzyme; anhydrous TFA, a base; or any combination thereof.
- an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the one or more N-terminal, internal, or C-terminal amino acids of the polypeptide, or removing the functionalized N-terminal, internal, or C-termin
- Embodiment 30 The kit of any one of Embodiments 26-29, wherein the one or more N-terminal, internal, or C-terminal amino acids comprise: (i) an N-terminal amino acid (NTAA); (ii) an N-terminal dipeptide sequence; (iii) an N-terminal tripeptide sequence; (iv) an internal amino acid; (v) an internal dipeptide sequence; (vi) an internal tripeptide sequence; (vii) a C-terminal amino acid (CTAA); (viii) a C-terminal dipeptide sequence; or (ix) a C-terminal tripeptide sequence, or any combination thereof, optionally wherein any one or more of the amino acid residues in (i)-(ix) are modified or functionalized.
- NTAA N-terminal amino acid
- CTAA C-terminal amino acid
- C-terminal dipeptide sequence or (ix) a C-terminal tripeptide sequence, or any combination thereof, optionally wherein any one or more of the amino acid
- a kit comprising: at least (a) a first binding agent comprising (i) a first binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a first coding tag comprising identifying information regarding the first binding moiety, optionally (b) a recording tag configured to associate directly or indirectly with the polypeptide, and further optionally (c) a functionalizing reagent capable of modifying a first NTAA of the polypeptide to generate a first functionalized NTAA, wherein the recording tag and the first binding agent are configured to allow transfer of information between the first coding tag and the recording tag, upon binding between the first binding agent and the polypeptide.
- a first binding agent comprising (i) a first binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a first coding tag comprising identifying information regarding
- Embodiment 32 The kit of Embodiment 31, further comprising one or more reagents for transferring information from the first coding tag to the recording tag, thereby generating a first order extended recording tag.
- Embodiment 33 The kit of Embodiment 31 or 32, wherein the functionalizing reagent comprises a chemical agent, an enzyme, and/or a biological agent, such as an isothiocyanate derivative, 2,4-dinitrobenzenesulfonic (DNBS), 4-sulfonyl-2-nitrofluorobenzene (SNFB) 1-fluoro-2,4-dinitrobenzene, dansyl chloride, 7-methoxycoumarin acetic acid, a thioacylation reagent, a thioacetylation reagent, or a thiobenzylation reagent.
- DNBS 2,4-dinitrobenzenesulfonic
- SNFB 4-sulfonyl-2-nitrofluorobenzene 1-fluoro-2,4-dinitrobenzene
- dansyl chloride 7-methoxycoumarin acetic acid
- a thioacylation reagent a thioacetylation reagent
- Embodiment 34 The kit of any one of Embodiments 31-33, further comprising an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the first functionalized NTAA to expose the immediately adjacent amino acid residue, as a second NTAA.
- an eliminating reagent for removing e.g., by chemical cleavage or enzymatic cleavage
- Embodiment 35 The kit of Embodiment 34, wherein the second NTAA is capable of being functionalized by the same or a different functionalizing reagent to generate a second functionalized NTAA, which may be the same as or different from the first functionalized NTAA.
- Embodiment 36 The kit of Embodiment 35, further comprising: (d) a second (or higher order) binding agent comprising (i) a second (or higher order) binding moiety capable of binding to the second functionalized NTAA, and (ii) a second (or higher order) coding tag comprising identifying information regarding the second (or higher order) binding moiety, wherein the first coding tag and the second (or higher order) coding tag can be the same or different.
- a second (or higher order) binding agent comprising (i) a second (or higher order) binding moiety capable of binding to the second functionalized NTAA
- a second (or higher order) coding tag comprising identifying information regarding the second (or higher order) binding moiety
- Embodiment 37 The kit of Embodiment 36, wherein the first functionalized NTAA and the second functionalized NTAA are selected, independent from each other, from the group consisting of a functionalized N-terminal Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr), in any combination thereof.
- a or Ala Alanine
- Embodiment 38 The kit of Embodiment 36 or 37, further comprising one or more reagents for transferring information from the second (or higher order) coding tag to the first order extended recording tag, thereby generating a second (or higher order) order extended recording tag.
- a kit comprising: at least (a) one or more binding agents each comprising (i) a binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a coding tag comprising identifying information regarding the binding moiety, and/or (b) one or more recording tags configured to associate directly or indirectly with the polypeptide, wherein the one or more recording tags and the one or more binding agents are configured to allow transfer of information between the coding tags and the recording tags, upon binding between each binding agent and the polypeptide, and optionally (c) a functionalizing reagent capable of modifying a first NTAA of the polypeptide to generate a first functionalized NTAA.
- binding agents each comprising (i) a binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a coding tag comprising identifying information regarding the binding
- Embodiment 40 The kit of Embodiment 39, further comprising an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the first functionalized NTAA to expose the immediately adjacent amino acid residue, as a second NTAA.
- an eliminating reagent for removing e.g., by chemical cleavage or enzymatic cleavage
- Embodiment 41 The kit of Embodiment 40, wherein the second NTAA is capable of being functionalized by the same or a different functionalizing reagent to generate a second functionalized NTAA, which may be the same as or different from the first functionalized NTAA.
- Embodiment 42 The kit of Embodiment 41, wherein the first functionalized NTAA and the second functionalized NTAA are selected, independent from each other, from the group consisting of a functionalized N-terminal Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr), in any combination thereof.
- a or Ala Alanine
- Embodiment 43 The kit of any one of Embodiments 39-42, which comprises: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to a first recording tag to generate a first extended recording tag, upon binding between the first binding agent and the polypeptide, and/or (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to a second recording tag to generate a second extended recording tag, upon binding between the second binding agent and the polypeptide, wherein the one or more reagents of (i) and the one or more reagents of (ii) can be the same or different.
- Embodiment 44 The kit of Embodiment 43, which further comprises: (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to a third (or higher order) recording tag to generate a third (or higher order) extended recording tag, upon binding between the third (or higher order) binding agent and the polypeptide.
- Embodiment 45 The kit of Embodiment 43 or 44, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to associate directly or indirectly with the polypeptide.
- Embodiment 46 The kit of any one of Embodiments 43-45, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to be immobilized on a support.
- Embodiment 47 The kit of any one of Embodiments 43-46, wherein the first recording tag, the second recording tag, and/or the third (or higher order) recording tag are configured to co-localize with the polypeptide, for example, to allow transfer of information between the first, second, or third (or higher order) coding tag and the first, second, or third (or higher order) recording tag, respectively, upon binding between the first, second, or third (or higher order) binding agent and the polypeptide.
- each of the first coding tag, the second coding tag, and/or the third (or higher order) coding tag comprises a binding cycle specific barcode, such as a binding cycle specific spacer sequence C n , and/or a coding tag specific spacer sequence C n , wherein n is an integer and C n indicates binding between the n th binding agent and the polypeptide.
- a binding cycle tag C n may be added exogenously, for example, the binding cycle tag C n may be exogenous to the coding tag(s).
- Embodiment 49 The kit of any one of Embodiments 1-48, wherein the analyte or the polypeptide comprises a protein or a polypeptide chain or a fragment thereof, a lipid, a carbohydrate, or a macrocycle.
- Embodiment 50 The kit of any one of Embodiments 1-49, wherein the analyte or the polypeptide comprises a macromolecule or a complex thereof, such as a protein complex or subunit thereof.
- Embodiment 51 The kit of any one of Embodiments 1-50, wherein the recording tag comprises a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA with protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the recording tag comprises a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA with protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- Embodiment 52 The kit of any one of Embodiments 1-51, wherein the recording tag comprises a universal priming site.
- Embodiment 53 The kit of any one of Embodiments 1-52, wherein the recording tag comprises a priming site for amplification, sequencing, or both, for example, the universal priming site comprises a priming site for amplification, sequencing, or both.
- Embodiment 54 The kit of any one of Embodiments 1-53, wherein the recording tag comprises a unique molecule identifier (UMI).
- UMI unique molecule identifier
- Embodiment 55 The kit of any one of Embodiments 1-54, wherein the recording tag comprises a barcode.
- Embodiment 56 The kit of any one of Embodiments 1-55, wherein the recording tag comprises a spacer at its 3′-terminus.
- Embodiment 57 The kit of any one of Embodiments 1-56, comprising a solid support, such as a rigid solid support, a flexible solid support, or a soft solid support, and including a porous support or a non-porous support.
- a solid support such as a rigid solid support, a flexible solid support, or a soft solid support, and including a porous support or a non-porous support.
- Embodiment 58 The kit of any one of Embodiments 1-57, comprising a support comprising a bead, a porous bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticles), quantum dots, a nanoshell, a nanocage, a microsphere, or any combination thereof.
- a support comprising a bead, a porous bead,
- Embodiment 59 The kit of Embodiment 58, wherein the support comprises a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- Embodiment 60 The kit of any one of Embodiments 1-59, which comprises a support and is for analyzing a plurality of the analytes or the polypeptides, in sequential reactions, in parallel reactions, or in a combination of sequential and parallel reactions.
- Embodiment 61 The kit of Embodiment 60, wherein the analytes or the polypeptides are spaced apart on the support at an average distance equal to or greater than about 10 nm, equal to or greater than about 15 nm, equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, or equal to or greater than about 500 nm.
- Embodiment 62 The kit of any one of Embodiments 1-61, wherein the binding moiety comprises a polypeptide or fragment thereof, a protein or polypeptide chain or fragment thereof, or a protein complex or subunit thereof, such as an antibody or antigen binding fragment thereof.
- Embodiment 63 The kit of any one of Embodiments 1-62, wherein the binding moiety comprises a carboxypeptidase or an aminopeptidase or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof, a ClpS or variant, mutant, or modified protein thereof; a UBR box protein or variant, mutant, or modified protein thereof; a modified small molecule that binds amino acid(s), i.e.
- the binding moiety comprises a small molecule
- the coding tag comprises a polynucleotide that identifies the small molecule, whereby a plurality of the binding agents form an encoded small molecule library, such as a DNA-encoded small molecule library.
- Embodiment 64 The kit of any one of Embodiments 1-63, wherein the binding moiety is capable of selectively and/or specifically binding to the analyte or the polypeptide.
- Embodiment 65 The kit of any one of Embodiments 1-64, wherein the coding tag comprises a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA or RNA with one or more protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the coding tag comprises a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA or RNA with one or more protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a
- Embodiment 66 The kit of any one of Embodiments 1-65, wherein the coding tag comprises a barcode sequence, such as an encoder sequence, e.g., one that identifies the binding moiety.
- a barcode sequence such as an encoder sequence, e.g., one that identifies the binding moiety.
- Embodiment 67 The kit of any one of Embodiments 1-66, wherein the coding tag comprises a spacer, a binding cycle specific sequence, a unique molecular identifier (UMI), a universal priming site, or any combination thereof, optionally wherein a binding cycle specific sequence is added to the recording tag after each binding cycle.
- the coding tag comprises a spacer, a binding cycle specific sequence, a unique molecular identifier (UMI), a universal priming site, or any combination thereof, optionally wherein a binding cycle specific sequence is added to the recording tag after each binding cycle.
- UMI unique molecular identifier
- Embodiment 68 The kit of any one of Embodiments 1-67, wherein the binding moiety and the coding tag are joined by a linker or a binding pair.
- Embodiment 69 The kit of any one of Embodiments 1-68, wherein the binding moiety and the coding tag are joined by a SpyTag/SpyCatcher, a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties), a sortase, a SnoopTag/SnoopCatcher peptide-protein pair, or a HaloTag/HaloTag ligand pair, or any combination thereof.
- a SpyTag/SpyCatcher wherein the binding moiety and the coding tag are joined by a SpyTag/SpyCatcher, a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties
- Embodiment 70 The kit of any one of Embodiments 1-69, further comprising a reagent for transferring information between the coding tag and the recording tag in a templated or non-templated reaction, optionally wherein the reagent is (i) a chemical ligation reagent or a biological ligation reagent, for example, a ligase, such as a DNA ligase or RNA ligase for ligating single-stranded nucleic acid or double-stranded nucleic acid, or (ii) a reagent for primer extension of single-stranded nucleic acid or double-stranded nucleic acid, optionally wherein the kit further comprises a ligation reagent comprising at least two ligases or variants thereof (e.g., at least two DNA ligases, or at least two RNA ligases, or at least one DNA ligase and at least one RNA ligase), wherein the at least two ligases or variants thereof comprises an
- Embodiment 71 The kit of any one of Embodiments 1-70, further comprising a polymerase, such as a DNA polymerase or RNA polymerase or a reverse transcriptase, for transferring information between the coding tag and the recording tag.
- a polymerase such as a DNA polymerase or RNA polymerase or a reverse transcriptase
- Embodiment 72 The kit of any one of Embodiments 1-71, further comprising one or more reagents for nucleic acid sequence analysis.
- Embodiment 73 The kit of Embodiment 72, wherein the nucleic acid sequence analysis comprises sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, pyrosequencing, single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy, or any combination thereof.
- Embodiment 74 The kit of any one of Embodiments 1-73, further comprising one or more reagents for nucleic acid amplification, for example, for amplifying one or more extended recording tags, optionally wherein the nucleic acid amplification comprises an exponential amplification reaction (e.g., polymerase chain reaction (PCR), such as an emulsion PCR to reduce or eliminate template switching) and/or a linear amplification reaction (e.g., isothermal amplification by in vitro transcription, or Isothermal Chimeric primer-initiated Amplification of Nucleic acids (ICAN)).
- PCR polymerase chain reaction
- ICAN Isothermal Chimeric primer-initiated Amplification of Nucleic acids
- Embodiment 75 The kit of any one of Embodiments 1-74, comprising one or more reagents for transferring coding tag information to the recording tag to form an extended recording tag, wherein the order and/or frequency of coding tag information on the extended recording tag indicates the order and/or frequency in which the binding agent binds to the analyte or the polypeptide.
- Embodiment 76 The kit of any one of Embodiments 1-75, further comprising one or more reagents for target enrichment, for example, enrichment of one or more extended recording tags.
- Embodiment 77 The kit of any one of Embodiments 1-76, further comprising one or more reagents for subtraction, for example, subtraction of one or more extended recording tags.
- Embodiment 78 The kit of any one of Embodiments 1-77, further comprising one or more reagents for normalization, for example, to reduce highly abundant species such as one or more analytes or polypeptides.
- Embodiment 79 The kit of any one of Embodiments 1-78, wherein at least one binding agent binds to a terminal amino acid residue, terminal di-amino-acid residues, or terminal triple-amino-acid residues.
- Embodiment 80 The kit of any one of Embodiments 1-79, wherein at least one binding agent binds to a post-translationally modified amino acid.
- Embodiment 81 The kit of any one of Embodiments 1-80, further comprising one or more reagents or means for partitioning a plurality of the analytes or polypeptides in a sample into a plurality of compartments, wherein each compartment comprises a plurality of compartment tags optionally joined to a support (e.g., a solid support), wherein the plurality of compartment tags are the same within an individual compartment and are different from the compartment tags of other compartments.
- a support e.g., a solid support
- Embodiment 82 The kit of Embodiment 81, further comprising one or more reagents or means for fragmenting the plurality of the analytes or polypeptides (such as a plurality of protein complexes, proteins, and/or polypeptides) into a plurality of polypeptide fragments.
- the kit of Embodiment 81 further comprising one or more reagents or means for fragmenting the plurality of the analytes or polypeptides (such as a plurality of protein complexes, proteins, and/or polypeptides) into a plurality of polypeptide fragments.
- Embodiment 83 The kit of Embodiment 81 or 82, further comprising one or more reagents or means for annealing or joining of the plurality of polypeptide fragments with the compartment tag within each of the plurality of compartments, thereby generating a plurality of compartment tagged polypeptide fragments.
- Embodiment 84 The kit of any one of Embodiments 81-83, wherein the plurality of compartments comprise a microfluidic droplet, a microwell, or a separated region on a surface, or any combination thereof.
- Embodiment 85 The kit of any one of Embodiments 81-84, wherein each of the plurality of compartments comprises on average a single cell.
- Embodiment 86 The kit of any one of Embodiments 81-85, further comprising one or more universal DNA tags for labeling the plurality of the analytes or polypeptides in the sample.
- Embodiment 87 The kit of any one of Embodiments 81-86, further comprising one or more reagents for labeling the plurality of the analytes or polypeptides in the sample with one or more universal DNA tags.
- Embodiment 88 The kit of any one of Embodiments 81-87, further comprising one or more reagents for primer extension or ligation.
- Embodiment 89 The kit of any one of Embodiments 81-88, wherein the support comprises a bead, such as a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- a bead such as a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- Embodiment 90 The kit of any one of Embodiments 81-89, wherein the compartment tag comprises a single stranded or double stranded nucleic acid molecule.
- Embodiment 91 The kit of any one of Embodiments 81-90, wherein the compartment tag comprises a barcode and optionally a UMI.
- Embodiment 92 The kit of any one of Embodiments 81-91, wherein the support is a bead and the compartment tag comprises a barcode.
- Embodiment 93 The kit of any one of Embodiments 81-92, wherein the support comprises a bead, and wherein beads comprising the plurality of compartment tags joined thereto are formed by split-and-pool synthesis, individual synthesis, or immobilization.
- Embodiment 94 The kit of any one of Embodiments 81-93, further comprising one or more reagents for split-and-pool synthesis, individual synthesis, or immobilization.
- Embodiment 95 The kit of any one of Embodiments 81-94, wherein the compartment tag is a component within a recording tag, wherein the recording tag optionally further comprises a spacer, a barcode sequence, a unique molecular identifier, a universal priming site, or any combination thereof.
- Embodiment 96 The kit of any one of Embodiments 81-95, wherein the compartment tags further comprise a functional moiety capable of reacting with an internal amino acid, the peptide backbone, or N-terminal amino acid on the plurality of analytes or polypeptides (such as protein complexes, proteins, or polypeptides).
- a functional moiety capable of reacting with an internal amino acid, the peptide backbone, or N-terminal amino acid on the plurality of analytes or polypeptides (such as protein complexes, proteins, or polypeptides).
- Embodiment 97 The kit of Embodiment 96, wherein the functional moiety comprises an aldehyde, an azide/alkyne, a malemide/thiol, an epoxy/nucleophile, an inverse Electron Demand Diels-Alder (iEDDA) group, a click reagent, or any combination thereof.
- the functional moiety comprises an aldehyde, an azide/alkyne, a malemide/thiol, an epoxy/nucleophile, an inverse Electron Demand Diels-Alder (iEDDA) group, a click reagent, or any combination thereof.
- iEDDA inverse Electron Demand Diels-Alder
- Embodiment 98 The kit of any one of Embodiments 81-97, wherein the compartment tag further comprises a peptide, such as a protein ligase recognition sequence, optionally wherein the protein ligase is butelase I or a homolog thereof.
- a peptide such as a protein ligase recognition sequence, optionally wherein the protein ligase is butelase I or a homolog thereof.
- Embodiment 99 The kit of any one of Embodiments 81-98, further comprising a chemical or biological reagent, such as an enzyme, for example, a protease (e.g., a metalloprotease), for fragmenting the plurality of analytes or polypeptides.
- a chemical or biological reagent such as an enzyme, for example, a protease (e.g., a metalloprotease), for fragmenting the plurality of analytes or polypeptides.
- Embodiment 100 The kit of any one of Embodiments 81-99, further comprising one or more reagents for releasing the compartment tags from the support.
- Embodiment 101 The kit of any one of Embodiments 1-100, further comprising one or more reagents for forming an extended coding tag or a di-tag construct.
- Embodiment 102 The kit of Embodiment 101, wherein the 3′-terminus of the recording tag is blocked to prevent extension of the recording tag by a polymerase.
- Embodiment 103 The kit of Embodiment 101 or 102, wherein the coding tag comprises an encoder sequence, a UMI, a universal priming site, a spacer at its 3′-terminus, a binding cycle specific sequence, or any combination thereof.
- Embodiment 104 The kit of any one of Embodiments 101-103, wherein the di-tag construct is generated by gap fill, primer extension, or a combination thereof.
- Embodiment 105 The kit of any one of Embodiments 101-104, wherein the di-tag molecule comprises a universal priming site derived from the recording tag, a compartment tag derived from the recording tag, a unique molecular identifier derived from the recording tag, an optional spacer derived from the recording tag, an encoder sequence derived from the coding tag, a unique molecular identifier derived from the coding tag, an optional spacer derived from the coding tag, and a universal priming site derived from the coding tag.
- the di-tag molecule comprises a universal priming site derived from the recording tag, a compartment tag derived from the recording tag, a unique molecular identifier derived from the recording tag, an optional spacer derived from the recording tag, an encoder sequence derived from the coding tag, a unique molecular identifier derived from the coding tag, an optional spacer derived from the coding tag, and a universal priming site derived from the coding tag.
- Embodiment 106 The kit of any one of Embodiments 101-105, wherein the binding agent is a polypeptide or protein.
- Embodiment 107 The kit of any one of Embodiments 101-106, wherein the binding agent comprises an aminopeptidase or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof; a ClpS or variant, mutant, or modified protein thereof; or a modified small molecule that binds amino acid(s), i.e. vancomycin or a variant, mutant, or modified molecule thereof; or an antibody or binding fragment thereof; or any combination thereof.
- the binding agent comprises an aminopeptidase or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof; a ClpS or variant, mutant, or modified protein thereof; or a modified small molecule that binds amino acid(s), i.e. vancomycin or a variant, mutant, or modified molecule thereof
- Embodiment 108 The kit of any one of Embodiments 101-107, wherein the binding agent binds to a single amino acid residue (e.g., an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue), a dipeptide (e.g., an N-terminal dipeptide, a C-terminal dipeptide, or an internal dipeptide), a tripeptide (e.g., an N-terminal tripeptide, a C-terminal tripeptide, or an internal tripeptide), or a post-translational modification of the analyte or polypeptide.
- a single amino acid residue e.g., an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue
- a dipeptide e.g., an N-terminal dipeptide, a C-terminal dipeptide, or an internal dipeptide
- a tripeptide e.g., an N
- Embodiment 109 The kit of any one of Embodiments 101-107, wherein the binding agent binds to an N-terminal polypeptide, a C-terminal polypeptide, or an internal polypeptide.
- Embodiment 110 The kit of any one of Embodiments 1-109, wherein the coding tag and/or the recording tag comprise one or more error correcting codes, one or more encoder sequences, one or more barcodes, one or more UMIs, one or more compartment tags, one or more cycle specific sequences, or any combination thereof.
- Embodiment 111 The kit of Embodiment 110, wherein the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- Embodiment 112 The kit of any one of Embodiments 1-111, wherein the coding tag and/or the recording tag comprise a cycle label.
- Embodiment 113 The kit of any one of Embodiments 1-112, further comprising a cycle label independent of the coding tag and/or the recording tag.
- Embodiment 114 The kit of any one of Embodiments 1-113, which comprises: (a) a reagent for generating a cell lysate or a protein sample; (b) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (c) a protease, such as trypsin, LysN, or LysC; (d) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support; (e) a reagent for degradation-based polypeptide sequencing; and/or (f) a reagent for nucleic acid sequencing.
- a reagent for generating a cell lysate or a protein sample a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine
- a protease such as trypsin, LysN, or Ly
- Embodiment 115 The kit of any one of Embodiments 1-113, which comprises: (a) a reagent for generating a cell lysate or a protein sample; (b) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (c) a protease, such as trypsin, LysN, or LysC; (d) a reagent for immobilizing a polypeptide (such as a protein) to a support comprising immobilized recording tags; (e) a reagent for degradation-based polypeptide sequencing; and/or (f) a reagent for nucleic acid sequencing.
- a reagent for generating a cell lysate or a protein sample a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine
- a protease such as trypsin, LysN, or LysC
- Embodiment 116 The kit of any one of Embodiments 1-113, which comprises: (a) a reagent for generating a cell lysate or a protein sample; (b) a denaturing reagent; (c) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (d) a universal DNA primer sequence; (e) a reagent for labeling a polypeptide with a universal DNA primer sequence; (f) a barcoded bead for annealing the labeled polypeptide via a primer; (g) a reagent for polymerase extension for writing the barcode from the bead to the labeled polypeptide; (h) a protease, such as trypsin, LysN, or LysC; (i) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support; (
- Embodiment 117 The kit of any one of Embodiments 1-113, which comprises: (a) a cross-linking reagent; (b) a reagent for generating a cell lysate or a protein sample; (c) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (d) a universal DNA primer sequence; (e) a reagent for labeling a polypeptide with a universal DNA primer sequence; (f) a barcoded bead for annealing the labeled polypeptide via a primer; (g) a reagent for polymerase extension for writing the barcode from the bead to the labeled polypeptide; (h) a protease, such as trypsin, LysN, or LysC; (i) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support;
- Embodiment 118 The kit of any one of Embodiments 1-117, wherein one or more components are provided in a solution or on a support, for example, a solid support.
- kits may be included in the kits.
- the sample may comprise macromolecules, including peptides, polypeptides, and proteins, and the recording may generate molecular interaction and/or reaction information, and/or polypeptide sequence information.
- the kits may be used in high-throughput, multiplexed, and/or automated analysis, and are suitable for analysis of a proteome or subset thereof.
- Kit components may include any molecule, molecular complex or conjugate, reagent (e.g., chemical or biological), agent, structure (e.g., support, surface, particle, or bead), reaction intermediate, reaction product, binding complex, or any other article of manufacture disclosed and/or used in the above exemplary methods.
- the present kits can be used for analyzing any suitable analyte, e.g., a macromolecule or a polypeptide.
- the present kits can be used for highly-parallel, high throughput digital analysis (e.g., a macromolecule analysis), particularly polypeptide analysis.
- the present kits can be used in the following exemplary methods for analyzing an analyte, e.g., a macromolecule or a polypeptide.
- the encoding tag and/or the recording tag, or any portion thereof may comprise or be replaced with a sequenceable polymer, such as a non-nucleic acid sequenceable polymer.
- the encoding tag and/or the recording tag, or any portion thereof give clearly resolvable signals, such as via a nanopore based sequencing.
- a wide range of polymers can be used, and optionally with click chemistry, tags that are compatible with an Edman-type degradation can be used to read out the sequence information of a target protein and/or polypeptide.
- the method disclosed herein comprises an amplification step. In other embodiments, without an amplification step, a single molecule can be processed through a nanopore multiple times to give multiple reads, in order to give resolvable signals.
- the recording tag comprises a polymer to be read, wherein the encoder within the coding tag comprises or is one or more small molecule portions, one or more subunits of a sequenceable non-nucleic acid polymer, one or more monomers of a sequenceable non-nucleic acid polymer.
- the encoder portion is akin to a bead on a string (e.g., an extended recording tag).
- sequenceable polymer is linear. In other embodiments, the sequenceable polymer comprises one or more linear chains, one or more branches, one or more circles, or any combination thereof.
- sequenceable polymer is not cross-linked. In other embodiments, the sequenceable polymer is cross-linked, for example, weakly cross-linked (e.g., the cross-linked polymer comprises between about 0.1% and about 1% cross-linkers).
- the sequenceable polymer is neutral, e.g., having an overall neutral charge.
- the sequenceable polymer comprises an acrylamide, an acrylate, a styrene, a nylon, a kapton, a NiPAM polymer, a PEG, a polylactam, a polylactone, an epoxide, a polysilicone, a polyester, a polycarbodiimide, a polyurethane, a polypyroldinone, a polyisothiocyanate, or any combination thereof.
- the sequenceable polymer is charged.
- the sequenceable polymer is negatively charged, for example, the sequenceable polymer may comprise a polysulfonate, and/or a negatively charged acrylamide (e.g., copolymerized with acrylic acid).
- the sequenceable polymer is positively charged, for example, the sequenceable polymer may comprise a polyamine, a polyaniline, a polyimine, and/or an acrylamide with an amine functional group which may be substituted or unsubstituted.
- the sequenceable polymer may comprise an ionomer.
- the sequenceable polymer comprises a polymorpholino and/or a zwitterionic polymer.
- the sequenceable polymer comprises a hydrophobic polymer and/or a hydrophilic polymer.
- the sequenceable polymer comprises a hydrophobic polymer, such as a styrene, a kapton, a fluoropolymer, or an isoprene, or any combination thereof.
- the sequenceable polymer comprises a hydrophilic polymer, such as a polyethylene glycol, a polylysine, a polyenimine, a polyimine, an acrylamide, or an acrylate, or any combination thereof.
- the sequenceable polymer comprises metathesis products, for example, a polymer product formed by ring-opening or linear metathesis.
- the sequenceable polymer comprises copolymers, block copolymers, diblock copolymers, or triblock copolymers, or any combination thereof. In some embodiments, the sequenceable polymer is formed by continuous polymerization or ligation of polymer products.
- sequenceable polymer comprises biopolymers: In specific embodiments, the sequenceable polymer comprises polysaccharides, polypeptides, peptides, or polyamides, or any combination thereof.
- the sequenceable polymer comprises naturally occurring biopolymers, biopolymer mimics, or synthetic biopolymers, or hybrids thereof.
- sequenceable polymer comprises biopolymer mimics, such as peptoids. In some embodiments, the sequenceable polymer comprises star polymers or dendrimers.
- the sequenceable polymer comprises stimulus triggered degradable polymers.
- stimuli include, but are not limited to, chemical stimulus, biochemical stimulus, enzymatic stimulus, light, time, and temperature.
- the sequenceable polymer comprises caged or protected polymers.
- the sequenceable polymer comprises reversible covalent bonded polymers. In some embodiments, the sequenceable polymer comprises a disulfide, thio(l)ester, tempo derived nitroxide polymers, or polyimines, or any combination thereof.
- the sequenceable polymer comprises polymers with low polydispersity index (PDI) or high PDI.
- Polydispersity index (PDI), or heterogeneity index, or simply dispersity (D) is a measure of the distribution of molecular mass in a given polymer sample. Typical dispersities vary based on the mechanism of polymerization and can be affected by a variety of reaction conditions. In synthetic polymers, it can vary greatly due to reactant ratio, how close the polymerization went to completion, etc. For typical addition polymerization, D can range around 5 to 20. For typical step polymerization, most probable values of D are around 2 or below. Living polymerization, a special case of addition polymerization, leads to values very close to 1. Such is the case also in biological polymers, where the dispersity can be very close or equal to 1, indicating only one length of polymer is present.
- the sequenceable polymer comprises polymers with low PDI, such as products of living polymerizations. In other embodiments, the sequenceable polymer comprises polymers with higher PDI, such as products of ATRP or other statistically driven distributions.
- the sequenceable polymer comprises conjugated polymers capable of acting as chromophores or conductive materials
- the sequenceable polymer comprises structured or unstructured (e.g., folded or non-folded) polymers such as foldamers.
- the coding polymers are relatively short, e.g., made up of 2 subunits.
- the polymers are large, e.g., made up of subunits totaling ⁇ 100 kDa.
- a number of polymer backbones are suitable for comprising a sequenceable polymer.
- the polyphosphate backbone described by Ouahabi et al. is useful for nanopore sequencing (Al Ouahabi, Charles et al. 2015).
- the phosphate group confers a negative charge to the backbone enabling electrically-controlled translocation through the pore.
- Different R groups can be used to provide different current blockade signatures.
- Peptoid polymers provide another useful polymer.
- a peptoid consists of a glycine backbone with side chain R groups connected to the nitrogen of the peptide-like backbone, instead of the ⁇ -carbon as in peptides.
- Solid phase synthesis of peptoids offers synthetic efficiency, high yield, and R group side chain diversity (hundreds of different R groups available) while reducing synthesis time and costs (Knight, Zhou et al. 2015).
- the peptoid backbone is neutral, but charged R groups can be employed along the length of the polymer to promote electrically-controlled translocation.
- Exemplar charged R groups include N-(2-aminoethyl) glycine (Nae) and N-(2-carboxyethyl) glycine (Nce).
- R groups for current blockade can be selected from a long list of functional moieties (incorporated by reference US20160075734).
- Functional moieties include substituted and/or functionalized groups such as alkoxy, halo, mercapto, azido, cyano, formyl, carboxyl, hydroxyl, nitro, acyl, aryloxy, alkylthio, amino, alkylamino, arylalkylamino, substituted amino, acylamino, acyloxy, ester, thioester, carboxylic thioester, ether, amide, amidino, sulfate, sulfoxyl, sulfonyl, sulfonyl, sulfonic acid, sulfonamide, urea, alkoxylacylamino, aminoacyloxy, guanidino, aldehyde, keto, imine, nitrile, phosphate, thiol, ep
- Heterocyclic group refers to an aliphatic (e.g., fully or partially saturated heterocyclo) or aromatic (e.g., heteroaryl) monocyclic- or a bicyclic-ring system.
- Monocyclic ring systems are exemplified by any 5 or 6 membered ring containing 1, 2, 3, or 4 heteroatoms independently selected from oxygen, nitrogen and sulfur. The 5 membered ring has from 0-2 double bonds and the 6 membered ring has from 0-3 double bonds.
- monocyclic ring systems include, but are not limited to, azetidine, azepine, aziridine, diazepine, 1,3-dioxolane, dioxane, dithiane, furan, imidazole, imidazoline, imidazolidine, isothiazole, isothiazoline, isothiazolidine, isoxazole, isoxazoline, isoxazolidine, morpholine, oxadiazole, oxadiazoline, oxadiazolidine, oxazole, oxazoline, oxazolidine, piperazine, piperidine, pyran, pyrazine, pyrazole, pyrazoline, pyrazolidine, pyridine, pyrimidine, pyridazine, pyrrole, pyrroline, pyrrolidine, tetrahydrofuran, tetrahydrothiophene, tetrazine,
- Bicyclic ring systems are exemplified by any of the above monocyclic ring systems fused to an aryl group as defined herein, a cycloalkyl group as defined herein, or another monocyclic ring system as defined herein.
- Representative examples of bicyclic ring systems include but are not limited to, for example, benzimidazole, benzothiazole, benzothiadiazole, benzothiophene, benzoxadiazole, benzoxazole, benzofuran, benzopyran, benzothiopyran, benzodioxine, 1,3-benzodioxole, cinnoline, indazole, indole, indoline, indolizine, naphthyridine, isobenzofuran, isobenzothiophene, isoindole, isoindoline, isoquinoline, phthalazine, purine, pyranopyridine, quinoline, quinoliz
- These rings include quaternized derivatives thereof and may be optionally substituted with groups selected from halo, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkylalkyl, aryl, arylalkyl, heterocyclo, heterocycloalkyl, hydroxyl, alkoxy, alkenyloxy, alkynyloxy, haloalkoxy, cycloalkoxy, cycloalkylalkyloxy, aryloxy, arylalkyloxy, heterocyclooxy, heterocyclolalkyloxy, mercapto, alkyl-S(O)m, haloalkyl-S(O)m, alkenyl-S(O)m, alkynyl-S(O)m, cycloalkyl-S(O)m, cycloalkylalkyl-S(O)m, aryl-S(O)m, arylalky
- the encoding tag and/or the recording tag (and/or the di-tag, the compartment tag, or the partition tag, if applicable), or any portion thereof (e.g., a universal primer, a spacer, a UMI, a recording tag barcode, an encoder sequence, a binding cycle-specific barcode, etc.), may comprise or be replaced by sequenceable polymer, such as a non-nucleic acid sequenceable polymer.
- FIGS. 1A-B FIG. 1A illustrates key for functional elements shown in the figures.
- a recording tag or an extended recording tag comprising one or more universal primer sequences (or one or more pairs of universal primer sequences, for example, one universal prime of the pair at the 5′ end and the other of the pair at the 3′ end of the recording tag or extended recording tag), one or more barcode sequences that can identify the recording tag or extended recording tag among a plurality of recording tags or extended recording tags, one or more UMI sequences, one or more spacer sequences, and/or one or more encoder sequences (also referred to as the coding sequence, e.g., of a coding tag).
- the coding sequence also referred to as the coding sequence, e.g., of a coding tag.
- the extended recording tag comprises (i) one universal primer sequence, one barcode sequence, one UMI sequence, and one spacer (all from the unextended recording tag), (ii) one or more “cassettes” arranged in tandem, each cassette comprising an encoder sequence for a binding agent, a UMI sequence, and a spacer, and each cassette comprises sequence information from a coding tag, and (iii) another universal primer sequence, which may be provided by the coding tag of the coding agent in the n th binding cycle, where n is an integer representing the number of binding cycle after which assay read out is desired.
- the binding cycles may continue, the extended recording tag may be further extended, and one or more additional universal primer sequences may be introduced.
- amplification and/or sequencing of the extended recording tag may be done using any combination of the universal primer sequences.
- FIG. 1B illustrates a general overview of transducing or converting a protein code to a nucleic acid (e.g., DNA) code where a plurality of proteins or polypeptides are fragmented into a plurality of peptides, which are then converted into a library of extended recording tags, representing the plurality of peptides.
- the extended recording tags constitute a DNA Encoded Library (DEL) representing the peptide sequences.
- DEL DNA Encoded Library
- the library can be appropriately modified to sequence on any Next Generation Sequencing (NGS) platform.
- NGS Next Generation Sequencing
- FIGS. 2A-2D illustrate an example of polypeptide (e.g., protein) analysis according to the methods disclosed herein, using multiple cycles of binding agents (e.g., antibodies, anticalins, N-recognins proteins (e.g., ClpSs, or UBR box proteins, etc.), and variants/homologues thereof, and aptamers etc.) comprising coding tags interacting with an immobilized protein that is co-localized or co-labeled with a single or multiple recording tags.
- binding agents e.g., antibodies, anticalins, N-recognins proteins (e.g., ClpSs, or UBR box proteins, etc.), and variants/homologues thereof, and aptamers etc.
- the recording tag comprises a universal priming site, a barcode (e.g., partition barcode, compartment barcode, and/or fraction barcode), an optional unique molecular identifier (UMI) sequence, and optionally a spacer sequence (Sp) used in information transfer between the coding tag and the recording tag (or an extended recording tag).
- the spacer sequence (Sp) can be constant across all binding cycles, be binding agent specific, and/or be binding cycle number specific (e.g., used for “clocking” the binding cycles).
- the coding tag comprises an encoder sequence providing identifying information for the binding agent (or a class of binding agents, for example, a class of binders that all specifically bind to a terminal amino acid, such as a modified N-terminal Q as shown in FIG. 3 ), an optional UMI, and a spacer sequence that hybridizes to the complementary spacer sequence on the recording tag, facilitating transfer of coding tag information to the recording tag (e.g., by primer extension, also referred to herein as polymerase extension). Ligation may also be used to transfer sequence information and in that case, a spacer sequence may be used but is not necessary.
- FIG. 2A illustrates a process of creating an extended recording tag through the cyclic binding of cognate binding agents to a analyte (such as a protein or protein complex), and corresponding information transfer from the binding agent's coding tag to the analyte's recording tag.
- the final extended recording tag is produced, containing binding agent coding tag information including encoder sequences from “n” binding cycles providing identifying information for the binding agents (e.g., antibody 1 (Ab1), antibody 2 (Ab2), antibody 3 (Ab3), . . .
- FIG. 2B illustrates an example of a scheme for labeling a protein with DNA barcoded recording tags.
- N-hydroxysuccinimide (NHS) is an amine reactive coupling agent
- DBCO Dibenzocyclooctyl
- the recording tags are coupled to ⁇ amines of lysine (K) residues (and optionally N-terminal amino acids) of the protein via NHS moieties.
- a heterobifunctional linker, NHS-alkyne is used to label the ⁇ amines of lysine (K) residues to create an alkyne “click” moiety.
- DNA recording tags can then easily be attached to these reactive alkyne groups via standard click chemistry.
- the DNA recording tag can also be designed with an orthogonal methyltetrazine (mTet) moiety for downstream coupling to a trans-cyclooctene (TCO)-derivatized sequencing substrate via an inverse Electron Demand Diels-Alder (iEDDA) reaction.
- mTet orthogonal methyltetrazine
- TCO trans-cyclooctene
- iEDDA inverse Electron Demand Diels-Alder
- FIG. 2C illustrates two examples of the protein analysis methods using recording tags.
- analytes such as protein macromolecules are immobilized on a solid support via a capture agent and optionally cross-linked. Either the protein or capture agent may co-localize or be labeled with a recording tag.
- proteins with associated recording tags are directly immobilized on a solid support.
- FIG. 2D illustrates an example of an overall workflow for a simple protein immunoassay using DNA encoding of cognate binders and sequencing of the resultant extended recording tag.
- the proteins can be sample barcoded (i.e., indexed) via recording tags and pooled prior to cyclic binding analysis, greatly increasing sample throughput and economizing on binding reagents.
- This approach is effectively a digital, simpler, and more scalable approach to performing reverse phase protein assays (RPPA), allowing measurement of protein levels (such as expression levels) in a large number of biological samples simultaneously in a quantitative manner.
- RPPA reverse phase protein assays
- FIGS. 3A-D illustrate a process for a degradation-based polypeptide sequencing assay by construction of an extended recording tag (e.g., DNA sequence) representing the polypeptide sequence.
- an extended recording tag e.g., DNA sequence
- a cyclic process such as N-terminal amino acid (NTAA) binding, coding tag information transfer to a recording tag attached to the polypeptide, terminal amino acid(s) cleavage (such as NTAA cleavage), and repeating the process in a cyclic manner, for example, all on a solid support.
- N-terminal amino acid of a peptide is labeled (e.g., with a phenylthiocarbamoyl (PTC), dinitrophenyl (DNP), sulfonyl nitrophenyl (SNP), acetyl, or guanidindyl moiety);
- PTC phenylthiocarbamoyl
- DNP dinitrophenyl
- SNP sulfonyl nitrophenyl
- acetyl or guanidindyl moiety
- B shows a binding agent and an associated coding tag bound to the labeled NTAA
- C shows the polypeptide bound to a solid support (e.g., bead) and associated with a recording tag (e.g., via a trifunctional linker), wherein upon binding of the binding agent to the NTAA of the polypeptide, information of the coding tag is transferred to the recording tag (e.g., via primer extension or lig
- the cycle is repeated “n” times to generate a final extended recording tag.
- the final extended recording tag is optionally flanked by universal priming sites to facilitate downstream amplification and/or DNA sequencing.
- the forward universal priming site e.g., Illumina's P5-S1 sequence
- the reverse universal priming site e.g., Illumina's P7-S2′ sequence
- This final step may be done independently of a binding agent.
- FIGS. 4A-B illustrate exemplary protein sequencing workflows according to the methods disclosed herein.
- FIG. 4A illustrates exemplary work flows with alternative modes outlined in light grey dashed lines, with a particular embodiment shown in boxes linked by arrows. Alternative modes for each step of the workflow are shown in boxes below the arrows.
- FIG. 4B illustrates options in conducting a cyclic binding and coding tag information transfer step to improve the efficiency of information transfer. Multiple recording tags per molecule can be employed. Moreover, for a given binding event, the transfer of coding tag information to the recording tag can be conducted multiples times, or alternatively, a surface amplification step can be employed to create copies of the extended recording tag library, etc.
- FIGS. 5A-B illustrate an overview of an exemplary construction of an extended recording tag using primer extension to transfer identifying information of a coding tag of a binding agent to a recording tag associated with an analyte such as a macromolecule (e.g., a polypeptide) to generate an extended recording tag.
- a coding tag comprising a unique encoder sequence with identifying information regarding the binding agent is optionally flanked on each end by a common spacer sequence (Sp′).
- FIG. 5A illustrates an NTAA binding agent comprising a coding tag binding to an NTAA of a polypeptide which is labeled with a recording tag and linked to a bead.
- the recording tag anneals to the coding tag via complementary spacer sequences (Sp anneals to Sp′), and a primer extension reaction mediates transfer of coding tag information to the recording tag using the spacer (Sp) as a priming site.
- the coding tag is illustrated as a duplex with a single stranded spacer (Sp′) sequence at the terminus distal to the binding agent. This configuration minimizes hybridization of the coding tag to internal sites in the recording tag and favors hybridization of the recording tag's terminal spacer (Sp) sequence with the single stranded spacer overhang (Sp′) of the coding tag.
- the extended recording tag may be pre-annealed with one or more oligonucleotides (e.g., complementary to an encoder and/or a spacer sequence) to block hybridization of the coding tag to internal recording tag sequence elements.
- FIG. 5B shows a final extended recording tag produced after “n” cycles of binding (“***” represents intervening binding cycles not shown in the extended recording tag) and transfer of coding tag information and the addition of a universal priming site at the 3′ end.
- FIG. 6 illustrates coding tag information being transferred to an extended recording tag via enzymatic ligation.
- Two different analytes are shown with their respective recording tags, with recording tag extension proceeding in parallel.
- Ligation can be facilitated by designing the double stranded coding tags so that the spacer sequences (Sp′) have a “sticky end” overhang on one strand that anneals with a complementary spacer (Sp) on the recording tag.
- This “sticky end” also known as “cohesive end” can be 0-8 bases in length, for example, around 2-4 bases.
- the complementary strand of the double stranded coding tag after being ligated to the recording tag, transfers information to the recording tag.
- the complementary strand may comprise another spacer sequence, which may be the same as or different from the Sp of the recording tag before the ligation.
- the direction of extension can be 5′ to 3′ as illustrated, or optionally 3′ to 5′.
- FIG. 7 illustrates a “spacer-less” approach of transferring coding tag information to a recording tag via chemical ligation to link the 3′ nucleotide of a recording tag or extended recording tag to the 5′ nucleotide of the coding tag (or its complement) without inserting a spacer sequence into the extended recording tag.
- the orientation of the extended recording tag and coding tag could also be inverted such that the 5′ end of the recording tag is ligated to the 3′ end of the coding tag (or complement).
- hybridization between complementary “helper” oligonucleotide sequences on the recording tag (“recording helper”) and the coding tag are used to stabilize the complex to enable specific chemical ligation of the recording tag to coding tag complementary strand.
- the resulting extended recording tag is devoid of spacer sequences. Also illustrated is a “click chemistry” version of chemical ligation (e.g., using azide and alkyne moieties (shown as a triple line symbol)) which can employ DNA, PNA, or similar nucleic acid polymers.
- FIGS. 8A-B illustrate an exemplary method of writing of post-translational modification (PTM) information of a polypeptide into an extended recording tag prior to N-terminal amino acid degradation.
- FIG. 8A A binding agent comprising a coding tag with identifying information regarding the binding agent (e.g., a phosphotyrosine antibody comprising a coding tag with identifying information for phosphotyrosine antibody) is capable of binding to the polypeptide.
- the binding agent e.g., a phosphotyrosine antibody comprising a coding tag with identifying information for phosphotyrosine antibody
- An extended recording tag may comprise coding tag information for both primary amino acid sequence (e.g., “aa 1 ”, “aa 2 ”, “aa 3 ” . . . , “aa N ”) and post-translational modifications (e.g., “PTM 1 ”, “PTM 2 ”) of the peptide.
- FIGS. 9A-B illustrate a process of multiple cycles of binding of a binding agent to an analyte (e.g., a macromolecule such as a polypeptide) and transferring information of a coding tag that is attached to a binding agent to an individual recording tag among a plurality of recording tags, for example, which are co-localized at a site of a single analyte attached to a solid support (e.g., a bead), thereby generating multiple extended recording tags that collectively represent the analyte information (e.g., presence or absence, level, or amount in a sample, binding profile to a library of binders, activity or reactivity, amino acid sequence, post-translational modification, sample origin, or any combination thereof).
- analyte e.g., a macromolecule such as a polypeptide
- FIGS. 9A-B illustrate a process of multiple cycles of binding of a binding agent to an analyte (e.g., a
- the analyte is a polypeptide and each cycle involves binding a binding agent to an N-terminal amino acid (NTAA), recording the binding event by transferring coding tag information to a recording tag, followed by removal of the NTAA to expose a new NTAA.
- FIG. 9A illustrates on a solid support a plurality of recording tags (e.g., comprising universal forward priming sequence and a UMI) which are available to a binding agent bound to the analyte.
- Individual recording tags possess a common spacer sequence (Sp) complementary to a common spacer sequence within coding tags of binding agents, which can be used to prime an extension reaction to transfer coding tag information to a recording tag.
- Sp common spacer sequence
- the plurality of recording tags may co-localize with the analyte on the support, and some of the recording tags may be closer to the analyte than others.
- the density of recording tags relative to the analyte density on the support may be controlled, so that statistically each analyte will have a plurality of recording tags (e.g., at least about two, about five, about ten, about 20, about 50, about 100, about 200, about 500, about 1000, about 2000, about 5000, or more) available to a binding agent bound to that analyte. This mode may be particularly useful for analyzing low abundance proteins or polypeptides in a sample.
- FIG. 9A shows a different recording tag is extended in each of Cycles 1-3 (e.g., a cycle-specific barcode in the binding agent or separately added in each binding/reaction cycle may be used to “clock” the binding/reactions), it is envisaged that an extended recording tag may be further extended in any one or more of subsequent binding cycles, and the resultant pool of extended recording tags may be a mix of recording tags that are extended only once, twice, three times, or more.
- a cycle-specific barcode in the binding agent or separately added in each binding/reaction cycle may be used to “clock” the binding/reactions
- FIG. 9B illustrates different pools of cycle-specific NTAA binding agents that are used for each successive cycle of binding, each pool having a cycle specific sequence, such as a cycle specific spacer sequence.
- the cycle specific sequence may be provided in a reagent separate from the binding agents.
- FIGS. 10A-C illustrate an exemplary mode comprising multiple cycles of transferring information of a coding tag that is attached to a binding agent to a recording tag among a plurality of recording tags co-localized at a site of a single analyte (e.g., a macromolecule such as a polypeptide) attached to a solid support (e.g., a bead), thereby generating multiple extended recording tags that collectively represent the analyte.
- the analyte is a polypeptide and each round of processing involves binding to an NTAA, recording the binding event, followed by removal of the NTAA to expose a new NTAA.
- FIG. 10A illustrates a plurality of recording tags (e.g., comprising a universal forward priming sequence and a UMI) on a solid support for the analyte, for example a single molecule per bead.
- Individual recording tags possess different spacer sequences at their 3′-end with different “cycle specific” sequences (e.g., C 1 , C 2 , C 3 , . . . C n ).
- the recording tags on each bead share the same compartment barcode and/or UMI sequence.
- a first cycle of binding (Cycle 1), a plurality of NTAA binding agents is contacted with the analyte.
- the binding agents used in Cycle 1 possess a common 5′-spacer sequence (C′1) that is complementary to the Cycle 1 C 1 spacer sequence of the recording tag.
- the binding agents used in Cycle 1 also possess a 3′-spacer sequence (C′ 2 ) that is complementary to the Cycle 2 spacer C 2 .
- a first NTAA binding agent binds to the free N-terminus of the analyte, and the information of a first coding tag is transferred to a cognate recording tag via primer extension from the C 1 sequence hybridized to the complementary C′ 1 spacer sequence.
- binding Cycle 2 contacts a plurality of NTAA binding agents that possess a Cycle 2 5′-spacer sequence (C′ 2 ) that is identical to the 3′-spacer sequence of the Cycle 1 binding agents and a common Cycle 3 3′-spacer sequence (C′ 3 ), with the analyte.
- a second NTAA binding agent binds to the NTAA of the analyte, and the information of a second coding tag is transferred to a cognate recording tag via primer extension from the complementary C 2 and C′ 2 spacer sequences.
- FIG. 10B illustrates different pools of cycle-specific binding agents that are used for each successive cycle of binding, each pool having cycle specific spacer sequences.
- 10C illustrates how the collection of extended recording tags (e.g., that are co-localized at the site of the analyte) can be assembled in a sequential order based on PCR assembly of the extended recording tags using cycle specific spacer sequences, thereby providing an ordered sequence of the analyte such as a macromolecule.
- extended recording tags e.g., that are co-localized at the site of the analyte
- cycle specific spacer sequences thereby providing an ordered sequence of the analyte such as a macromolecule.
- multiple copies of each extended recording tag are generated via amplification prior to concatenation.
- FIGS. 11A-B illustrate information transfer from recording tag to a coding tag or di-tag construct.
- a binding agent may be any type of binding agent as described herein; an anti-phosphotyrosine binding agent is shown for illustration purposes only.
- information is either transferred from the recording tag to the coding tag to generate an extended coding tag ( FIG. 11A ), or information is transferred from both the recording tag and coding tag to a third di-tag-forming construct ( FIG. 11B ).
- the di-tag and extended coding tag comprise the information of the recording tag (containing a barcode, an optional UMI sequence, and an optional compartment tag (CT) sequence (not illustrated)) and the coding tag.
- the di-tag and extended coding tag can be eluted from the recording tag, collected, and optionally amplified and read out on a next generation sequencer.
- FIGS. 12A-D illustrate design of PNA combinatorial barcode/UMI recording tag and di-tag detection of binding events.
- FIG. 12A the construction of a combinatorial PNA barcode/UMI via chemical ligation of four elementary PNA word sequences (A, A′-B, B′-C, and C′) is illustrated. Hybridizing DNA arms are included to create a spacer-less combinatorial template for combinatorial assembly of a PNA barcode/UMI. Chemical ligation is used to stitch the annealed PNA “words” together.
- FIG. 12B shows a method to transfer the PNA information of the recording tag to a DNA intermediate. The DNA intermediate is capable of transferring information to the coding tag.
- complementary DNA word sequences are annealed to the PNA and chemically ligated (optionally enzymatically ligated if a ligase is discovered that uses a PNA template).
- the DNA intermediate is designed to interact with the coding tag via a spacer sequence, Sp.
- a strand-displacing primer extension step displaces the ligated DNA and transfers the recording tag information from the DNA intermediate to the coding tag to generate an extended coding tag.
- a terminator nucleotide may be incorporated into the end of the DNA intermediate to prevent transfer of coding tag information to the DNA intermediate via primer extension.
- FIG. 12D Alternatively, information can be transferred from the coding tag to the DNA intermediate to generate a di-tag construct.
- a terminator nucleotide may be incorporated into the end of the coding tag to prevent transfer of recording tag information from the DNA intermediate to the coding tag.
- FIGS. 13A-E illustrate proteome partitioning on a compartment barcoded bead, and subsequent di-tag assembly via emulsion fusion PCR to generate a library of elements representing polypeptide sequence composition.
- the amino acid content of the polypeptide can be subsequently characterized through N-terminal sequencing or alternatively through attachment (covalent or non-covalent) of amino acid specific chemical labels or binding agents associated with a coding tag.
- the coding tag comprises universal priming sequence, as well as an encoder sequence for the amino acid identity, a compartment tag, and an amino acid UMI. After information transfer, the di-tags are mapped back to the originating molecule via the recording tag UMI.
- the proteome is compartmentalized into droplets with barcoded beads.
- Peptides with associated recording tags are attached to the bead surface.
- the droplet emulsion is broken, releasing barcoded beads with partitioned peptides.
- specific amino acid residues on the peptides are chemically labeled with DNA coding tags that are conjugated to site-specific labeling moieties.
- the DNA coding tags comprise amino acid barcode information and optionally an amino acid UMI.
- FIG. 13C Labeled peptide-recording tag complexes are released from the beads.
- FIG. 13D The labeled peptide-recording tag complexes are emulsified into nano or microemulsions such that there is, on average, less than one peptide-recording tag complex per compartment.
- FIG. 13E An emulsion fusion PCR transfers recording tag information (e.g., compartment barcode) to all of the DNA coding tags attached to the amino acid residues.
- FIG. 14 illustrates generation of extended coding tags from emulsified peptide recording tag—coding tags complex.
- the peptide complexes from FIG. 13C are co-emulsified with PCR reagents into droplets with on average a single peptide complex per droplet.
- a three-primer fusion PCR approach is used to amplify the recording tag associated with the peptide, fuse the amplified recording tags to multiple binding agent coding tags or coding tags of covalently labeled amino acids, extend the coding tags via primer extension to transfer peptide UMI and compartment tag information from the recording tag to the coding tag, and amplify the resultant extended coding tags.
- the U1 universal primer and Sp primer are designed to have a higher melting T m than the U2 tr universal primer. This enables a two-step PCR in which the first few cycles are performed at a higher annealing temperature to amplify the recording tag, and then stepped to a lower Tm so that the recording tags and coding tags prime on each other during PCR to produce an extended coding tag, and the U1 and U2 tr universal primers are used to prime amplification of the resultant extended coding tag product.
- premature polymerase extension from the U2 tr primer can be prevented by using a photo-labile 3′ blocking group (Young et al., 2008 , Chem. Commun . (Camb) 4:462-464).
- a photo-labile 3′ blocking group Young et al., 2008 , Chem. Commun . (Camb) 4:462-464.
- FIG. 15 illustrates use of proteome partitioning and barcoding facilitating enhanced mappability and phasing of proteins.
- proteins are typically digested into peptides.
- information about the relationship between individual polypeptides that originated from a parent protein molecule, and their relationship to the parent protein molecule is lost.
- individual peptide sequences are mapped back to a collection of protein sequences from which they may have derived.
- the task of finding a unique match in such a set is rendered more difficult with short and/or partial peptide sequences, and as the size and complexity of the collection (e.g., proteome sequence complexity) increases.
- the partitioning of the proteome into barcoded (e.g., compartment tagged) compartments or partitions, subsequent digestion of the protein into peptides, and the joining of the compartment tags to the peptides reduces the “protein” space to which a peptide sequence needs to be mapped to, greatly simplifying the task in the case of complex protein samples.
- Labeling of a protein with unique molecular identifier (UMI) prior to digestion into peptides facilitates mapping of peptides back to the originating protein molecule and allows annotation of phasing information between post-translational modified (PTM) variants derived from the same protein molecule and identification of individual proteoforms.
- UMI unique molecular identifier
- FIG. 15A shows an example of proteome partitioning comprising labeling proteins with recording tags comprising a compartment or partition barcode and subsequent fragmentation into recording-tag labeled peptides.
- FIG. 15B For partial peptide sequence information or even just composition information, this mapping is highly-degenerate. However, partial peptide sequence or composition information coupled with information from multiple peptides from the same protein, allow unique identification of the originating protein molecule.
- FIG. 16 illustrates exemplary modes of compartment tagged bead sequence design.
- the compartment tags comprise a barcode of X 5-20 to identify an individual compartment and a unique molecular identifier (UMI) of N 5-10 to identify the peptide to which the compartment tag is joined, where X and N represent degenerate nucleobases or nucleobase words.
- Compartment tags can be single stranded (upper depictions) or double stranded (lower depictions).
- compartment tags can be a chimeric molecule comprising a peptide sequence with a recognition sequence for a protein ligase (e.g., butelase I) for joining to a peptide of interest (left depictions).
- a chemical moiety can be included on the compartment tag for coupling to a peptide of interest (e.g., azide as shown in right depictions).
- FIGS. 17A-B illustrate: (A) a plurality of extended recording tags representing a plurality of peptides; and (B) an exemplary method of target peptide enrichment via standard hybrid capture techniques.
- hybrid capture enrichment may use one or more biotinylated “bait” oligonucleotides that hybridize to extended recording tags representing one or more peptides of interest (“target peptides”) from a library of extended recording tags representing a library of peptides.
- the bait oligonucleotide:target extended recording tag hybridization pairs are pulled down from solution via the biotin tag after hybridization to generate an enriched fraction of extended recording tags representing the peptide or peptides of interest.
- the separation (“pull down”) of extended recording tags can be accomplished, for example, using streptavidin-coated magnetic beads.
- the biotin moieties bind to streptavidin on the beads, and separation is accomplished by localizing the beads using a magnet while solution is removed or exchanged.
- a non-biotinylated competitor enrichment oligonucleotide that competitively hybridizes to extended recording tags representing undesirable or over-abundant peptides can optionally be included in the hybridization step of a hybrid capture assay to modulate the amount of the enriched target peptide.
- the non-biotinylated competitor oligonucleotide competes for hybridization to the target peptide, but the hybridization duplex is not captured during the capture step due to the absence of a biotin moiety. Therefore, the enriched extended recording tag fraction can be modulated by adjusting the ratio of the competitor oligonucleotide to the biotinylated “bait” oligonucleotide over a large dynamic range. This step will be important to address the dynamic range issue of protein abundance within the sample.
- FIGS. 18A-B illustrate exemplary methods of single cell and bulk proteome partitioning into individual droplets, each droplet comprising a bead having a plurality of compartment tags attached thereto to correlate peptides to their originating protein complex, or to proteins originating from a single cell.
- the compartment tags comprise barcodes.
- Manipulation of droplet constituents after droplet formation (A) Single cell partitioning into an individual droplet followed by cell lysis to release the cell proteome, and proteolysis to digest the cell proteome into peptides, and inactivation of the protease following sufficient proteolysis; (B) Bulk proteome partitioning into a plurality of droplets wherein an individual droplet comprises a protein complex followed by proteolysis to digest the protein complex into peptides, and inactivation of the protease following sufficient proteolysis.
- a heat labile metallo-protease can be used to digest the encapsulated proteins into peptides after photo-release of photo-caged divalent cations to activate the protease.
- the protease can be heat inactivated following sufficient proteolysis, or the divalent cations may be chelated.
- Droplets contain hybridized or releasable compartment tags comprising nucleic acid barcodes (separate from recording tag) capable of being ligated to either an N- or C-terminal amino acid of a peptide.
- FIGS. 19A-B illustrate exemplary methods of single cell and bulk proteome partitioning into individual droplets, each droplet comprising a bead having a plurality of bifunctional recording tags with compartment tags attached thereto to correlate peptides to their originating protein or protein complex, or proteins to originating single cell.
- Manipulation of droplet constituents after post droplet formation (A) Single cell partitioning into an individual droplet followed by cell lysis to release the cell proteome, and proteolysis to digest the cell proteome into peptides, and inactivation of the protease following sufficient proteolysis; (B) Bulk proteome partitioning into a plurality of droplets wherein an individual droplet comprises a protein complex followed by proteolysis to digest the protein complex into peptides, and inactivation of the protease following sufficient proteolysis.
- a heat labile metallo-protease can be used to digest the encapsulated proteins into peptides after photo-release of photo-caged divalent cations (e.g., Zn 2+ ).
- the protease can be heat inactivated following sufficient proteolysis or the divalent cations may be chelated.
- Droplets contain hybridized or releasable compartment tags comprising nucleic acid barcodes (separate from recording tag) capable of being ligated to either an N- or C-terminal amino acid of a peptide.
- FIGS. 20A-L illustrate generation of compartment barcoded recording tags attached to peptides.
- Compartment barcoding technology e.g., barcoded beads in microfluidic droplets, etc.
- Compartment barcoding technology can be used to transfer a compartment-specific barcode to molecular contents encapsulated within a particular compartment.
- the protein molecule is denatured, and the ⁇ -amine group of lysine residues (K) is chemically conjugated to an activated universal DNA tag molecule (comprising a universal priming sequence (U1)), shown with NHS moiety at the 5′ end, but any other bioconjugation moiety can also be employed).
- U1 universal priming sequence
- the universal DNA tagged-polypeptides are hybridized to nucleic acid molecules bound to beads, wherein the nucleic acid molecules bound to an individual bead comprise a unique population of compartment tag (barcode) sequences.
- the compartmentalization can occur by separating the sample into different physical compartments, such as droplets (illustrated by the dashed oval).
- compartmentalization can be directly accomplished by the immobilization of the labeled polypeptides on the bead surface, e.g., via annealing of the universal DNA tags on the polypeptide to the compartment DNA tags on the bead, without the need for additional physical separation.
- a single polypeptide molecule interacts with only a single bead (e.g., a single polypeptide does not span multiple beads). Multiple polypeptides, however, may interact with the same bead.
- the nucleic acid molecules bound to the bead may be comprised of a common Sp (spacer) sequence, a unique molecular identifier (UMI), and a sequence complementary to the polypeptide DNA tag, U1′.
- C After annealing of the universal DNA tagged polypeptides to the compartment tags bound to the bead, the compartment tags are released from the beads via cleavage of the attachment linkers.
- the annealed U1 DNA tag primers are extended via polymerase-based primer extension using the compartment tag nucleic acid molecule originating from the bead as template.
- the primer extension step may be carried out after release of the compartment tags from the bead as shown in (C) or, optionally, while the compartment tags are still attached to the bead (not shown). This effectively writes the barcode sequence from the compartment tags on the bead onto the U1 DNA-tag sequence on the polypeptide. This new sequence constitutes a recording tag.
- a protease e.g., Lys-C (cleaves on C-terminal side of lysine residues), Glu-C (cleaves on C-terminal side of glutamic acid residues and to a lower extent glutamic acid residues), or random protease such as Proteinase K, is used to cleave the polypeptide into peptide fragments.
- Each peptide fragment is labeled with an extended DNA tag sequence constituting a recording tag on its C-terminal lysine for downstream peptide sequencing as disclosed herein.
- the recording tagged peptides are coupled to azide beads through a strained alkyne label, DBCO.
- the azide beads optionally also contain a capture sequence complementary to the recording tag to facilitate the efficiency of DBCO-azide immobilization. It should be noted that removing the peptides from the original beads and re-immobilizing to a new solid support (e.g., beads) permits optimal intermolecular spacing between peptides to facilitate peptide sequencing methods as disclosed herein.
- FIG. 20G-L illustrates a similar concept as illustrated in FIGS. 20A-F except using click chemistry conjugation of DNA tags to an alkyne pre-labeled polypeptide (as described in FIG. 2B ).
- the Azide and mTet chemistries are orthogonal allowing click conjugation to DNA tags and click iEDDA conjugation (mTet and TCO) to the sequencing substrate.
- FIG. 21 illustrates an exemplary method using flow-focusing T-junction for single cell and compartment tagged (e.g., barcode) compartmentalization with beads.
- FIGS. 22A-B illustrate exemplary tagging details.
- a compartment tag (DNA-peptide chimera) is attached onto the peptide using peptide ligation with Butelase I.
- Compartment tag information is transferred to an associated recording tag prior to commencement of peptide sequencing.
- an endopeptidase AspN which selectively cleaves peptide bonds N-terminal to aspartic acid residues, can be used to cleave the compartment tag after information transfer to the recording tag.
- FIGS. 23A-C Array-based barcodes for a spatial proteomics-based analysis of a tissue slice.
- A An array of spatially-encoded DNA barcodes (feature barcodes denoted by BC ij ), is combined with a tissue slice (e.g., FFPE or frozen).
- the tissue slice is fixed and permeabilized.
- the array feature size is smaller than the cell size ( ⁇ 10 ⁇ m for human cells).
- the array-mounted tissue slice is treated with reagents to reverse cross-linking (e.g., antigen retrieval protocol w/citraconic anhydride (Namimatsu, Ghazizadeh et al.
- the proteins therein are labeled with site-reactive DNA labels, that effectively label all protein molecules with DNA recording tags (e.g., lysine labeling, liberated after antigen retrieval).
- DNA recording tags e.g., lysine labeling, liberated after antigen retrieval.
- the array bound DNA barcode sequences are cleaved and allowed to diffuse into the mounted tissue slice and hybridize to DNA recording tags attached to the proteins therein.
- the array-mounted tissue is now subjected to polymerase extension to transfer information of the hybridized barcodes to the DNA recording tags labeling the proteins. After transfer of the barcode information, the array-mounted tissue is scraped from the slides, optionally digested with a protease, and the proteins or peptides extracted into solution.
- FIGS. 24A-B illustrate two different exemplary DNA target analytes (AB and CD) that are immobilized on beads and assayed by binding agents attached to coding tags.
- This model system serves to illustrate the single molecule behavior of coding tag transfer from a bound agent to a proximal reporting tag.
- the coding tags are incorporated into an extended recoding tag via primer extension.
- 24A illustrates the interaction of an AB macromolecule with an A-specific binding agent (“A′”, an oligonucleotide sequence complementary to the “A” component of the AB macromolecule) and transfer of information of an associated coding tag to a recording tag via primer extension, and a B-specific binding agent (“B′”, an oligonucleotide sequence complementary to the “B” component of the AB macromolecule) and transfer of information of an associated coding tag to a recoding tag via primer extension.
- Coding tags A and B are of different sequence, and for ease of identification in this illustration, are also of different length. The different lengths facilitate analysis of coding tag transfer by gel electrophoresis, but are not required for analysis by next generation sequencing.
- the binding of A′ and B′ binding agents are illustrated as alternative possibilities for a single binding cycle. If a second cycle is added, the extended recording tag would be further extended. Depending on which of A′ or B′ binding agents are added in the first and second cycles, the extended recording tags can contain coding tag information of the form AA, AB, BA, and BB. Thus, the extended recording tag contains information on the order of binding events as well as the identity of binders. Similarly, FIG.
- CD macromolecule 24B illustrates the interaction of a CD macromolecule with a C-specific binding agent (“C′”, an oligonucleotide sequence complementary to the “C” component of the CD macromolecule) and transfer of information of an associated coding tag to a recording tag via primer extension, and a D-specific binding agent (“D′”, an oligonucleotide sequence complementary to the “D” component of the CD macromolecule) and transfer of information of an associated coding tag to a recording tag via primer extension.
- Coding tags C and D are of different sequence and for ease of identification in this illustration are also of different length. The different lengths facilitate analysis of coding tag transfer by gel electrophoresis, but are not required for analysis by next generation sequencing.
- the binding of C′ and D′ binding agents are illustrated as alternative possibilities for a single binding cycle. If a second cycle is added, the extended recording tag would be further extended.
- the extended recording tags can contain coding tag information of the form CC, CD, DC, and DD. Coding tags may optionally comprise a UMI. The inclusion of UMIs in coding tags allows additional information to be recorded about a binding event; it allows binding events to be distinguished at the level of individual binding agents. This can be useful if an individual binding agent can participate in more than one binding event (e.g. its binding affinity is such that it can disengage and re-bind sufficiently frequently to participate in more than one event).
- a coding tag might transfer information to the recording tag twice or more in the same binding cycle.
- the use of a UMI would reveal that these were likely repeated information transfer events all linked to a single binding event.
- FIG. 25 illustrates exemplary DNA target macromolecules (AB) and immobilized on beads and assayed by binding agents attached to coding tags.
- An A-specific binding agent (“A′”, oligonucleotide complementary to A component of AB macromolecule) interacts with an AB macromolecule and information of an associated coding tag is transferred to a recording tag by ligation.
- a B-specific binding agent (“B′”, an oligonucleotide complementary to B component of AB macromolecule) interacts with an AB macromolecule and information of an associated coding tag is transferred to a recording tag by ligation.
- Coding tags A and B are of different sequence and for ease of identification in this illustration are also of different length. The different lengths facilitate analysis of coding tag transfer by gel electrophoresis, but are not required for analysis by next generation sequencing.
- FIGS. 26A-B illustrate exemplary DNA-peptide analytes (such as macromolecules) for binding/coding tag transfer via primer extension.
- FIG. 26A illustrates an exemplary oligonucleotide-peptide target macromolecule (“A” oligonucleotide-cMyc peptide) immobilized on beads.
- a cMyc-specific binding agent e.g. antibody
- the transfer of information of the cMyc coding tag to a recording tag may be analyzed by gel electrophoresis.
- 26B illustrates an exemplary oligonucleotide-peptide target macromolecule (“C” oligonucleotide-hemagglutinin (HA) peptide) immobilized on beads.
- An HA-specific binding agent e.g., antibody
- the transfer of information of the coding tag to a recording tag may be analyzed by gel electrophoresis.
- the binding of cMyc antibody-coding tag and HA antibody-coding tag are illustrated as alternative possibilities for a single binding cycle. If a second binding cycle is performed, the extended recording tag would be further extended.
- the extended recording tags can contain coding tag information of the form cMyc-HA, HA-cMyc, cMyc-cMyc, and HA-HA.
- additional binding agents can also be introduced to enable detection of the A and C oligonucleotide components of the macromolecules.
- hybrid macromolecules comprising different types of backbone can be analyzed via transfer of information to a recording tag and readout of the extended recording tag, which contains information on the order of binding events as well as the identity of the binding agents.
- FIGS. 27A-D illustrate examples for the generation of Error-Correcting Barcodes.
- This algorithm generates 15-mer “Hamming” barcodes that can correct substitution errors out to a distance of four substitutions, and detect errors out to nine substitutions.
- the subset of 65 barcodes was created by filtering out barcodes that didn't exhibit a variety of nanopore current levels (for nanopore-based sequencing) or that were too correlated with other members of the set.
- (B) A plot of the predicted nanopore current levels for the 15-mer barcodes passing through the pore. The predicted currents were computed by splitting each 15-mer barcode word into composite sets of 11 overlapping 5-mer words, and using a 5-mer R9 nanopore current level look-up table (template_median68pA.5mers.model, available at https://github.com/jts/nanopolish/tree/master/etc/r9-models) to predict the corresponding current level as the barcode passes through the nanopore, one base at a time.
- template_median68pA.5mers.model available at https://github.com/jts/nanopolish/tree/master/etc/r9-models
- this set of 65 barcodes exhibit unique current signatures for each of its members.
- C Generation of PCR products as model extended recording tags for nanopore sequencing is shown using overlapping sets of DTR and DTR primers. PCR amplicons are then ligated to form a concatenated extended recording tag model.
- D Nanopore sequencing read of exemplary “extended recording tag” model (read length 734 bases) generated as shown in FIG. 27C .
- the MinIon R9.4 Read has a quality score of 7.2 (poor read quality).
- a 15-mer spacer element is underlined. Barcodes can align in either forward or reverse orientation, denoted by BC or BC′ designation.
- FIGS. 28A-D illustrate examples for the analyte-specific labeling of proteins with recording tags.
- a binding agent targeting a protein analyte of interest in its native conformation comprises an analyte-specific barcode (BC A ′) that hybridizes to a complementary analyte-specific barcode (BC A ) on a DNA recording tag.
- BC A ′ an analyte-specific barcode
- BC A complementary analyte-specific barcode
- the DNA recording tag could be attached to the binding agent via a cleavable linker, and the DNA recording tag is “clicked” to the protein directly and is subsequently cleaved from the binding agent (via the cleavable linker).
- the DNA recording tag comprises a reactive coupling moiety (such as a click chemistry reagent (e.g., azide, mTet, etc.) for coupling to the protein of interest, and other functional components (e.g., universal priming sequence (P1), sample barcode (BCs), analyte specific barcode (BC A ), and spacer sequence (Sp)).
- a sample barcode (BCs) can also be used to label and distinguish proteins from different samples.
- the DNA recording tag may also comprise an orthogonal coupling moiety (e.g., mTet) for subsequent coupling to a substrate surface.
- the protein is pre-labeled with a click chemistry coupling moiety cognate for the click chemistry coupling moiety on the DNA recording tag (e.g., alkyne moiety on protein is cognate for azide moiety on DNA recording tag).
- reagents for labeling the DNA recording tag with coupling moieties for click chemistry coupling include alkyne-NHS reagents for lysine labeling, alkyne-benzophenone reagents for photoaffinity labeling, etc.
- the reactive coupling moiety on the recording tag (e.g., azide) covalently attaches to the cognate click chemistry coupling moiety (shown as a triple line symbol) on the proximal protein.
- the attached binding agent is removed by digestion of uracils (U) using a uracil-specific excision reagent (e.g., USERTM).
- the DNA recording tag labeled target protein analyte is immobilized to a substrate surface using a suitable bioconjugate chemistry reaction, such as click chemistry (alkyne-azide binding pair, methyl tetrazine (mTET)-trans-cyclooctene (TCO) binding pair, etc.).
- a suitable bioconjugate chemistry reaction such as click chemistry (alkyne-azide binding pair, methyl tetrazine (mTET)-trans-cyclooctene (TCO) binding pair, etc.
- the entire target protein-recording tag labeling assay is performed in a single tube comprising many different target protein analytes using a pool of binding agents and a pool of recording tags.
- multiple protein analyte samples can be pooled before the immobilization step in (D).
- NGPA next generation protein assay
- FIGS. 29A-D illustrate examples for the conjugation of DNA recording tags to polypeptides.
- a denatured polypeptide is labeled with a bifunctional click chemistry reagent, such as alkyne-NHS ester (acetylene-PEG-NHS ester) reagent or alkyne-benzophenone to generate an alkyne-labeled (triple line symbol) polypeptide.
- An alkyne can also be a strained alkyne, such as cyclooctynes including Dibenzocyclooctyl (DBCO), etc.
- B An example of a DNA recording tag design that is chemically coupled to the alkyne-labeled polypeptide is shown.
- the recording tag comprises a universal priming sequence (P1), a barcode (BC), and a spacer sequence (Sp).
- the recording tag is labeled with a mTet moiety for coupling to a substrate surface and an azide moiety for coupling with the alkyne moiety of the labeled polypeptide.
- C A denatured, alkyne-labeled protein or polypeptide is labeled with a recording tag via the alkyne and azide moieties.
- the recording tag-labeled polypeptide can be further labeled with a compartment barcode, e.g., via annealing to complementary sequences attached to a compartment bead and primer extension (also referred to as polymerase extension), or a shown in FIGS. 20H-J .
- a compartment barcode e.g., via annealing to complementary sequences attached to a compartment bead and primer extension (also referred to as polymerase extension), or a shown in FIGS. 20H-J .
- D Protease digestion of the recording tag-labeled polypeptide creates a population of recording tag-labeled peptides.
- some peptides will not be labeled with any recording tags.
- some peptides may have one or more recording tags attached.
- FIGS. 30A-E illustrate an exemplary process of writing sample barcodes into recording tags after initial DNA tag labeling of polypeptides.
- a denatured polypeptide is labeled with a bifunctional click chemistry reagent such as an alkyne-NHS reagent or alkyne-benzophenone to generate an alkyne-labeled polypeptide.
- B After alkyne (or alternative click chemistry moiety) labeling of the polypeptide, DNA tags comprising a universal priming sequence (P1) and labeled with an azide moiety and an mTet moiety are coupled to the polypeptide via the azide-alkyne interaction. It is understood that other click chemistry interactions may be employed.
- a recording tag DNA construct comprising a sample barcode information (BC S ′) and other recording tag functional components (e.g., universal priming sequence (P1′), spacer sequence (Sp′)) anneals to the DNA tag-labeled polypeptide via complementary universal priming sequences (P1-P1′). Recording tag information is transferred to the DNA tag by polymerase extension.
- P1′ universal priming sequence
- Sp′ spacer sequence
- Recording tag information is transferred to the DNA tag by polymerase extension.
- D Protease digestion of the recording tag-labeled polypeptide creates a population of recording tag-labeled peptides.
- FIGS. 31A-D illustrate examples for bead compartmentalization for barcoding polypeptides.
- a polypeptide is labeled in solution with a heterobifunctional click chemistry reagent using standard bioconjugation or photoaffinity labeling techniques. Possible labeling sites include F-amine of lysine residues (e.g., with NHS-alkyne as shown) or the carbon backbone of the peptide (e.g., with benzophenone-alkyne).
- Azide-labeled DNA tags comprising a universal priming sequence (P1) are coupled to the alkyne moieties of the labeled polypeptide.
- the DNA tag-labeled polypeptide is annealed to DNA recording tag labeled beads via complementary DNA sequences (P1 and P1′).
- the DNA recording tags on the bead comprises a spacer sequence (Sp′), a compartment barcode sequence (BC P ′), an optional unique molecular identifier (UMI), and a universal sequence (P1′).
- the DNA recording tag information is transferred to the DNA tags on the polypeptide via polymerase extension (alternatively, ligation could be employed). After information transfer, the resulting polypeptide comprises multiple recording tags containing several functional elements including compartment barcodes.
- D) Protease digestion of the recording tag-labeled polypeptide creates a population of recording tag-labeled peptides.
- the recording tag-labeled peptides are dissociated from the beads, and
- E) re-immobilized onto a sequencing substrate e.g., using iEDDA click chemistry between mTet and TCO moieties as
- FIGS. 32A-H illustrate examples for the workflow for Next Generation Protein Assay (NGPA).
- NGPA Next Generation Protein Assay
- a protein sample is labeled with a DNA recording tag comprised of several functional units, e.g., a universal priming sequence (P1), a barcode sequence (BC), an optional UMI sequence, and a spacer sequence (Sp) (enables information transfer with a binding agent coding tag).
- P1 universal priming sequence
- BC barcode sequence
- Sp spacer sequence
- the labeled proteins are immobilized (passively or covalently) to a substrate (e.g., bead, porous bead or porous matrix).
- B) The substrate is blocked with protein and, optionally, competitor oligonucleotides (Sp′) complementary to the spacer sequence are added to minimize non-specific interaction of the analyte recording tag sequence.
- Sp′ competitor oligonucleotides
- Analyte-specific antibodies (with associated coding tags) are incubated with substrate-bound protein.
- the coding tag may comprise a uracil base for subsequent uracil specific cleavage.
- D After antibody binding, excess competitor oligonucleotides (Sp′), if added, are washed away.
- the coding tag transiently anneals to the recording tag via complementary spacer sequences, and the coding tag information is transferred to the recording tag in a primer extension reaction to generate an extended recording tag. If the immobilized protein is denatured, the bound antibody and annealed coding tag can be removed under alkaline wash conditions such as with 0.1N NaOH.
- milder conditions may be needed to remove the bound antibody and coding tag.
- An example of milder antibody removal conditions is outlined in panels E-H.
- E After information transfer from the coding tag to the recording tag, the coding tag is nicked (cleaved) at its uracil site using a uracil-specific excision reagent (e.g., USERTM) enzyme mix.
- F The bound antibody is removed from the protein using a high-salt, low/high pH wash. The truncated DNA coding tag remaining attached to the antibody is short and rapidly elutes off as well. The longer DNA coding tag fragment may or may not remain annealed to the recording tag.
- a second binding cycle commences as in steps (B)-(D) and a second primer extension step transfers the coding tag information from the second antibody to the extended recording tag via primer extension.
- the result of two binding cycles is a concatenate of binding information from the first antibody and second antibody attached to the recording tag.
- FIGS. 33A-D illustrate examples for a single-step Next Generation Protein Assay (NGPA) using multiple binding agents and enzymatically-mediated sequential information transfer.
- NGPA assay with immobilized protein molecule simultaneously bound by two cognate binding agents (e.g., antibodies).
- two cognate binding agents e.g., antibodies
- a combined primer extension and DNA nicking step is used to transfer information from the coding tags of bound antibodies to the recording tag.
- the caret symbol ( ⁇ circumflex over ( ) ⁇ ) in the coding tags represents a double stranded DNA nicking endonuclease site.
- the coding tag of the antibody bound to epitope 1 (Epi #1) of a protein transfers coding tag information (e.g., encoder sequence) to the recording tag in a primer extension step following hybridization of complementary spacer sequences.
- coding tag information e.g., encoder sequence
- FIG. 33B once the double stranded DNA duplex between the extended recording tag and coding tag is formed, a nicking endonuclease that cleaves only one strand of DNA on a double-stranded DNA substrate, such as Nt.BsmAI, which is active at 37° C., is used to cleave the coding tag.
- the duplex formed from the truncated coding tag-binding agent and extended recording tag is thermodynamically unstable and dissociates.
- the longer coding tag fragment may or may not remain annealed to the recording tag.
- this allows the coding tag from the antibody bound to epitope #2 (Epi #2) of the protein to anneal to the extended recording tag via complementary spacer sequences, and the extended recording tag to be further extended by transferring information from the coding tag of Epi #2 antibody to the extended recording tag via primer extension.
- Epi #2 epitope #2
- a nicking endonuclease such Nb.BssSI.
- use of a non-strand displacing polymerase during primer extension also referred to as polymerase extension
- a non-strand displacing polymerase prevents extension of the cleaved coding tag stub that remains annealed to the recording tag by more than a single base.
- the coding tag can comprise an encoder sequence identical for all binding agents (e.g., antibodies) specific for a given analyte (e.g., cognate protein), can comprise an epitope-specific encoder sequence, or can comprise a unique molecular identifier (UMI) to distinguish between different molecular events.
- binding agents e.g., antibodies
- analyte e.g., cognate protein
- UMI unique molecular identifier
- FIGS. 34A-C illustrate examples for controlled density of recording tag-peptide immobilization using titration of reactive moieties on substrate surface.
- peptide density on a substrate surface may be titrated by controlling the density of functional coupling moieties on the surface of the substrate. This can be accomplished by derivitizing the surface of the substrate with an appropriate ratio of active coupling molecules to “dummy” coupling molecules.
- NHS-PEG-TCO reagent active coupling molecule
- NHS-mPEG dummy molecule
- Functionalized PEGs come in various molecular weights from 300 to over 40,000.
- a bifunctional 5′ amine DNA recording tag (mTet is other functional moiety) is coupled to a N-terminal Cys residue of a peptide using a succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 (SMCC) bifunctional cross-linker.
- the internal mTet-dT group on the recording tag is created from an azide-dT group using mTetrazine-Azide.
- the recording tag labeled peptides are immobilized to the activated substrate surface from FIG. 34A using the iEDDA click chemistry reaction with mTet and TCO.
- the mTet-TCO iEDDA coupling reaction is extremely fast, efficient, and stable (mTet-TCO is more stable than Tet-TCO).
- FIGS. 35A-C illustrate examples for next Generation Protein Sequencing (NGPS) binding cycle-specific coding tags.
- A Design of NGPS assay with a cycle-specific N-terminal amino acid (NTAA) binding agent coding tags.
- An NTAA binding agent e.g., antibody specific for N-terminal DNP-labeled tyrosine
- P1 universal priming sequence
- BC barcode
- Sp spacer sequence
- the coding tag associated with the NTAA binding agent comes into proximity of the recording tag and anneals to the recording tag via complementary spacer sequences. Coding tag information is transferred to the recording tag via primer extension.
- the coding tag can comprise of a cycle-specific barcode.
- coding tags of binding agents that bind to an analyte have the same encoder barcode independent of cycle number, which is combined with a unique binding cycle-specific barcode.
- a coding tag for a binding agent to an analyte comprises a unique encoder barcode for the combined analyte-binding cycle information.
- a common spacer sequence can be used for binding agents' coding tags in each binding cycle.
- binding agents from each binding cycle have a short binding cycle-specific barcode to identify the binding cycle, which together with the encoder barcode that identifies the binding agent, provides a unique combination barcode that identifies a particular binding agent-binding cycle combination.
- the extended recording tag can be converted into an amplifiable library using a capping cycle step where, for example, a cap comprising a universal priming sequence P1′ linked to a universal priming sequence P2 and spacer sequence Sp′ initially anneals to the extended recording tag via complementary P1 and P1′ sequences to bring the cap in proximity to the extended recording tag.
- the complementary Sp and Sp′ sequences in the extended recording tag and cap anneal and primer extension adds the second universal primer sequence (P2) to the extended recording tag.
- FIGS. 36A-E illustrate examples for DNA based model system for demonstrating information transfer from coding tags to recording tags.
- Exemplary binding and intra-molecular writing was demonstrated by an oligonucleotide model system.
- the targeting agent A′ and B′ in coding tags were designed to hybridize to target binding regions A and B in recording tags.
- Recording tag (RT) mix was prepared by pooling two recoding tags, saRT_Abc_v2 (A target) and saRT_Bbc_V2 (B target), at equal concentrations.
- Recording tags are biotinylated at their 5′ end and contain a unique target binding region, a universal forward primer sequence, a unique DNA barcode, and an 8 base common spacer sequence (Sp).
- the coding tags contain unique encoder barcodes base flanked by 8 base common spacer sequences (Sp′), one of which is covalently linked to A or B target agents via polyethylene glycol linker.
- Sp′ base common spacer sequences
- FIG. 36A biotinylated recording tag oligonucleotides (saRT_Abc_v2 and saRT_Bbc_V2) along with a biotinylated Dummy-T10 oligonucleotide were immobilized to streptavidin beads.
- the recording tags were designed with A or B capture sequences (recognized by cognate binding agents—A′ and B′, respectively), and corresponding barcodes (rtA_BC and rtB_BC) to identify the binding target.
- All barcodes in this model system were chosen from the set of 65 15-mer barcodes (SEQ ID NOs: 1-65). In some cases, 15-mer barcodes were combined to constitute a longer barcode for ease of gel analysis.
- Complementary blocking oligos (DupCT_A′BC and DupCT_AB′BC) to a portion of the coding tag sequence (leaving a single stranded Sp′ sequence) were optionally pre-annealed to the coding tags prior to annealing of coding tags to the bead-immobilized recording tags.
- a strand displacing polymerase removes the blocking oligo during polymerase extension.
- a barcode key (inset) indicates the assignment of 15-mer barcodes to the functional barcodes in the recording tags and coding tags.
- the recording tag barcode design and coding tag encoder barcode design provide an easy gel analysis of “intra-molecular” vs.
- FIG. 36C shows a primer extension assay demonstrated information transfer from coding tags to recording tags, and addition of adapter sequences via primer extension on annealed EndCap oligo for PCR analysis.
- FIG. 36D shows optimization of “intra-molecular” information transfer via titration of surface density of recording tags via use of Dummy-T20 oligo. Biotinylated recording tag oligos were mixed with biotinylated Dummy-T20 oligo at various ratios from 1:0, 1:10, all the way down to 1:10000. At reduced recording tag density (1:10 3 and 1:10 4 ), “intra-molecular” interactions predominate over “inter-molecular” interactions. In FIG.
- Nano-Tag 15 peptide-Streptavidin binding pair is illustrated (K D ⁇ 4 nM) (Perbandt et al., 2007 , Proteins 67:1147-1153), but any number of peptide-binding agent model systems can be employed.
- Nano-Tag 15 peptide further comprises a short, flexible linker peptide (GGGGS) and a cysteine residue for coupling to the DNA recording tag.
- peptide tag—cognate binding agent pairs include: calmodulin binding peptide (CBP)-calmodulin (K D ⁇ 2 pM) (Mukherjee et al., 2015 , J. Mol. Biol. 427: 2707-2725), amyloid-beta (A ⁇ 16-27) peptide-US7/Lcn2 anticalin (0.2 nM) (Rauth et al., 2016 , Biochem. J.
- CBP calmodulin binding peptide
- K D ⁇ 2 pM K D ⁇ 2 pM
- a ⁇ 16-27 amyloid-beta
- peptide-US7/Lcn2 anticalin 0.2 nM
- PA tag/NZ-1 antibody K D ⁇ 400 pM
- FLAG-M2 Ab 28 nM
- HA-4B2 Ab 1.6 nM
- Myc-9E10 Ab 2.2 nM
- an oligonucleotide “binding agent” that binds to complementary DNA sequence “A” can be used in testing and development. This hybridization event has essentially greater than fM affinity.
- Streptavidin may be used as a test binding agent for the Nano-tag 15 peptide epitope.
- the peptide tag-binding agent interaction is high affinity, but can easily be disrupted with an acidic and/or high salt washes (Perbandt et al., supra).
- FIGS. 37A-B illustrate examples for use of nano- or micro-emulsion PCR to transfer information from UMI-labeled N or C terminus to DNA tags labeling body of polypeptide.
- a polypeptide is labeled, at its N- or C-terminus with a nucleic acid molecule comprising a unique molecular identifier (UMI).
- UMI unique molecular identifier
- the UMI may be flanked by sequences that are used to prime subsequent PCR.
- the polypeptide is then “body labeled” at internal sites with a separate DNA tag comprising sequence complementary to a priming sequence flanking the UMI.
- UMI unique molecular identifier
- the resultant labeled polypeptides are emulsified and undergo an emulsion PCR (ePCR) (alternatively, an emulsion in vitro transcription-RT-PCR (IVT-RT-PCR) reaction or other suitable amplification reaction can be performed) to amplify the N- or C-terminal UMI.
- ePCR emulsion PCR
- IVT-RT-PCR emulsion in vitro transcription-RT-PCR
- a microemulsion or nanoemulsion is formed such that the average droplet diameter is 50-1000 nm, and that on average there is fewer than one polypeptide per droplet.
- a snapshot of a droplet content pre- and post PCR is shown in the left panel and right panel, respectively.
- the UMI amplicons hybridize to the internal polypeptide body DNA tags via complementary priming sequences and the UMI information is transferred from the amplicons to the internal polypeptide body DNA tags via primer extension.
- FIG. 38 illustrates examples for single cell proteomics.
- Cells are encapsulated and lysed in droplets containing polymer-forming subunits (e.g., acrylamide).
- the polymer-forming subunits are polymerized (e.g., polyacrylamide), and proteins are cross-linked to the polymer matrix.
- the emulsion droplets are broken and polymerized gel beads that contain a single cell protein lysate attached to the permeable polymer matrix are released.
- the proteins are cross-linked to the polymer matrix in either their native conformation or in a denatured state by including a denaturant such as urea in the lysis and encapsulation buffer.
- Recording tags comprising a compartment barcode and other recording tag components (e.g., universal priming sequence (P1), spacer sequence (Sp), optional unique molecular identifier (UMI)) are attached to the proteins using a number of methods known in the art and disclosed herein, including emulsification with barcoded beads, or combinatorial indexing.
- the polymerized gel bead containing the single cell protein can also be subjected to proteinase digest after addition of the recording tag to generate recording tag labeled peptides suitable for peptide sequencing.
- the polymer matrix can be designed such that is dissolves in the appropriate additive such as disulfide cross-linked polymer that break upon exposure to a reducing agent such as tris(2-carboxyethyl)phosphine (TCEP) or dithiothreitol (DTT).
- TCEP tris(2-carboxyethyl)phosphine
- DTT dithiothreitol
- FIGS. 39A-E illustrate examples for enhancement of amino acid cleavage reaction using a bifunctional N-terminal amino acid (NTAA) modifier and a chimeric cleavage reagent.
- NTAA N-terminal amino acid
- a peptide attached to a solid-phase substrate is modified with a bifunctional NTAA modifier, such as biotin-phenyl isothiocyanate (PITC).
- PITC biotin-phenyl isothiocyanate
- C A low affinity Edmanase (> ⁇ M Kd) is recruited to biotin-PITC labeled NTAAs using a streptavidin-Edmanase chimeric protein.
- FIGS. 40A-I illustrate examples for generation of C-terminal recording tag-labeled peptides from protein lysate (may be encapsulated in a gel bead).
- a denatured polypeptide is reacted with an acid anhydride to label lysine residues.
- a mix of alkyne (mTet)-substituted citraconic anhydride+proprionic anhydride is used to label the lysines with mTet (shown as striped rectangles).
- B The result is an alkyne (mTet)-labeled polypeptide, with a fraction of lysines blocked with a proprionic group (shown as squares on the polypeptide chain).
- the alkyne (mTet) moiety is useful in click-chemistry based DNA labeling.
- C DNA tags (shown as solid rectangles) are attached by click chemistry using azide or trans-cyclooctene (TCO) labels for alkyne or mTet moieties, respectively.
- D Barcodes and functional elements such as a spacer (Sp) sequence and universal priming sequence are appended to the DNA tags using a primer extension step as shown in FIG. 31 to produce recording tag-labeled polypeptide.
- the barcodes may be a sample barcode, a partition barcode, a compartment barcode, a spatial location barcode, etc., or any combination thereof.
- the resulting recording tag-labeled polypeptide is fragmented into recording tag-labeled peptides with a protease or chemically.
- F For illustration, a peptide fragment labeled with two recording tags is shown.
- G A DNA tag comprising universal priming sequence that is complementary to the universal priming sequence in the recording tag is ligated to the C-terminal end of the peptide.
- the C-terminal DNA tag also comprises a moiety for conjugating the peptide to a surface.
- H The complementary universal priming sequences in the C-terminal DNA tag and a stochastically selected recording tag anneal. An intra-molecular primer extension reaction is used to transfer information from the recording tag to the C-terminal DNA tag.
- the internal recording tags on the peptide are coupled to lysine residues via maleic anhydride, which coupling is reversible at acidic pH.
- the internal recording tags are cleaved from the peptide's lysine residues at acidic pH, leaving the C-terminal recording tag.
- the newly exposed lysine residues can optionally be blocked with a non-hydrolyzable anhydride, such as proprionic anhydride.
- FIG. 41 illustrates an exemplary workflow for an embodiment of the NGPS assay.
- FIGS. 42A-D illustrate exemplary steps of NGPS sequencing assay.
- An N-terminal amino acid (NTAA) acetylation or amidination step on a recording tag-labeled, surface bound peptide can occur before or after binding by an NTAA binding agent, depending on whether NTAA binding agents have been engineered to bind to acetylated NTAAs or native NTAAs.
- NTAA N-terminal amino acid
- NAT N-terminal acetyltransferase
- the NTAA is recognized by an NTAA binding agent, such as an engineered anticalin, aminoacyl tRNA synthetase (aaRS), ClpS, etc.
- a DNA coding tag is attached to the binding agent and comprises a barcode encoder sequence that identifies the particular NTAA binding agent.
- the DNA coding tag After binding of the acetylated NTAA by the NTAA binding agent, the DNA coding tag transiently anneals to the recording tag via complementary sequences and the coding tag information is transferred to the recording tag via polymerase extension. In an alternative embodiment, the recording tag information is transferred to the coding tag via polymerase extension.
- the acetylated NTAA is cleaved from the peptide by an engineered acylpeptide hydrolase (APH), which catalyzes the hydrolysis of terminal acetylated amino acid from acetylated peptides. After cleavage of the acetylated NTAA, the cycle repeats itself starting with acetylation of the newly exposed NTAA.
- APH engineered acylpeptide hydrolase
- N-terminal acetylation is used as an exemplary mode of NTAA modification/cleavage, but other N-terminal moieties, such as a guanyl moiety can be substituted with a concomitant change in cleavage chemistry.
- the guanylated NTAA can be cleaved under mild conditions using 0.5-2% NaOH solution (see Hamada, 2016, incorporated by reference in its entirety).
- APH is a serine peptidase able to catalyse the removal of N ⁇ -acetylated amino acids from blocked peptides and it belongs to the prolyl oligopeptidase (POP) family (clan SC, family S9). It is a crucial regulator of N-terminally acetylated proteins in eukaryal, bacterial and archaeal cells.
- FIGS. 43A-B illustrate exemplary recording tag—coding tag design features.
- A Structure of an exemplary recording tag associated protein (or peptide) and bound binding agent (e.g., anticalin) with associated coding tag.
- a thymidine (T) base is inserted between the spacer (Sp′) and barcode (BC′) sequence on the coding tag to accommodate a stochastic non-templated 3′ terminal adenosine (A) addition in the primer extension reaction.
- DNA coding tag is attached to a binding agent (e.g., anticalin) via SpyCatcher-SpyTag protein-peptide interaction.
- FIGS. 44A-E illustrate examples for enhancement of NTAA cleavage reaction using hybridization of cleavage agent to recording tag.
- a recording tag-labeled peptide attached to a solid-phase substrate e.g., bead
- NTAA Mod
- FIG. 44A-B a recording tag-labeled peptide attached to a solid-phase substrate (e.g., bead) is modified or labeled at the NTAA (Mod), e.g., with PITC, DNP, SNP, an acetyl modifier, guanidinylation, etc.
- a cleavage enzyme e.g., acylpeptide hydrolase (APH), aminopeptidase (AP), Edmanase, etc.
- APH acylpeptide hydrolase
- AP aminopeptidase
- Edmanase Edmanase
- the cleavage enzyme is recruited to the modified NTAA via hybridization of complementary universal priming sequences on the cleavage enzyme's DNA tag and the recording tag.
- the hybridization step greatly improves the effective affinity of the cleavage enzyme for the NTAA.
- the cleaved NTAA diffuses away and associated cleavage enzyme can be removed by stripping the hybridized DNA tag.
- FIG. 45 illustrates an exemplary cyclic degradation peptide sequencing using peptide ligase+protease+diaminopeptidase.
- Butelase I ligates the TEV-Butelase I peptide substrate (TENLYFQNHV, SEQ ID NO: 132) to the NTAA of the query peptide.
- Butelase requires an NHV motif at the C-terminus of the peptide substrate.
- TEV Tobacco Etch Virus
- protease is used to cleave the chimeric peptide substrate after the glutamine (Q) residue, leaving a chimeric peptide having an asparagine (N) residue attached to the N-terminus of the query peptide.
- TEV Tobacco Etch Virus
- Diaminopeptidase or Dipeptidyl-peptidase, which cleaves two amino acid residues from the N-terminus, shortens the N-added query peptide by two amino acids effectively removing the asparagine residue (N) and the original NTAA on the query peptide.
- the newly exposed NTAA is read using binding agents as provided herein, and then the entire cycle is repeated “n” times for “n” amino acids sequenced.
- the use of a streptavidin-DAP metalloenzyme chimeric protein and tethering a biotin moiety to the N-terminal asparagine residue may allow control of DAP processivity.
- FIGS. 46A-C illustrate an exemplary “spacer-less” coding tag transfer via ligation of single strand DNA coding tag to single strand DNA recording tag.
- a single strand DNA coding tag is transferred directly by ligating the coding tag to a recording tag to generate an extended recording tag.
- the targeting agent B′ sequence conjugated to a coding tag was designed for detecting the B DNA target in the recording tag.
- the ssDNA recording tag, saRT_Bbca_ssLig is 5′ phosphorylated and 3′ biotinylated, and comprised of a 6 base DNA barcode BCa, a universal forward primer sequence, and a target DNA B sequence.
- the coding tag, CT_B′bcb_ssLig contains a universal reverse primer sequence, a uracil base, and a unique 6 bases encoder barcode BCb.
- the coding tag is covalently liked to B′DNA sequence via polyethylene glycol linker. Hybridization of the B′ sequence attached to the coding tag to the B sequence attached to the recording tag brings the 5′ phosphate group of the recording tag and 3′ hydroxyl group of the coding tag into close proximity on the solid surface, resulting in the information transfer via single strand DNA ligation with a ligase, such as CircLigase II.
- B Gel analysis to confirm single strand DNA ligation.
- Single strand DNA ligation assay demonstrated binding information transfer from coding tags to recording tags.
- the size of ligated products of 47 bases recording tags with 49 bases coding tag is 96 bases. Specificity is demonstrated given that a ligated product band was observed in the presence of the cognate saRT_Bbca_ssLig recording tag, while no product bands were observed in the presence of the non-cognate saRT_Abcb_ssLig recording tag.
- C Multiple cycles information transfer of coding tag. The first cycle ligated product was treated with USER enzyme to generate a free 5′ phosphorylated terminus for use in the second cycle of information transfer.
- FIGS. 47A-B illustrate an exemplary coding tag transfer via ligation of double strand DNA coding tag to double strand DNA recording tag. Multiple information transfer of coding tag via double strand DNA ligation was demonstrated by DNA based model system.
- A Overview of DNA based model system via double strand DNA ligation. The targeting agent A′ sequence conjugated to coding tag was prepared for detection of target binding agent A in recording tag. Both of recording tag and coding tag are composed of two strands with 4 bases overhangs.
- Double strand DNA ligation assay demonstrated A/A′ binding information transfer from coding tags to recording tags.
- the size of ligated products of 76 and 54 bases recording tags with double strand coding tag is 116 and 111 bases, respectively.
- the first cycle ligated products were digested by USER Enzyme (NEB), and used in the second cycle assay. The second cycle ligated product bands were observed at around 150 bases.
- FIGS. 48A-E illustrate an exemplary peptide-based and DNA-based model system for demonstrating information transfer from coding tags to recording tags with multiple cycles. Multiple information transfer was demonstrated by sequential peptide and DNA model systems.
- A Overview of the first cycle in the peptide based model system. The targeting agent anti-PA antibody conjugated to coding tag was prepared for detecting the PA-peptide tag in recording tag at the first cycle information transfer.
- peptide-recording tag complex negative controls were also generated, using a Nanotag peptide or an amyloid beta (A ⁇ ) peptide.
- Recording tag amRT_Abc that contains A sequence target agents, poly-dT, a universal forward primer sequence, unique DNA barcodes BC1 and BC2, and an 8 bases common spacer sequence (Sp) is covalently attached to peptide and solid support via amine group at 5′ end and internal alkyne group, respectively.
- the coding tag, amCT_bc5 that contains unique encoder barcode BC5′ flanked by 8 base common spacer sequences (Sp′) is covalently liked to antibody and C3 linker at the 5′ end and 3′ end, respectively.
- the information transfer from coding tags to recording tags is done by polymerase extension when anti-PA antibody binds to PA-tag peptide-recording tag (RT) complex.
- the targeting agent A′ sequence linked to coding tag was prepared for detecting the A sequence target agent in recording tag.
- the information transfer from coding tags to recording tags are done by polymerase extension when A′ sequence hybridizes to A sequence.
- the immobilized recording tags were amplified by 18 cycles PCR using P1_F2 and Sp/BC2 primer sets. The recording tag density dependent PCR products were observed at around 56 bp.
- D PCR analysis to confirm the first cycle extension assay.
- the first cycle extended recording tags were amplified by 21 cycles PCR using P1_F2 and Sp/BC5 primer sets.
- the strong bands of PCR products from the first cycle extended products were observed at around 80 bp for the PA-peptide RT complex across the different density titration of the complexes.
- a small background band is observed at the highest complex density for Nano and A ⁇ peptide complexes as well, ostensibly due to non-specific binding.
- E PCR analysis to confirm the second cycle extension assay.
- the second extended recording tags were amplified by 21 cycles PCR using P1_F2 and P2_R1 primer sets.
- FIGS. 49A-B use p53 protein sequencing as an example to illustrate the importance of proteoform and the robust mappability of the sequencing reads, e.g., those obtained using a single molecule approach.
- FIG. 49A at the left panel shows the intact proteoform may be digested to fragments, each of which may comprise one or more methylated amino acids, one or more phosphorylated amino acids, or no post-translational modification. The post-translational modification information may be analyzed together with sequencing reads.
- the right panel shows various post-translational modifications along the protein.
- the sequencing reads do not have to be long—for example, about 10-15 amino acid sequences may give sufficient information to identify the protein within the proteome.
- the sequencing reads may overlap and the redundancy of sequence information at the overlapping sequences may be used to deduce and/or validate the entire polypeptide sequence.
- FIGS. 50A-C illustrate labeling a protein or peptide with a DNA recording Tag using mRNA Display.
- FIGS. 51A-E illustrate a single cycle protein identification via N-terminal dipeptide binding to partition barcode-labeled peptides.
- FIGS. 52A-E illustrate a single cycle protein identification via N-terminal dipeptide binders to peptides immobilized partition barcoded beads.
- FIGS. 53A-B illustrate ClpS homologues/variants across different species of bacteria, and exemplary ClpS proteins for use in the present disclosure, e.g., ClpS2 from Accession No.
- A. tumefaciens (SEQ ID NO: 198) MSDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLKAVFRMS EDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTE PEE; C1pS from Accession No. 2W9R, E. coli : (SEQ ID NO: 199) MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKF FSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLL CTLEKAGA; and C1pS from Accession No.
- FIG. 53A shows dendogram of hierarchical clustering of ClpS amino acid sequences from 612 different bacterial species clustered to 99% identity.
- FIG. 53B is a table of amino acid sequence identity between ClpSs from the three species in FIG. 53A .
- A. tumfaciens ClpS2 has less than 35% sequence identity to E. coli ClpS, and less than 40% sequence identity to C. crescentus ClpS.
- FIG. 54 illustrates an exemplary ligand binding assay with ligands and associated coding tags on OBOC Beads, as described in Example 31.
- a library of DNA encoded OBOC beads is constructed wherein each bead has as single population of small molecule ligands and associated DNA Encoded Library Barcodes (DEL BC) (MacConnell, A. B., et al. (2015) ACS Comb Sci 17(9): 518-534).
- FIG. 54B illustrates a single cycle of binding and writing of binding information between the bound protein recording tag and coding tag on the OBOC bead.
- All coding tags on the bead are comprised of the same DEL BC sequence, identifying the small molecule type also present on the bead (many identical small molecules per bead). Proteins with associated recording tags are introduced and bound the ligands on the beads. Information is transferred between the coding tag and recording tag either concomitantly with binding or subsequent to binding. This information transfer can be performed chemically or enzymatically by polymerase extension, ssDNA ligation, or dsDNA ligation.
- the coding tag can be attached directly to the bead or two the ligand via a bifunctional linker.
- FIG. 54C shows the information transfer from the recording tag to the coding tag by polymerase extension.
- FIG. 54D shows the information transfer from the coding tag to the recording tag.
- FIGS. 55A-C illustrate a process of multiple cycles of binding of a macromolecule to a binding agent and transferring information of an individual coding tag among a plurality of coding tags co-localized at a site of a single binding agent attached to a solid support (e.g., a bead) to a recording tag that is attached to the macromolecule, thereby producing an extended recording tag comprising a coding tag representing the temporal binding history for a given macromolecule.
- a solid support e.g., a bead
- the macromolecule is a peptide and each round involves binding an N-terminal amino acid (NTAA) of a peptide to a binding agent, recording the binding event by transferring coding tag information to a recording tag, recording the binding event order by transferring cycle specific tag information to a recording tag, followed by removal of the NTAA to expose a new NTAA.
- NTAA N-terminal amino acid
- FIGS. 56A-C illustrate a process of multiple cycles of binding of a macromolecule to a binding agent and transferring information of a recording tag that is attached to a macromolecule to an individual coding tag among a plurality of coding tags co-localized at a site of a single binding agent attached to a solid support (e.g., a bead), thereby generating multiple extended coding tags that collectively represent the binding agent.
- a solid support e.g., a bead
- the binding agent is an N-terminal amino acid (NTAA) binding agent and each round involves binding an NTAA of peptide to a binding agent, recording the binding event by transferring recording tag information to a coding tag, recording the binding event order by transferring cycle specific tag information to a cording tag, followed by removal of the NTAA to expose a new NTAA.
- NTAA N-terminal amino acid
- FIGS. 57A-B Three cycle binding/encoding and NGS readout.
- A Three sequential encoding steps are illustrated. A peptide is shown conjugated to a recording tag (DNA RT) and immobilized on a magnetic bead. The peptide contains a PA epitope.
- An anti-PA antibody labeled with three different cycle-specific barcodes BC4, BC5, BC13 was used to carry out three sequential cycles of the assay, with each barcode used for a different cycle (1st, 2nd and 3rd cycle respectively). Each cycle results in the recording tag being extended with the respective cycle barcode.
- B Agarose gel showing analysis of PCR products of the extended recording tag after each cycle.
- Lane 1 size standards
- Lane 2 to 4 correspond to 1st, 2nd and 3rd cycle products respectively.
- the gel clearly shows high yield encoding.
- PCR employed KOD polymerase with 24 cycles of amplification.
- C In addition to gel analysis, the final “three cycle” product (3rd lane in gel) was analyzed by NGS sequencing. The primary product (over 78% of products), corresponding to largest band on the gel, consisted of library elements with all three barcodes. Single and double barcode products were also observed at a lower proportion (2 BCs at 20.7% and 1 BC at 1.1%).
- FIGS. 58A-B Use of Blocking Oligonucleotides in Primer Extension Encoding Assay.
- Several types of blocking oligonucleotide were tested in a primer extension-based encoding assay.
- A Illustrates the design of a DNA “binder” model system and three types of blocking oligonucleotide used to block components of an encoding assay: RT Blocker, CT Blocker, and Sp′ Blocker. Coding tag barcodes for each cycle were designed to be cycle-specific and orthogonal (non-interacting) between cycles.
- B Gel analysis of encoding results after three cycles of encoding and PCR amplification. In the example shown, a CT Blocker cognate (lane marked with *) to the incoming coding tag on each cycle provided the highest encoding efficiency as indicated by the upper band denoted by the arrow.
- FIGS. 59A-B Minimizing template switching during ProteoCode library amplification.
- Thermophilic polymerases were screened for propensity for template switching during PCR.
- Two synthetic mock templates of differing lengths (TS_Ctrl1 and TS_Ctrl4) containing shared barcodes (BC3, BC4, BC5 and BC13) and spacer (Sp) sequences are shown.
- TS_Ctrl1 and TS_Ctrl4 Two synthetic mock templates of differing lengths (TS_Ctrl1 and TS_Ctrl4) containing shared barcodes (BC3, BC4, BC5 and BC13) and spacer (Sp) sequences are shown. Following co-amplification by PCR, the presence of bands by PAGE in addition to the two original template bands is indicative of template switching.
- FIG. 60 Single Cycle ProteoCode Assay.
- Two different bead types one with an amino A-terminal peptide (AFA-peptide), and the other with an amino F-terminal peptide (FA-peptide) were used in the assay.
- AFA-peptide and FA-peptide beads were used in a full cycle ProteoCode assay consisting of one cycle of NTF/NTE chemistry and two cycles of encoding comprised of pre- and post-chemistry encoding steps employing an engineered phenylalanine (F) binder.
- a different barcode for the F-binder was used in the pre-chemistry encoding assay vs. post-chemistry encoding assay.
- FIGS. 61A-B Inter-molecular cross-talk as a function of peptide chimera surface density. F-binder assay crosstalk measurement on 4-plex peptide-recording tag chimeras (AA-peptide, AF-peptide, FA-peptide, and no peptide) immobilized on the same bead at different surface chimera densities.
- A Uniformity of chimera immobilization across four chimera type assessed by PA antibody binding/encoding. Each chimera (as measured by sequencing or recording tags) represented roughly 20-30% of total chimera.
- the intra-molecular encoding efficiency of the FA-peptide is much greater than the inter-molecular encoding of the off-target peptide chimeras (AF, AA, and no peptide).
- FIG. 62A-B DNA encoding with base protected DNA using ssDNA ligase.
- A Design of base protected recording tag (RT) and coding tag (CT) for ssDNA ligation assay.
- the base protection groups employed were the standard phosphoramidite protection groups used in oligonucleotide synthesis: Bz-dA, ibu-dG, Ac-dC. These protecting groups were left in place after synthesis.
- CircLigase II was used to ligate the 5′ phosphorylated terminus of the RT oligo with the 3′ OH of the CT oligo.
- B PAGE gel analysis of ssDNA ligase ligation reaction components and products.
- Lane 1 RT Full length oligo
- Lane 2 after USER enzyme treatment to generate a phosphorylated RT sequence from an RT full length comprised of a 5′ U
- Lane 3 after annealing of CT oligo to RT oligo immobilized on beads
- Lane 4 after ligation of the 3′ terminus of CT to the 5′ terminus of RT via the B-B′ interaction, using CircLigase II.
- the ligation of “base protected” DNA is relatively efficient as indicated by formation of a higher molecular weight ligation product as seen in Lane 5 using CircLigase II.
- FIGS. 63A-E Immobilization of DNA tagged peptides using hybridization and ligation to DNA beads.
- A Design of DNA hairpin beads in which the 5′ overhang on the DNA hairpin is used to capture the DNA-peptide chimeras.
- B DNA-peptide chimera hybridized to the hairpins on the bead.
- C DNA ligase is used to covalently join the 5′ end of the phosphorylated DNA tags on the peptides to the hairpin.
- the DNA tag on the peptide is designed such that the peptide is chemically conjugated to an internal nucleotide.
- the DNA tag on the peptide constitutes a recording tag with a free 3′ end to which information from the coding tag can be transferred.
- Molecular recognition and characterization of a protein or polypeptide analyte is typically performed using an immunoassay.
- immunoassay formats including ELISA, multiplex ELISA (e.g., spotted antibody arrays, liquid particle ELISA arrays), digital ELISA (e.g., Quanterix, Singulex), reverse phase protein arrays (RPPA), and many others.
- ELISA ELISA
- multiplex ELISA e.g., spotted antibody arrays, liquid particle ELISA arrays
- digital ELISA e.g., Quanterix, Singulex
- RPPA reverse phase protein arrays
- Binding agent agnostic approaches such as direct protein characterization via peptide sequencing (Edman degradation or Mass Spectroscopy) provide useful alternative approaches. However, neither of these approaches is very parallel or high-throughput.
- Peptide sequencing based on Edman degradation was first proposed by Pehr Edman in 1950; namely, stepwise degradation of the N-terminal amino acid on a peptide through a series of chemical modifications and downstream HPLC analysis (later replaced by mass spectrometry analysis).
- the N-terminal amino acid is modified with phenyl isothiocyanate (PITC) under mildly basic conditions (NMP/methanol/H 2 O) to form a phenylthiocarbamoyl (PTC) derivative.
- PITC phenyl isothiocyanate
- the PTC-modified amino group is treated with acid (anhydrous trifluoroacetic acid, TFA) to create a cleaved cyclic ATZ (2-anilino-5(4)-thiozolinone) modified amino acid, leaving a new N-terminus on the peptide.
- the cleaved cyclic ATZ-amino acid is converted to a phenylthiohydantoin (PTH)-amino acid derivative and analyzed by reverse phase HPLC. This process is continued in an iterative fashion until all or a partial number of the amino acids comprising a peptide sequence has been removed from the N-terminal end and identified.
- PTH phenylthiohydantoin
- MS electrospray mass spectroscopy
- LC-MS/MS LC-MS/MS
- Dynamic range is an additional complication in which concentrations of proteins within a sample can vary over a very large range (over 10 orders for plasma). MS typically only analyzes the more abundant species, making characterization of low abundance proteins challenging. Finally, sample throughput is typically limited to a few thousand peptides per run, and for data independent analysis (DIA), this throughput is inadequate for true bottoms-up high-throughput proteome analysis. Furthermore, there is a significant compute requirement to de-convolute thousands of complex MS spectra recorded for each sample.
- the present disclosure provides, in part, methods of highly-parallel, high throughput digital macromolecule characterization and quantitation, with direct applications to protein and peptide characterization and sequencing (see, e.g., FIG. 1B , FIG. 2A ).
- the methods described herein use binding agents comprising a coding tag with identifying information in the form of a nucleic acid molecule or sequenceable polymer, wherein the binding agents interact with a macromolecule of interest. Multiple, successive binding cycles, each cycle comprising exposing a plurality macromolecules, for example representing pooled samples, immobilized on a solid support to a plurality of binding agents, are performed.
- each binding cycle the identity of each binding agent that binds to the macromolecule, and optionally binding cycle number, is recorded by transferring information from the binding agent coding tag to a recording tag co-localized with the macromolecule.
- information from the recording tag comprising identifying information for the associated macromolecule may be transferred to the coding tag of the bound binding agent (e.g., to form an extended coding tag) or to a third “di-tag” construct.
- Multiple cycles of binding events build historical binding information on the recording tag co-localized with the macromolecule, thereby producing an extended recording tag comprising multiple coding tags in co-linear order representing the temporal binding history for a given macromolecule.
- cycle-specific coding tags can be employed to track information from each cycle, such that if a cycle is skipped for some reason, the extended recording tag can continue to collect information in subsequent cycles, and identify the cycle with missing information.
- information can be transferred from a recording tag comprising identifying information for the associated macromolecule to the coding tag forming an extended coding tag or to a third di-tag construct.
- the resulting extended coding tags or di-tags can be collected after each binding cycle for subsequent sequence analysis.
- the identifying information on the recording tags comprising barcodes (e.g., partition tags, compartment tags, sample tags, fraction tags, UMIs, or any combination thereof) can be used to map the extended coding tag or di-tag sequence reads back to the originating macromolecule. In this manner, a nucleic acid encoded library representation of the binding history of the macromolecule is generated.
- nucleic acid encoded library can be amplified, and analyzed using very high-throughput next generation digital sequencing methods, enabling millions to billions of molecules to be analyzed per run.
- the creation of a nucleic acid encoded library of binding information is useful in another way in that it enables enrichment, subtraction, and normalization by DNA-based techniques that make use of hybridization. These DNA-based methods are easily and rapidly scalable and customizable, and more cost-effective than those available for direct manipulation of other types of macromolecule libraries, such as protein libraries.
- nucleic acid encoded libraries of binding information can be processed prior to sequencing by one or more techniques to enrich and/or subtract and/or normalize the representation of sequences.
- nucleic-acid based techniques for manipulating library representation are orthogonal to more conventional methods, and can be used in combination with them.
- common, highly abundant proteins such as albumin
- albumin can be subtracted using protein-based methods, which may remove the majority but not all the undesired protein.
- albumin-specific members of an extended recording tag library can also be subtracted, thus achieving a more complete overall subtraction.
- the present disclosure provides a highly-parallelized approach for peptide sequencing using an Edman-like degradation approach, allowing the sequencing from a large collection of DNA recording tag-labeled peptides (e.g., millions to billions).
- These recording tag labeled peptides are derived from a proteolytic digest or limited hydrolysis of a protein sample, and the recording tag labeled peptides are immobilized randomly on a sequencing substrate (e.g., porous beads) at an appropriate inter-molecular spacing on the substrate.
- N-terminal amino acid (NTAA) residues of the peptides with small chemical moieties, such as phenylthiocarbamoyl (PTC), dinitrophenol (DNP), sulfonyl nitrophenol (SNP), dansyl, 7-methoxy coumarin, acetyl, or guanidinyl, that catalyze or recruit an NTAA cleavage reaction allows for cyclic control of the Edman-like degradation process.
- PTC phenylthiocarbamoyl
- DNP dinitrophenol
- SNP sulfonyl nitrophenol
- dansyl 7-methoxy coumarin
- acetyl or guanidinyl
- the modifying chemical moieties may also provide enhanced binding affinity to cognate NTAA binding agents.
- the modified NTAA of each immobilized peptide is identified by the binding of a cognate NTAA binding agent comprising a coding tag, and transferring coding tag information (e.g., encoder sequence providing identifying information for the binding agent) from the coding tag to the recording tag of the peptide (e.g., primer extension or ligation).
- coding tag information e.g., encoder sequence providing identifying information for the binding agent
- the modified NTAA is removed by chemical methods or enzymatic means.
- enzymes e.g., Edmanase
- naturally occurring exopeptidases such as aminopeptidases or acyl peptide hydrolases, can be engineered to cleave a terminal amino acid only in the presence of a suitable chemical modification.
- macromolecule encompasses large molecules composed of smaller subunits.
- macromolecules include, but are not limited to peptides, polypeptides, proteins, nucleic acids, carbohydrates, lipids, macrocycles.
- a macromolecule also includes a chimeric macromolecule composed of a combination of two or more types of macromolecules, covalently linked together (e.g., a peptide linked to a nucleic acid).
- a macromolecule may also include a “macromolecule assembly”, which is composed of non-covalent complexes of two or more macromolecules.
- a macromolecule assembly may be composed of the same type of macromolecule (e.g., protein-protein) or of two more different types of macromolecules (e.g., protein-DNA).
- polypeptide encompasses peptides and proteins, and refers to a molecule comprising a chain of two or more amino acids joined by peptide bonds.
- a polypeptide or a peptide comprises 2 to 50 amino acids, e.g., having more than 20-30 amino acids.
- a peptide does not comprise a secondary, territory, or higher structure.
- a protein comprises 30 or more amino acids, e.g. having more than 50 amino acids.
- a protein in addition to a primary structure, a protein comprises a secondary, territory, or higher structure.
- the amino acids of the polypeptide are most typically L-amino acids, but may also be D-amino acids, unnatural amino acids, modified amino acids, amino acid analogs, amino acid mimetics, or any combination thereof.
- Polypeptides may be naturally occurring, synthetically produced, or recombinantly expressed. Polypeptide may also comprise additional groups modifying the amino acid chain, for example, functional groups added via post-translational modification.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the term also encompasses an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- amino acid refers to an organic compound comprising an amine group, a carboxylic acid group, and a side-chain specific to each amino acid, which serve as a monomeric subunit of a peptide.
- An amino acid includes the 20 standard, naturally occurring or canonical amino acids as well as non-standard amino acids.
- the standard, naturally-occurring amino acids include Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr).
- amino acid may be an L-amino acid or a D-amino acid.
- Non-standard amino acids may be modified amino acids, amino acid analogs, amino acid mimetics, non-standard proteinogenic amino acids, or non-proteinogenic amino acids that occur naturally or are chemically synthesized.
- non-standard amino acids include, but are not limited to, selenocysteine, pyrrolysine, and N-formylmethionine, ⁇ -amino acids, Homo-amino acids, Proline and Pyruvic acid derivatives, 3-substituted alanine derivatives, glycine derivatives, ring-substituted phenylalanine and tyrosine derivatives, linear core amino acids, N-methyl amino acids.
- post-translational modification refers to modifications that occur on a peptide after its translation by ribosomes is complete.
- a post-translational modification may be a covalent modification or enzymatic modification.
- post-translation modifications include, but are not limited to, acylation, acetylation, alkylation (including methylation), biotinylation, butyrylation, carbamylation, carbonylation, deamidation, deiminiation, diphthamide formation, disulfide bridge formation, eliminylation, flavin attachment, formylation, gamma-carboxylation, glutamylation, glycylation, glycosylation, glypiation, heme C attachment, hydroxylation, hypusine formation, iodination, isoprenylation, lipidation, lipoylation, malonylation, methylation, myristolylation, oxidation, palmitoylation, pegylation, phosphopantethein
- a post-translational modification includes modifications of the amino terminus and/or the carboxyl terminus of a peptide.
- Modifications of the terminal amino group include, but are not limited to, des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
- Modifications of the terminal carboxy group include, but are not limited to, amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications (e.g., wherein lower alkyl is C 1 -C 4 alkyl).
- a post-translational modification also includes modifications, such as but not limited to those described above, of amino acids falling between the amino and carboxy termini.
- the term post-translational modification can also include peptide modifications that include one or more detectable labels.
- binding agent refers to a nucleic acid molecule, a peptide or peptide mimetic, a polypeptide, a protein, a carbohydrate, a peptidomimetic (e.g., a peptoid, a ⁇ -peptide, or a D-peptide peptidomimetic), a polysaccharide, or a small molecule that binds to, associates, unites with, recognizes, or combines with an analyte, e.g., a macromolecule or a component or feature of a macromolecule.
- a peptidomimetic e.g., a peptoid, a ⁇ -peptide, or a D-peptide peptidomimetic
- a binding agent may form a covalent association or non-covalent association with the analyte, e.g., a macromolecule or component or feature of a macromolecule.
- a binding agent may also be a chimeric binding agent, composed of two or more types of molecules, such as a nucleic acid molecule-peptide chimeric binding agent or a carbohydrate-peptide chimeric binding agent.
- a binding agent may be a naturally occurring, synthetically produced, or recombinantly expressed molecule.
- a binding agent may bind to a single monomer or subunit of a macromolecule (e.g., a single amino acid of a peptide) or bind to a plurality of linked subunits of a macromolecule (e.g., a di-peptide, tri-peptide, or higher order peptide of a longer peptide, polypeptide, or protein molecule).
- a binding agent may bind to a linear molecule or a molecule having a three-dimensional structure (also referred to as conformation).
- an antibody binding agent may bind to linear peptide, polypeptide, or protein, or bind to a conformational peptide, polypeptide, or protein.
- a binding agent may bind to an N-terminal peptide, a C-terminal peptide, or an intervening peptide of a peptide, polypeptide, or protein molecule.
- a binding agent may bind to an N-terminal amino acid, C-terminal amino acid, or an intervening amino acid of a peptide molecule.
- a binding agent may for example bind to a chemically modified or labeled amino acid over a non-modified or unlabeled amino acid.
- a binding agent may for example bind to an amino acid that has been modified with an acetyl moiety, guanyl moiety, dansyl moiety, PTC moiety, DNP moiety, SNP moiety, etc., over an amino acid that does not possess said moiety.
- a binding agent may bind to a post-translational modification of a polypeptide molecule.
- a binding agent may exhibit selective binding to a component or feature of an analyte, such as a macromolecule (e.g., a binding agent may selectively bind to one of the 20 possible natural amino acid residues and bind with very low affinity or not at all to the other 19 natural amino acid residues).
- a binding agent may exhibit less selective binding, where the binding agent is capable of binding a plurality of components or features of an analyte, such as a macromolecule (e.g., a binding agent may bind with similar affinity to two or more different amino acid residues).
- a binding agent comprises a coding tag, which may be joined to the binding agent by a linker.
- small molecule refers to an organic compound, including an organometallic compound, of a molecular weight less than about 2 kDa, that is not a polynucleotide, a polypeptide, a polysaccharide, or a synthetic polymer composed of a plurality of repeating units.
- the term “peptidomimetic” includes a small protein-like chain designed to mimic a peptide.
- a peptidomimetic can arise either from modification of an existing peptide (such as cyclic peptides), or by designing similar systems that mimic peptides, such as peptoids and ⁇ -peptides.
- the altered chemical structure is designed to advantageously adjust the molecular properties such as, stability or biological activity. This can have a role in the development of drug-like compounds from existing peptides. In some embodiments, these modifications involve changes to the peptide that will not occur naturally (such as altered backbones and the incorporation of nonnatural amino acids). Based on their similarity with the precursor peptide, peptidomimetics can be grouped into four classes (A-D) where A features the most and D the least similarities. Classes A and B involve peptide-like scaffolds, while classes C and D include small molecules.
- the term “peptoid” includes poly-N-substituted glycines, which are a class of peptidomimetics whose side chains are appended to the nitrogen atom of the peptide backbone, rather than to the ⁇ -carbons (as they are in amino acids).
- the term “ ⁇ -peptide” includes ⁇ amino acids, such as ⁇ -alanine (a naturally occurring ⁇ amino acid, which have their amino group bonded to the ⁇ carbon rather than the ⁇ carbon. The only common is; although it is used as a component of larger bioactive molecules, ⁇ -peptides in general do not appear in nature.
- the term “agent” and “reagent” are used interchangeably.
- a binding agent is referred to as an agent
- its coding tag can have a reactive portion, e.g., a spacer sequence or a reactive end, to react with a spacer sequence or reactive end on the recording tag in order to transfer information.
- the reactions may include ligation and/or annealing followed by primer extension.
- linker refers to one or more of a nucleotide, a nucleotide analog, an amino acid, a peptide, a polypeptide, or a non-nucleotide chemical moiety that is used to join two molecules.
- a linker may be used to join a binding agent with a coding tag, a recording tag with a macromolecule (e.g., peptide), a macromolecule with a solid support, a recording tag with a solid support, etc.
- a linker joins two molecules via enzymatic reaction or chemistry reaction (e.g., click chemistry).
- proteomics refers to analysis (e.g., quantitative analysis) of a proteome, e.g., the proteome within cell(s), tissue(s), and bodily fluid(s), and the corresponding spatial distribution of the proteome within the cell and within tissues. Additionally, proteomics studies include the dynamic state of a proteome, continually changing in time as a function of biology and defined biological or chemical stimuli.
- proteome can include the entire set of proteins, polypeptides, or peptides (including conjugates or complexes thereof) expressed by a target, e.g., a genome, cell, tissue, or organism at a certain time, of any organism. In one aspect, it is the set of expressed proteins in a given type of cell or organism, at a given time, under defined conditions. Proteomics is the study of a proteome. For example, a “cellular proteome” may include the collection of proteins found in a particular cell type under a particular set of environmental conditions, such as exposure to hormone stimulation. An organism's complete proteome may include the complete set of proteins from all of the various cellular proteomes.
- a proteome may also include the collection of proteins in certain sub-cellular biological systems. For example, all of the proteins in a virus can be called a viral proteome.
- the term “proteome” include subsets of a proteome, including but not limited to a kinome; a secretome; a receptome (e.g., GPCRome); an immunoproteome; a nutriproteome; a proteome subset defined by a post-translational modification (e.g., phosphorylation, ubiquitination, methylation, acetylation, glycosylation, oxidation, lipidation, and/or nitrosylation), such as a phosphoproteome (e.g., phosphotyrosine-proteome, tyrosine-kinome, and tyrosine-phosphatome), a glycoproteome, etc.; a proteome subset associated with a tissue or organ, a developmental stage, or a physiological or pathological condition; a
- non-cognate binding agent refers to a binding agent that is not capable of binding or binds with low affinity to a macromolecule feature, component, or subunit being interrogated in a particular binding cycle reaction as compared to a “cognate binding agent”, which binds with high affinity to the corresponding macromolecule feature, component, or subunit.
- non-cognate binding agents are those that bind with low affinity or not at all to the tyrosine residue, such that the non-cognate binding agent does not efficiently transfer coding tag information to the recording tag under conditions that are suitable for transferring coding tag information from cognate binding agents to the recording tag.
- non-cognate binding agents are those that bind with low affinity or not at all to the tyrosine residue, such that recording tag information does not efficiently transfer to the coding tag under suitable conditions for those embodiments involving extended coding tags rather than extended recording tags.
- the term “specific binding” refers to the specificity of a binder, e.g., an antibody, a ClpS protein, or an anticalin, such that it preferentially binds to a target, such as a polypeptide antigen.
- a binding partner e.g., protein, nucleic acid, antibody or other affinity capture agent, etc.
- “specific binding” can include a binding reaction of two or more binding partners with high affinity and/or complementarity to ensure selective hybridization under designated assay conditions. Typically, specific binding will be at least three times the standard deviation of the background signal. Thus, under designated conditions the binding partner binds to its particular target molecule and does not bind in a significant amount to other molecules present in the sample.
- binders, antibodies or antibody fragments that are specific for or bind specifically to a target bind to the target with higher affinity than binding to other non-target substances.
- binders, antibodies or antibody fragments that are specific for or bind specifically to a target avoid binding to a significant percentage of non-target substances, e.g., non-target substances present in a testing sample.
- binders, antibodies or antibody fragments of the present disclosure avoid binding greater than about 90% of non-target substances, although higher percentages are clearly contemplated and preferred.
- binders, antibodies or antibody fragments of the present disclosure avoid binding about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, and about 99% or more of non-target substances. In other embodiments, binders, antibodies or antibody fragments of the present disclosure avoid binding greater than about 10%, 20%, 30%, 40%, 50%, 60%, or 70%, or greater than about 75%, or greater than about 80%, or greater than about 85% of non-target substances.
- a polynucleotide, protein or polypeptide variant, mutant, homologue, or modified version include proteins or polypeptides that share nucleic acid or amino acid sequence identity with a reference polynucleotide, protein or polypeptide, for example, about 10% sequence identity, about 15% sequence identity, about 20% sequence identity, about 25% sequence identity, about 30% sequence identity, about 35% sequence identity, about 40% sequence identity, about 45% sequence identity, about 50% sequence identity, about 55% sequence identity, about 60% sequence identity, about 65% sequence identity, about 70% sequence identity, about 75% sequence identity, about 80% sequence identity, about 85% sequence identity, about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, or about 100% sequence identity.
- Percent (%) nucleic acid sequence identity with respect to a reference polynucleotide sequence is defined as the percentage of nucleic acid residues in a candidate sequence that are identical with the nucleic acid residues in the reference polynucleotide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Alignment for purposes of determining percent amino acid sequence identity and/or percent nucleic acid sequence can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- a ClpS protein or polypeptide disclosed herein include a variant, mutant, homologue, or modified version that shares sequence identity with a reference ClpS protein or polypeptide, such as A. tumefaciens ClpS2 (e.g., SEQ ID NO: 198), E. coli ClpS (e.g., SEQ ID NO: 199), and/or C.
- A. tumefaciens ClpS2 e.g., SEQ ID NO: 198
- E. coli ClpS e.g., SEQ ID NO: 199
- C C.
- crescentus ClpS (e.g., SEQ ID NO: 200), with about 10% sequence identity, about 15% sequence identity, about 20% sequence identity, about 25% sequence identity, about 30% sequence identity, about 35% sequence identity, about 40% sequence identity, about 45% sequence identity, about 50% sequence identity, about 55% sequence identity, about 60% sequence identity, about 65% sequence identity, about 70% sequence identity, about 75% sequence identity, about 80% sequence identity, about 85% sequence identity, about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, or about 100% sequence identity.
- N-terminal amino acid The terminal amino acid at one end of the peptide chain that has a free amino group is referred to herein as the “N-terminal amino acid” (NTAA).
- C-terminal amino acid The terminal amino acid at the other end of the chain that has a free carboxyl group is referred to herein as the “C-terminal amino acid” (CTAA).
- the amino acids making up a peptide may be numbered in order, with the peptide being “n” amino acids in length.
- NTAA is considered the n th amino acid (also referred to herein as the “n th NTAA”).
- next amino acid is the (n ⁇ 1) th amino acid, then the (n ⁇ 2) th amino acid, and so on down the length of the peptide from the N-terminal end to C-terminal end.
- an NTAA, CTAA, or both may be modified or labeled with a chemical moiety.
- barcode refers to a nucleic acid molecule of about 2 to about 30 bases (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 bases) providing a unique identifier tag or origin information for a macromolecule (e.g., protein, polypeptide, peptide), a binding agent, a set of binding agents from a binding cycle, a sample macromolecules, a set of samples, macromolecules within a compartment (e.g., droplet, bead, or separated location), macromolecules within a set of compartments, a fraction of macromolecules, a set of macromolecule fractions, a spatial region or set of spatial regions, a library of macromolecules, or a library of binding agents.
- a macromolecule e.g., protein, polypeptide, peptide
- binding agent e.g., a binding agent from a binding cycle
- sample macromolecules e.g., a set of
- a barcode can be an artificial sequence or a naturally occurring sequence.
- each barcode within a population of barcodes is different.
- a portion of barcodes in a population of barcodes is different, e.g., at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99% of the barcodes in a population of barcodes is different.
- a population of barcodes may be randomly generated or non-randomly generated.
- a population of barcodes are error correcting barcodes.
- Barcodes can be used to computationally deconvolute the multiplexed sequencing data and identify sequence reads derived from an individual macromolecule, sample, library, etc.
- a barcode can also be used for deconvolution of a collection of macromolecules that have been distributed into small compartments for enhanced mapping. For example, rather than mapping a peptide back to the proteome, the peptide is mapped back to its originating protein molecule or protein complex.
- sample barcode also referred to as “sample tag” identifies from which sample a macromolecule derives.
- a “spatial barcode” which region of a 2-D or 3-D tissue section from which a macromolecule derives. Spatial barcodes may be used for molecular pathology on tissue sections. A spatial barcode allows for multiplex sequencing of a plurality of samples or libraries from tissue section(s).
- coding tag refers to a polynucleotide with any suitable length, e.g., a nucleic acid molecule of about 2 bases to about 100 bases, including any integer including 2 and 100 and in between, that comprises identifying information for its associated binding agent.
- a “coding tag” may also be made from a “sequencable polymer” (see, e.g., Niu et al., 2013 , Nat. Chem. 5:282-292; Roy et al., 2015 , Nat. Commun. 6:7237; Lutz, 2015 , Macromolecules 48:4759-4767; each of which are incorporated by reference in its entirety).
- a coding tag may comprise an encoder sequence (e.g., a barcode identifier), which is optionally flanked by one spacer on one side or flanked by a spacer on each side.
- a coding tag may also be comprised of an optional UMI and/or an optional binding cycle-specific barcode.
- a coding tag may be single stranded or double stranded.
- a double stranded coding tag may comprise blunt ends, overhanging ends, or both.
- a coding tag may refer to the coding tag that is directly attached to a binding agent, to a complementary sequence hybridized to the coding tag directly attached to a binding agent (e.g., for double stranded coding tags), or to coding tag information present in an extended recording tag.
- a coding tag may further comprise a binding cycle specific spacer or barcode, a unique molecular identifier, a universal priming site, or any combination thereof.
- encoder sequence refers to a nucleic acid molecule of about 2 bases to about 30 bases (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 bases) in length that provides identifying information for its associated binding agent.
- the encoder sequence may uniquely identify its associated binding agent.
- an encoder sequence is provides identifying information for its associated binding agent and for the binding cycle in which the binding agent is used.
- an encoder sequence is combined with a separate binding cycle-specific barcode within a coding tag.
- the encoder sequence may identify its associated binding agent as belonging to a member of a set of two or more different binding agents. In some embodiments, this level of identification is sufficient for the purposes of analysis. For example, in some embodiments involving a binding agent that binds to an amino acid, it may be sufficient to know that a peptide comprises one of two possible amino acids at a particular position, rather than definitively identify the amino acid residue at that position.
- a common encoder sequence is used for polyclonal antibodies, which comprises a mixture of antibodies that recognize more than one epitope of a protein target, and have varying specificities.
- an encoder sequence identifies a set of possible binding agents
- a sequential decoding approach can be used to produce unique identification of each binding agent. This is accomplished by varying encoder sequences for a given binding agent in repeated cycles of binding (see, Gunderson et al., 2004 , Genome Res. 14:870-7).
- the partially identifying coding tag information from each binding cycle when combined with coding information from other cycles, produces a unique identifier for the binding agent, e.g., the particular combination of coding tags rather than an individual coding tag (or encoder sequence) provides the uniquely identifying information for the binding agent.
- the encoder sequences within a library of binding agents possess the same or a similar number of bases.
- binding cycle specific tag refers to a unique sequence used to identify a library of binding agents used within a particular binding cycle.
- a binding cycle specific tag may comprise about 2 bases to about 8 bases (e.g., 2, 3, 4, 5, 6, 7, or 8 bases) in length.
- a binding cycle specific tag may be incorporated within a binding agent's coding tag as part of a spacer sequence, part of an encoder sequence, part of a UMI, or as a separate component within the coding tag.
- spacer refers to a nucleic acid molecule of about 0 base to about 20 bases (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 bases) in length that is present on a terminus of a recording tag or coding tag.
- a spacer sequence flanks an encoder sequence of a coding tag on one end or both ends.
- Sp′ refers to spacer sequence complementary to Sp.
- spacer sequences within a library of binding agents possess the same number of bases.
- a common (shared or identical) spacer may be used in a library of binding agents.
- a spacer sequence may have a “cycle specific” sequence in order to track binding agents used in a particular binding cycle.
- the spacer sequence (Sp) can be constant across all binding cycles, be specific for a particular class of macromolecules, or be binding cycle number specific.
- Macromolecule class-specific spacers permit annealing of a cognate binding agent's coding tag information present in an extended recording tag from a completed binding/extension cycle to the coding tag of another binding agent recognizing the same class of macromolecules in a subsequent binding cycle via the class-specific spacers.
- a spacer sequence may comprise sufficient number of bases to anneal to a complementary spacer sequence in a recording tag to initiate a primer extension (also referred to as polymerase extension) reaction, or provide a “splint” for a ligation reaction, or mediate a “sticky end” ligation reaction.
- a spacer sequence may comprise a fewer number of bases than the encoder sequence within a coding tag.
- the term “recording tag” refers to a moiety, e.g., a chemical coupling moiety, a nucleic acid molecule, or a sequenceable polymer molecule (see, e.g., Niu et al., 2013, Nat. Chem. 5:282-292; Roy et al., 2015, Nat. Commun. 6:7237; Lutz, 2015, Macromolecules 48:4759-4767; each of which are incorporated by reference in its entirety) to which identifying information of a coding tag can be transferred, or from which identifying information about the macromolecule (e.g. UMI information) associated with the recording tag can be transferred to the coding tag.
- identifying information of a coding tag can be transferred, or from which identifying information about the macromolecule (e.g. UMI information) associated with the recording tag can be transferred to the coding tag.
- Identifying information can comprise any information characterizing a molecule such as information pertaining to sample, fraction, partition, spatial location, interacting neighboring molecule(s), cycle number, etc. Additionally, the presence of UMI information can also be classified as identifying information.
- information from a coding tag linked to a binding agent can be transferred to the recording tag associated with the polypeptide while the binding agent is bound to the polypeptide.
- information from a recording tag associated with the polypeptide can be transferred to the coding tag linked to the binding agent while the binding agent is bound to the polypeptide.
- a recoding tag may be directly linked to a polypeptide, linked to a polypeptide via a multifunctional linker, or associated with a polypeptide by virtue of its proximity (or co-localization) on a solid support.
- a recording tag may be linked via its 5′ end or 3′ end or at an internal site, as long as the linkage is compatible with the method used to transfer coding tag information to the recording tag or vice versa.
- a recording tag may further comprise other functional components, e.g., a universal priming site, unique molecular identifier, a barcode (e.g., a sample barcode, a fraction barcode, spatial barcode, a compartment tag, etc.), a spacer sequence that is complementary to a spacer sequence of a coding tag, or any combination thereof.
- the spacer sequence of a recording tag is preferably at the 3′-end of the recording tag in embodiments where polymerase extension is used to transfer coding tag information to the recording tag.
- primer extension also referred to as “polymerase extension,” refers to a reaction catalyzed by a nucleic acid polymerase (e.g., DNA polymerase) whereby a nucleic acid molecule (e.g., oligonucleotide primer, spacer sequence) that anneals to a complementary strand is extended by the polymerase, using the complementary strand as template.
- a nucleic acid polymerase e.g., DNA polymerase
- a nucleic acid molecule e.g., oligonucleotide primer, spacer sequence
- UMI unique molecular identifier
- a macromolecule UMI can be used to computationally deconvolute sequencing data from a plurality of extended recording tags to identify extended recording tags that originated from an individual macromolecule.
- a binding agent UMI can be used to identify each individual binding agent that binds to a particular macromolecule.
- a UMI can be used to identify the number of individual binding events for a binding agent specific for a single amino acid that occurs for a particular peptide molecule. It is understood that when UMI and barcode are both referenced in the context of a binding agent or macromolecule, that the barcode refers to identifying information other that the UMI for the individual binding agent or macromolecule (e.g., sample barcode, compartment barcode, binding cycle barcode).
- universal priming site or “universal primer” or “universal priming sequence” refers to a nucleic acid molecule, which may be used for library amplification and/or for sequencing reactions.
- a universal priming site may include, but is not limited to, a priming site (primer sequence) for PCR amplification, flow cell adaptor sequences that anneal to complementary oligonucleotides on flow cell surfaces enabling bridge amplification in some next generation sequencing platforms, a sequencing priming site, or a combination thereof.
- Universal priming sites can be used for other types of amplification, including those commonly used in conjunction with next generation digital sequencing.
- extended recording tag molecules may be circularized and a universal priming site used for rolling circle amplification to form DNA nanoballs that can be used as sequencing templates (Drmanac et al., 2009 , Science 327:78-81).
- recording tag molecules may be circularized and sequenced directly by polymerase extension from universal priming sites (Korlach et al., 2008 , Proc. Natl. Acad. Sci. 105:1176-1181).
- forward when used in context with a “universal priming site” or “universal primer” may also be referred to as “5′” or “sense.”
- reverse when used in context with a “universal priming site” or “universal primer” may also be referred to as “3′” or “antisense.”
- extended recording tag refers to a recording tag to which information of at least one binding agent's coding tag (or its complementary sequence) has been transferred following binding of the binding agent to an analyte, e.g., a macromolecule.
- Information of the coding tag may be transferred to the recording tag directly (e.g., ligation) or indirectly (e.g., primer extension).
- Information of a coding tag may be transferred to the recording tag enzymatically or chemically.
- An extended recording tag may comprise binding agent information of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200 or more coding tags.
- the base sequence of an extended recording tag may reflect the temporal and sequential order of binding of the binding agents identified by their coding tags, may reflect a partial sequential order of binding of the binding agents identified by the coding tags, or may not reflect any order of binding of the binding agents identified by the coding tags.
- the coding tag information present in the extended recording tag represents with at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98%, 99%, or 100% identity the macromolecule sequence being analyzed.
- errors may be due to off-target binding by a binding agent, or to a “missed” binding cycle (e.g., because a binding agent fails to bind to a macromolecule during a binding cycle, because of a failed primer extension reaction), or both.
- extended coding tag refers to a coding tag to which information of at least one recording tag (or its complementary sequence) has been transferred following binding of a binding agent, to which the coding tag is joined, to a macromolecule, to which the recording tag is associated.
- Information of a recording tag may be transferred to the coding tag directly (e.g., ligation), or indirectly (e.g., primer extension).
- Information of a recording tag may be transferred enzymatically or chemically.
- an extended coding tag comprises information of one recording tag, reflecting one binding event.
- the term “di-tag” or “di-tag construct” or “di-tag molecule” refers to a nucleic acid molecule to which information of at least one recording tag (or its complementary sequence) and at least one coding tag (or its complementary sequence) has been transferred following binding of a binding agent, to which the coding tag is joined, to a macromolecule, to which the recording tag is associated (see, e.g., FIG. 11B ).
- Information of a recording tag and coding tag may be transferred to the di-tag indirectly (e.g., primer extension).
- Information of a recording tag may be transferred enzymatically or chemically.
- a di-tag comprises a UMI of a recording tag, a compartment tag of a recording tag, a universal priming site of a recording tag, a UMI of a coding tag, an encoder sequence of a coding tag, a binding cycle specific barcode, a universal priming site of a coding tag, or any combination thereof.
- solid support refers to any solid material, including porous and non-porous materials, to which a macromolecule (e.g., peptide) can be associated directly or indirectly, by any means known in the art, including covalent and non-covalent interactions, or any combination thereof.
- a solid support may be two-dimensional (e.g., planar surface) or three-dimensional (e.g., gel matrix or bead).
- a solid support can be any support surface including, but not limited to, a bead, a microbead, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a flow cell, a biochip including signal transducing electronics, a channel, a microtiter well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a polymer matrix, a nanoparticle, or a microsphere.
- Materials for a solid support include but are not limited to acrylamide, agarose, cellulose, nitrocellulose, glass, gold, quartz, polystyrene, polyethylene vinyl acetate, polypropylene, polymethacrylate, polyethylene, polyethylene oxide, polysilicates, polycarbonates, Teflon, fluorocarbons, nylon, silicon rubber, polyanhydrides, polyglycolic acid, polyactic acid, polyorthoesters, functionalized silane, polypropylfumerate, collagen, glycosaminoglycans, polyamino acids, dextran, or any combination thereof.
- Solid supports further include thin film, membrane, bottles, dishes, fibers, woven fibers, shaped polymers such as tubes, particles, beads, microspheres, microparticles, or any combination thereof.
- the bead can include, but is not limited to, a ceramic bead, polystyrene bead, a polymer bead, a methylstyrene bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, a glass bead, or a controlled pore bead.
- a bead may be spherical or an irregularly shaped.
- a bead's size may range from nanometers, e.g., 100 nm, to millimeters, e.g., 1 mm. In certain embodiments, beads range in size from about 0.2 micron to about 200 microns, or from about 0.5 micron to about 5 micron. In some embodiments, beads can be about 1, 1.5, 2, 2.5, 2.8, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 15, or 20 m in diameter. In certain embodiments, “a bead” solid support may refer to an individual bead or a plurality of beads.
- substrate includes a mechanical support upon which material may be disposed to provide functionality, whether mechanical, biological, optical, chemical or other functionality.
- a substrate may be unpatterned or patterned, partitioned or unpartitioned. Molecules on a substrate may be disposed in features or may be uniformly disposed on the substrate surface.
- nucleic acid molecule refers to a single- or double-stranded polynucleotide containing deoxyribonucleotides or ribonucleotides that are linked by 3′-5′ phosphodiester bonds, as well as polynucleotide analogs.
- a nucleic acid molecule includes, but is not limited to, DNA, RNA, and cDNA.
- a polynucleotide analog may possess a backbone other than a standard phosphodiester linkage found in natural polynucleotides and, optionally, a modified sugar moiety or moieties other than ribose or deoxyribose.
- Polynucleotide analogs contain bases capable of hydrogen bonding by Watson-Crick base pairing to standard polynucleotide bases, where the analog backbone presents the bases in a manner to permit such hydrogen bonding in a sequence-specific fashion between the oligonucleotide analog molecule and bases in a standard polynucleotide.
- polynucleotide analogs include, but are not limited to xeno nucleic acid (XNA), bridged nucleic acid (BNA), glycol nucleic acid (GNA), peptide nucleic acids (PNAs), ⁇ PNAs, morpholino polynucleotides, locked nucleic acids (LNAs), threose nucleic acid (TNA), 2′-O-Methyl polynucleotides, 2′-O-alkyl ribosyl substituted polynucleotides, phosphorothioate polynucleotides, and boronophosphate polynucleotides.
- XNA xeno nucleic acid
- BNA bridged nucleic acid
- GAA glycol nucleic acid
- PNAs peptide nucleic acids
- ⁇ PNAs ⁇ PNAs
- morpholino polynucleotides include locked nucleic acids (LNAs),
- a polynucleotide analog may possess purine or pyrimidine analogs, including for example, 7-deaza purine analogs, 8-halopurine analogs, 5-halopyrimidine analogs, or universal base analogs that can pair with any base, including hypoxanthine, nitroazoles, isocarbostyril analogues, azole carboxamides, and aromatic triazole analogues, or base analogs with additional functionality, such as a biotin moiety for affinity binding.
- purine or pyrimidine analogs including for example, 7-deaza purine analogs, 8-halopurine analogs, 5-halopyrimidine analogs, or universal base analogs that can pair with any base, including hypoxanthine, nitroazoles, isocarbostyril analogues, azole carboxamides, and aromatic triazole analogues, or base analogs with additional functionality, such as a biotin moiety for affinity binding.
- nucleic acid sequencing means the determination of the order of nucleotides in a nucleic acid molecule or a sample of nucleic acid molecules.
- next generation sequencing refers to high-throughput sequencing methods that allow the sequencing of millions to billions of molecules in parallel.
- next generation sequencing methods include sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, and pyrosequencing.
- primers By attaching primers to a solid substrate and a complementary sequence to a nucleic acid molecule, a nucleic acid molecule can be hybridized to the solid substrate via the primer and then multiple copies can be generated in a discrete area on the solid substrate by using polymerase to amplify (these groupings are sometimes referred to as polymerase colonies or polonies).
- a nucleotide at a particular position can be sequenced multiple times (e.g., hundreds or thousands of times)—this depth of coverage is referred to as “deep sequencing.”
- Examples of high throughput nucleic acid sequencing technology include platforms provided by Illumina, BGI, Qiagen, Thermo-Fisher, and Roche, including formats such as parallel bead arrays, sequencing by synthesis, sequencing by ligation, capillary electrophoresis, electronic microchips, “biochips,” microarrays, parallel microchips, and single-molecule arrays, as reviewed by Service ( Science 311:1544-1546, 2006).
- single molecule sequencing or “third generation sequencing” refers to next-generation sequencing methods wherein reads from single molecule sequencing instruments are generated by sequencing of a single molecule of DNA. Unlike next generation sequencing methods that rely on amplification to clone many DNA molecules in parallel for sequencing in a phased approach, single molecule sequencing interrogates single molecules of DNA and does not require amplification or synchronization. Single molecule sequencing includes methods that need to pause the sequencing reaction after each base incorporation (‘wash-and-scan’ cycle) and methods which do not need to halt between read steps. Examples of single molecule sequencing methods include single molecule real-time sequencing (Pacific Biosciences), nanopore-based sequencing (Oxford Nanopore), duplex interrupted nanopore sequencing, and direct imaging of DNA using advanced microscopy.
- analyzing means to quantify, characterize, distinguish, or a combination thereof, all or a portion of the components of the analyte or macromolecule.
- analyzing a peptide, polypeptide, or protein includes determining all or a portion of the amino acid sequence (contiguous or non-continuous) of the peptide.
- Analyzing a macromolecule also includes partial identification of a component of the macromolecule. For example, partial identification of amino acids in the macromolecule protein sequence can identify an amino acid in the protein as belonging to a subset of possible amino acids.
- Analysis typically begins with analysis of the n th NTAA, and then proceeds to the next amino acid of the peptide (i.e., n ⁇ 1, n ⁇ 2, n ⁇ 3, and so forth). This is accomplished by cleavage of the n th NTAA, thereby converting the (n ⁇ 1) th amino acid of the peptide to an N-terminal amino acid (referred to herein as the “(n ⁇ 1) th NTAA”). Analyzing the peptide may also include determining the presence and frequency of post-translational modifications on the peptide, which may or may not include information regarding the sequential order of the post-translational modifications on the peptide.
- Analyzing the peptide may also include determining the presence and frequency of epitopes in the peptide, which may or may not include information regarding the sequential order or location of the epitopes within the peptide. Analyzing the peptide may include combining different types of analysis, for example obtaining epitope information, amino acid sequence information, post-translational modification information, or any combination thereof.
- compartment refers to a physical area or volume that separates or isolates a subset of macromolecules from a sample of macromolecules.
- a compartment may separate an individual cell from other cells, or a subset of a sample's proteome from the rest of the sample's proteome.
- a compartment may be an aqueous compartment (e.g., microfluidic droplet), a solid compartment (e.g., picotiter well or microtiter well on a plate, tube, vial, gel bead), or a separated region on a surface.
- a compartment may comprise one or more beads to which macromolecules may be immobilized.
- compartment tag refers to a single or double stranded nucleic acid molecule of about 4 bases to about 100 bases (including 4 bases, 100 bases, and any integer between) that comprises identifying information for the constituents (e.g., a single cell's proteome), within one or more compartments (e.g., microfluidic droplet).
- a compartment barcode identifies a subset of macromolecules in a sample, e.g., a subset of protein sample, that have been separated into the same physical compartment or group of compartments from a plurality (e.g., millions to billions) of compartments.
- a compartment tag can be used to distinguish constituents derived from one or more compartments having the same compartment tag from those in another compartment having a different compartment tag, even after the constituents are pooled together.
- a compartment tag comprises a barcode, which is optionally flanked by a spacer sequence on one or both sides, and an optional universal primer.
- the spacer sequence can be complementary to the spacer sequence of a recording tag, enabling transfer of compartment tag information to the recording tag.
- a compartment tag may also comprise a universal priming site, a unique molecular identifier (for providing identifying information for the peptide attached thereto), or both, particularly for embodiments where a compartment tag comprises a recording tag to be used in downstream peptide analysis methods described herein.
- a compartment tag can comprise a functional moiety (e.g., aldehyde, NHS, mTet, alkyne, etc.) for coupling to a peptide.
- a compartment tag can comprise a peptide comprising a recognition sequence for a protein ligase to allow ligation of the compartment tag to a peptide of interest.
- a compartment can comprise a single compartment tag, a plurality of identical compartment tags save for an optional UMI sequence, or two or more different compartment tags.
- each compartment comprises a unique compartment tag (one-to-one mapping).
- multiple compartments from a larger population of compartments comprise the same compartment tag (many-to-one mapping).
- a compartment tag may be joined to a solid support within a compartment (e.g., bead) or joined to the surface of the compartment itself (e.g., surface of a picotiter well). Alternatively, a compartment tag may be free in solution within a compartment.
- partition refers to random assignment of a unique barcode to a subpopulation of macromolecules from a population of macromolecules within a sample.
- partitioning may be achieved by distributing macromolecules into compartments.
- a partition may be comprised of the macromolecules within a single compartment or the macromolecules within multiple compartments from a population of compartments.
- partition tag or “partition barcode” refers to a single or double stranded nucleic acid molecule of about 4 bases to about 100 bases (including 4 bases, 100 bases, and any integer between) that comprises identifying information for a partition.
- a partition tag for a macromolecule refers to identical compartment tags arising from the partitioning of macromolecules into compartment(s) labeled with the same barcode.
- fraction refers to a subset of macromolecules (e.g., proteins) within a sample that have been sorted from the rest of the sample or organelles using physical or chemical separation methods, such as fractionating by size, hydrophobicity, isoelectric point, affinity, and so on. Separation methods include HPLC separation, gel separation, affinity separation, cellular fractionation, cellular organelle fractionation, tissue fractionation, etc. Physical properties such as fluid flow, magnetism, electrical current, mass, density, or the like can also be used for separation.
- macromolecules e.g., proteins
- fraction barcode refers to a single or double stranded nucleic acid molecule of about 4 bases to about 100 bases (including 4 bases, 100 bases, and any integer therebetween) that comprises identifying information for the macromolecules within a fraction.
- multiplexing may include an assay or other analytical method in which the presence and/or amount of multiple targets, e.g., multiple nucleic acid sequences, can be assayed simultaneously by using more than one capture probe conjugate, each of which has at least one different detection characteristic, e.g., fluorescence characteristic (for example excitation wavelength, emission wavelength, emission intensity, FWHM (full width at half maximum peak height), or fluorescence lifetime) or a unique nucleic acid or protein sequence characteristic.
- fluorescence characteristic for example excitation wavelength, emission wavelength, emission intensity, FWHM (full width at half maximum peak height), or fluorescence lifetime
- kits described herein provide a highly-parallelized approach for analyte, e.g., macromolecule, analysis. Highly multiplexed analyte macromolecule binding assays are converted into a nucleic acid molecule library for readout by next generation sequencing.
- the kits and kit components provided herein are particularly useful for protein or peptide sequencing.
- protein samples are labeled at the single molecule level with at least one nucleic acid recording tag that includes a barcode (e.g., sample barcode, compartment barcode) and an optional unique molecular identifier.
- the protein samples undergo proteolytic digest to produce a population of recording tag labeled peptides (e.g., millions to billions). These recording tag labeled peptides are pooled and immobilized randomly on a solid support (e.g., porous beads).
- the pooled, immobilized, recording tag labeled peptides are subjected to multiple, successive binding cycles, each binding cycle comprising exposure to a plurality of binding agents (e.g., binding agents for all twenty of the naturally occurring amino acids) that are labeled with coding tags comprising an encoder sequence that identifies the associated binding agent.
- binding agents e.g., binding agents for all twenty of the naturally occurring amino acids
- coding tags comprising an encoder sequence that identifies the associated binding agent.
- information about the binding of a binding agent to the peptide is captured by transferring a binding agent's coding tag information to the recording tag (or transferring the recording tag information to the coding tag or transferring both recording tag information and coding tag information to a separate di-tag construct).
- a library of extended recording tags (or extended coding tags or di-tag constructs) is generated that represents the binding histories of the assayed peptides, which can be analyzed using very high-throughput next generation digital sequencing methods.
- nucleic acid barcodes in the recording tag allows deconvolution of a massive amount of peptide sequencing data, e.g., to identify which sample, cell, subset of proteome, or protein, a peptide sequence originated from.
- kits and kit components for use in a method for analysing a macromolecule, the method comprising: (a) providing a macromolecule and an associated or co-localized recording tag joined to a solid support; (b) contacting the macromolecule with a first binding agent capable of binding to the macromolecule, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate a first order extended recording tag; (d) contacting the macromolecule with a second binding agent capable of binding to the macromolecule, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (e) transferring the information of the second coding tag is transferred to the first order extended recording tag to generate a second order extended recording tag; and (f) analysing the second order extended tag (see, e.g., FIGS. 2A-D ).
- the contacting steps (b) and (d) are performed in sequential order, e.g., the first binding agent and the second binding agent are contacted with the macromolecule in separate binding cycle reactions. In other embodiments, the contacting steps (b) and (d) are performed at the same time, e.g., as in a single binding cycle reaction comprising the first binding agent, the second binding agent, and optionally additional binding agents. In a preferred embodiment, the contacting steps (b) and (d) each comprise contacting the macromolecule with a plurality of binding agents. Kit components are provided to perform these steps.
- the method further comprises between steps (e) and (f) the following steps: (x) repeating steps (d) and (e) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the macromolecule, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the second (or higher order) extended recording tag to generate a third (or higher order) extended recording tag; and (z) analysing the third (or higher order) extended recording tag. Kit components are provided to perform these steps.
- the third (or higher order) binding agent may be contacted with the macromolecule in a separate binding cycle reaction from the first binding agent and the second binding agent.
- a n th binding agent is contacted with the analyte (such as a macromolecule) at the n th binding cycle, and information is transferred from the n th coding tag (of the n th binding agent) to the extended recording tag formed in the (n ⁇ 1) th binding cycle in order to form a further extended recording tag (the n th extended recording tag), wherein n is an integer of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or about 50, about 100, about 150, about 200, or more.
- a (n+1) th binding agent is contacted with the analyte at the (n+1) th binding cycle, and so on.
- the third (or higher order) binding agent may be contacted with the macromolecule in a single binding cycle reaction with the first binding agent, and the second binding agent.
- binding cycle specific sequences such as binding cycle specific coding tags may be used.
- the coding tags may comprise binding cycle specific spacer sequences, such that only after information is transferred from the n th coding tag to the (n ⁇ 1) th extended recording tag to form the n th extended recording tag, will then the (n+1) th binding agent (which may or may not already be bound to the analyte) be able to transfer information of the (n+1) th binding tag to the n th extended recording tag.
- kits and kit components for use in a method, the method comprising the steps of: (a) providing a macromolecule, an associated first recording tag and an associated second recording tag joined to a solid support; (b) contacting the macromolecule with a first binding agent capable of binding to the macromolecule, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the first recording tag to generate a first extended recording tag; (d) contacting the macromolecule with a second binding agent capable of binding to the macromolecule, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (e) transferring the information of the second coding tag to the second recording tag to generate a second extended recording tag; and (f) analyzing the first and second extended recording tags.
- contacting steps (b) and (d) are performed in sequential order, e.g., the first binding agent and the second binding agent are contacted with the macromolecule in separate binding cycle reactions. In other embodiments, contacting steps (b) and (d) are performed at the same time, e.g., as in a single binding cycle reaction comprising the first binding agent, the second binding agent, and optionally additional binding agents. Kit components are provided to perform these steps.
- step (a) further comprises providing an associated third (or higher order) recording tag joined to the solid support.
- the method further comprises, between steps (e) and (f), the following steps: (x) repeating steps (d) and (e) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the macromolecule, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the third (or higher order) recording tag to generate a third (or higher order) extended recording tag; and (z) analysing the first, second and third (or higher order) extended recording tags. Kit components are provided to perform these steps.
- the third (or higher order) binding agent may be contacted with the macromolecule in a separate binding cycle reaction from the first binding agent and the second binding agent.
- the third (or higher order) binding agent may be contacted with the macromolecule in a single binding cycle reaction with the first binding agent, and the second binding agent.
- the first coding tag, second coding tag, and any higher order coding tags each have a binding cycle specific sequence.
- kits and kit components for use in a method, the method comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) modifying the N-terminal amino acid (NTAA) of the peptide with a chemical moiety to produce a modified NTAA; (c) contacting the peptide with a first binding agent capable of binding to the modified NTAA, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (d) transferring the information of the first coding tag to the recording tag to generate an extended recording tag; and (e) analyzing the extended recording tag (see, e.g. FIG. 3 ).
- step (c) further comprises contacting the peptide with a second (or higher order) binding agent comprising a second (or higher order) coding tag with identifying information regarding the second (or higher order) binding agent, wherein the second (or higher order) binding agent is capable of binding to a modified NTAA other than the modified NTAA of step (b).
- contacting the peptide with the second (or higher order) binding agent occurs in sequential order following the peptide being contacted with the first binding agent, e.g., the first binding agent and the second (or higher order) binding agent are contacted with the peptide in separate binding cycle reactions.
- contacting the peptide with the second (or higher order) binding agent occurs simultaneously with the peptide being contacted with the first binding agent, e.g., as in a single binding cycle reaction comprising the first binding agent and the second (or higher order) binding agent).
- Kit components are provided to perform these steps.
- the chemical moiety is added to the NTAA via chemical reaction or enzymatic reaction.
- the chemical moiety used for modifying the NTAA is a phenylthiocarbamoyl (PTC), dinitrophenol (DNP) moiety; a sulfonyloxynitrophenyl (SNP) moiety, a dansyl moiety; a 7-methoxy coumarin moiety; a thioacyl moiety; a thioacetyl moiety; an acetyl moiety; a guanidinyl moiety; or a thiobenzyl moiety.
- PTC phenylthiocarbamoyl
- DNP dinitrophenol
- SNP sulfonyloxynitrophenyl
- a chemical moiety may be added to the NTAA using a chemical agent.
- the chemical agent for modifying an NTAA with a PTC moiety is a phenyl isothiocyanate or derivative thereof;
- the chemical agent for modifying an NTAA with a DNP moiety is 2,4-dinitrobenzenesulfonic acid (DNBS) or an aryl halide such as 1-Fluoro-2,4-dinitrobenzene (DNFB);
- the chemical agent for modifying an NTAA with a sulfonyloxynitrophenyl (SNP) moiety is 4-sulfonyl-2-nitrofluorobenzene (SNFB);
- the chemical agent for modifying an NTAA with a dansyl group is a sulfonyl chloride such as dansyl chloride;
- the chemical agent for modifying an NTAA with a 7-methoxy coumarin moiety is 7-methoxycoumarin acetic acid (MC
- the present disclosure provides a kit and kit components for use in a method comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) modifying the N-terminal amino acid (NTAA) of the peptide with a chemical moiety to produce a modified NTAA; (c) contacting the peptide with a first binding agent capable of binding to the modified NTAA, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (d) transferring the information of the first coding tag to the recording tag to generate a first extended recording tag; (e) removing the modified NTAA to expose a new NTAA; (f) modifying the new NTAA of the peptide with a chemical moiety to produce a newly modified NTAA; (g) contacting the peptide with a second binding agent capable of binding to the newly modified NTAA, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding
- the contacting steps (c) and (g) are performed in sequential order, e.g., the first binding agent and the second binding agent are contacted with the peptide in separate binding cycle reactions. Kit components are provided to perform these steps.
- the method further comprises between steps (h) and (i) the following steps: (x) repeating steps (e), (f), and (g) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the modified NTAA, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the second (or higher order) extended recording tag to generate a third (or higher order) extended recording tag; and (z) analysing the third (or higher order) extended recording tag. Kit components are provided to perform these steps.
- the chemical moiety is added to the NTAA via chemical reaction or enzymatic reaction.
- the chemical moiety is a phenylthiocarbamoyl (PTC), dinitrophenol (DNP) moiety; a sulfonyloxynitrophenyl (SNP) moiety, a dansyl moiety; a 7-methoxy coumarin moiety; a thioacyl moiety; a thioacetyl moiety; an acetyl moiety; a guanyl moiety; or a thiobenzyl moiety.
- PTC phenylthiocarbamoyl
- DNP dinitrophenol
- SNP sulfonyloxynitrophenyl
- a chemical moiety may be added to the NTAA using a chemical agent.
- the chemical agent for modifying an NTAA with a PTC moiety is a phenyl isothiocyanate or derivative thereof;
- the chemical agent for modifying an NTAA with a DNP moiety is 2,4-dinitrobenzenesulfonic acid (DNBS) or an aryl halide such as 1-Fluoro-2,4-dinitrobenzene (DNFB);
- the chemical agent for modifying an NTAA with a sulfonyloxynitrophenyl (SNP) moiety is 4-sulfonyl-2-nitrofluorobenzene (SNFB);
- the chemical agent for modifying an NTAA with a dansyl group is a sulfonyl chloride such as dansyl chloride;
- the chemical reagent for modifying an NTAA with a 7-methoxy coumarin moiety is 7-methoxycoumarin acetic acid
- a kit and kit components for use in a method for analyzing a polypeptide comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) contacting the peptide with a first binding agent capable of binding to the N-terminal amino acid (NTAA) of the peptide, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate an extended recording tag; and (d) analyzing the extended recording tag.
- NTAA N-terminal amino acid
- step (b) further comprises contacting the peptide with a second (or higher order) binding agent comprising a second (or higher order) coding tag with identifying information regarding the second (or higher order) binding agent, wherein the second (or higher order) binding agent is capable of binding to a NTAA other than the NTAA of the peptide.
- the contacting the peptide with the second (or higher order) binding agent occurs in sequential order following the peptide being contacted with the first binding agent, e.g., the first binding agent and the second (or higher order) binding agent are contacted with the peptide in separate binding cycle reactions.
- the contacting the peptide with the second (or higher order) binding agent occurs at the same time as the peptide the being contacted with first binding agent, e.g., as in a single binding cycle reaction comprising the first binding agent and the second (or higher order) binding agent.
- a kit and kit components for use in a method comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) contacting the peptide with a first binding agent capable of binding to the N-terminal amino acid (NTAA) of the peptide, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate a first extended recording tag; (d) removing the NTAA to expose a new NTAA of the peptide; (e) contacting the peptide with a second binding agent capable of binding to the new NTAA, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (f) transferring the information of the second coding tag to the first extended recording tag to generate a second extended recording tag; and (g) analyzing the second extended recording tag.
- NTAA N-terminal amino acid
- the method further comprises between steps (f) and (g) the following steps: (x) repeating steps (d), (e), and (f) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the macromolecule, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the second (or higher order) extended recording tag to generate a third (or higher order) extended recording tag; and wherein the third (or higher order) extended recording tag is analyzed in step (g). Kit components are provided to perform these steps.
- the contacting steps (b) and (e) are performed in sequential order, e.g., the first binding agent and the second binding agent are contacted with the peptide in separate binding cycle reactions.
- the methods comprise analyzing a plurality of macromolecules in parallel. In a preferred embodiment, the methods comprise analyzing a plurality of peptides in parallel.
- the step of contacting a macromolecule (or peptide) with a binding agent comprises contacting the macromolecule (or peptide) with a plurality of binding agents.
- the macromolecule may be a protein, polypeptide, or peptide.
- the peptide may be obtained by fragmenting a protein or polypeptide from a biological sample.
- the macromolecule may be or comprise a carbohydrate, lipid, nucleic acid, or macrocycle.
- the recording tag may be a DNA molecule, a DNA molecule with modified bases, an RNA molecule, a BNA, molecule, a XNA molecule, an LNA molecule, a PNA molecule, a ⁇ PNA molecule (Dragulescu-Andrasi et al., 2006 , J. Am. Chem. Soc. 128:10258-10267), a GNA molecule, or any combination thereof.
- the recording tag may comprise a universal priming site.
- the universal priming site comprises a priming site for amplification, ligation, sequencing, or a combination thereof.
- the recording tag may comprise a unique molecular identifier, a compartment tag, a partition barcode, sample barcode, a fraction barcode, a spacer sequence, or any combination thereof.
- the coding tag may comprise a unique molecular identifier (UMI), an encoder sequence, a binding cycle specific sequence, a spacer sequence, or any combination thereof.
- UMI unique molecular identifier
- the binding cycle specific sequence in the coding tag may be a binding cycle-specific spacer sequence.
- a binding cycle specific sequence is encoded as a separate barcode from the encoder sequence.
- the encoder sequence and binding cycle specific sequence is set forth in a single barcode that is unique for the binding agent and for each cycle of binding.
- the spacer sequence comprises a common binding cycle sequence that is shared among binding agents from the multiple binding cycles. In other embodiments, the spacer sequence comprises a unique binding cycle sequence that is shared among binding agents from the same binding cycle.
- the recording tag may comprise a barcode.
- the macromolecule and the associated recording tag(s) may be covalently joined to the solid support.
- the solid support may be a bead, a porous bead, a porous matrix, an expandable gel bead or matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtiter well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle, or a microsphere.
- the solid support may be a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- a plurality of macromolecules and associated recording tags may be joined to a solid support.
- the plurality of analytes are spaced apart on the solid support at an average distance >50 nm, >100 nm, or >200 nm.
- the binding agent may be a polypeptide or protein.
- the binding agent is a modified or variant aminopeptidase, a modified or variant amino acyl tRNA synthetase, a modified or variant anticalin, or a modified or variant ClpS.
- the binding agent may be capable of selectively binding to the macromolecule.
- the coding tag may be a DNA molecule, DNA molecule with modified bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a GNA molecule, a PNA molecule, a ⁇ PNA molecule, or a combination thereof.
- the binding agent and the coding tag may be joined by a linker.
- the binding agent and the coding tag may be joined by a SpyTag/SpyCatcher or SnoopTag/SnoopCatcher peptide-protein pair (Zakeri, et al., 2012, Proc Natl Acad Sci USA 109(12): E690-697; Veggiani et al., 2016, Proc. Natl. Acad. Sci. USA 113:1202-1207, each of which is incorporated by reference in its entirety).
- the SpyTag/SpyCatcher interaction is an irreversible protein-peptide interaction based on a protein domain from Streptococcus pyogenes , that locks itself together via spontaneous isopeptide bond formation.
- the binding agent and the coding tag may be joined by a SpyLigase, for example, a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties).
- the SpyLigase is a protein domain that ligates two peptide tags to each other, in order to form irreversible peptide-peptide interaction.
- a sortase may also be used to join the binding agent and the coding tag.
- a sortase may selectively join a LPXTG Tag (where X represents any amino acid) to a poly G moiety, such as GGG.
- a sortase A5 for example, from ActiveMotif, San Diego, or as disclosed in U.S. Pat. No. 9,267,127 B2 may be used.
- a sortase comprising an amino acid sequence that is at least about 50%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100% identical to the amino acid sequence of Staphylococcus aureus ( S. aureus ) Sortase A may be used.
- the transferring of information of the coding tag to the recording tag is mediated by a ligase, such as a DNA ligase, e.g., a single-stranded DNA (ssDNA) ligase.
- a DNA ligase e.g., a single-stranded DNA (ssDNA) ligase.
- ssDNA single-stranded DNA
- the ssDNA ligase can be a Thermus bacteriophage RNA ligase such as a bacteriophage TS2126 RNA ligase (e.g., CircLigaseTM and CircLigase IITM) or a variant, homologue, mutant, or modified version thereof, or an archaebacterium RNA ligase such as Methanobacterium thermoautotrophicum RNA ligase 1 or a variant, homologue, mutant, or modified version thereof.
- a Thermus bacteriophage RNA ligase such as a bacteriophage TS2126 RNA ligase (e.g., CircLigaseTM and CircLigase IITM) or a variant, homologue, mutant, or modified version thereof, or an archaebacterium RNA ligase such as Methanobacterium thermoautotrophicum RNA ligase 1 or a variant, homologue, mutant, or modified version thereof.
- the ssDNA ligase is an RNA ligase, such as a T4 RNA ligase, e.g., T4 RNA ligase 2, T4 RNA ligase 2 truncated, T4 RNA ligase 2 truncated KQ, or T4 RNA ligase 2 truncated K227Q.
- the ligation reaction may be optimized by using a crowding agent, such as PEG 4000.
- T4 DNA Ligase and Ampligase® DNA Ligase may also be used, when DNA ends to be ligated are annealed adjacent to each other on a complementary DNA sequence.
- the transferring of information of the coding tag to the recording tag is mediated by a DNA polymerase or chemical ligation.
- analyzing the extended recording tag may comprise nucleic acid sequencing.
- nucleic acid sequencing is sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, or pyrosequencing.
- nucleic acid sequencing is single molecule real-time sequencing, nanopore-based sequencing, nanogap tunneling sequencing, or direct imaging of DNA using advanced microscopy.
- the extended recording tag may be amplified prior to analysis.
- the order of the coding tag information contained on the extended recording tag may provide information regarding the order of binding by the binding agents to the macromolecule and thus, the sequence of analytes detected by the binding agents.
- the frequency of a particular coding tag information (e.g., encoder sequence) contained on the extended recording tag may provide information regarding the frequency of binding by a particular binding agent to the macromolecule and thus, the frequency of the analyte in the macromolecule detected by the binding agent.
- multiple macromolecule (e.g., protein) samples wherein a population of macromolecules within each sample are labeled with recording tags comprising a sample specific barcode, can be pooled.
- Such a pool of macromolecule samples may be subjected to binding cycles within a single-reaction tube.
- the plurality of extended recording tags representing a plurality of macromolecules may be analyzed in parallel.
- the plurality of extended recording tags representing a plurality of macromolecules may be analyzed in a multiplexed assay.
- the plurality of extended recording tags may undergo a target enrichment assay prior to analysis.
- the plurality of extended recording tags may undergo a subtraction assay prior to analysis.
- the plurality of extended recording tags may undergo a normalization assay to reduce highly abundant species prior to analysis.
- the NTAA may be removed by a modified aminopeptidase, a modified amino acid tRNA synthetase, a mild Edman degradation, an Edmanase enzyme, or anhydrous TFA.
- At least one binding agent may bind to a terminal amino acid residue.
- the terminal amino acid residue is an N-terminal amino acid or a C-terminal amino acid.
- At least one binding agent may bind to a post-translationally modified amino acid.
- kits comprising: (a) a recording tag configured to associate directly or indirectly with an analyte; (b) (i) a coding tag which comprises identifying information regarding a binding moiety capable of binding to the analyte, and which is configured to associate directly or indirectly with the binding moiety to form a binding agent, and/or (ii) a label, wherein the recording tag and the coding tag are configured to allow transfer of information between them, upon binding between the binding agent and the analyte; and optionally (c) the binding moiety.
- the recording tag and/or the analyte are configured to be immobilized directly or indirectly to a support.
- the recording tag is configured to be immobilized to the support, thereby immobilizing the analyte associated with the recording tag.
- the analyte is configured to be immobilized to the support, thereby immobilizing the recording tag associated with the analyte.
- each of the recording tag and the analyte is configured to be immobilized to the support.
- the recording tag and the analyte are configured to co-localize when both are immobilized to the support.
- the distance between (i) an analyte and (ii) a recording tag for information transfer between the recording tag and the coding tag of a binding agent bound to the analyte is less than about 10 ⁇ 6 nm, about 10 ⁇ 6 nm, about 10 ⁇ 5 nm, about 10 ⁇ 4 nm, about 0.001 nm, about 0.01 nm, about 0.1 nm, about 0.5 nm, about 1 nm, about 2 nm, about 5 nm, or more than about 5 nm, or of any value in between the above ranges.
- the kit can further comprise an immobilizing linker configured to: (i) be immobilized directly or indirectly to a support, and (ii) associate directly or indirectly with the recording tag and/or the analyte.
- the immobilizing linker is configured to associate with the recording tag and the analyte.
- the immobilizing linker can be configured to be immobilized directly to the support, thereby immobilizing the recording tag and/or the analyte which are associated with the immobilizing linker.
- the kit can further comprise the support.
- the kit can further comprise one or more reagents for transferring information between the coding tag and the recording tag, upon binding between the binding agent and the analyte.
- the one or more reagents are configured to transfer information from the coding tag to the recording tag, thereby generating an extended recording tag.
- the one or more reagents are configured to transfer information from the recording tag to the coding tag, thereby generating an extended coding tag.
- the one or more reagents are configured to generate a di-tag construct comprising information from the coding tag and information from the recording tag.
- the kit can comprise at least two of the recording tags. In any of the preceding embodiments, the kit can comprise at least two of the coding tags each comprising identifying information regarding its associated binding moiety.
- each analyte has a plurality of recording tags (e.g., at least about two, about five, about ten, about 20, about 50, about 100, about 200, about 500, about 1000, about 2000, about 5000, or more) available to a binding agent bound to that analyte.
- the kit comprises a plurality of recording tags, e.g., at least about two, about five, about ten, about 20, about 50, about 100, about 200, about 500, about 1000, about 2000, about 5000, or more.
- the kit can comprise at least two of the binding agents.
- the kit comprises: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to the recording tag to generate a first order extended recording tag, upon binding between the first binding agent and the analyte, and/or (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to the first order extended recording tag to generate a second order extended recording tag, upon binding between the second binding agent and the analyte, wherein the one or more reagents of (i) and the one or more reagents of (ii) can be the same or different.
- each analyte has a plurality of binding agents and/or coding tags, e.g., at least about two, about five, about ten, about 20, about 50, about 100, about 200, about 500, about 1000, about 2000, about 5000, or more, available to a recording tag for the analyte, and the plurality of binding agents may be added sequentially or in parallel.
- the kit comprises a plurality of binding agents and/or coding tags, e.g., at least about two, about five, about ten, about 20, about 50, about 100, about 200, about 500, about 1000, about 2000, about 5000, or more.
- the kit can further comprise (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to the second order extended recording tag to generate a third (or higher order) order extended recording tag, upon binding between the third (or higher order) binding agent and the analyte.
- the kit comprises: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to a first recording tag to generate a first extended recording tag, upon binding between the first binding agent and the analyte, (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to a second recording tag to generate a second extended recording tag, upon binding between the second binding agent and the analyte, and/or (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to a third (or higher order) recording tag to generate a third (or higher order) extended recording tag, upon binding between the third (or higher order) binding agent and the analyte, wherein the one or more reagents of (i), (ii), and/or (iii) can be the same or different.
- the kit can further comprise (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to a third (or higher order) recording tag to generate a third (or higher order) extended recording tag, upon binding between the third (or higher order) binding agent and the analyte.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to associate directly or indirectly with the analyte.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to be immobilized on a support.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to co-localize with the analyte, for example, to allow transfer of information between the first, second, or third (or higher order) coding tag and the first, second, or third (or higher order) recording tag, respectively, upon binding between the first, second, or third (or higher order) binding agent and the analyte.
- each of the first coding tag, the second coding tag, and/or the third (or higher order) coding tag can comprise a binding cycle specific barcode, such as a binding cycle specific spacer sequence C n , and/or a coding tag specific spacer sequence C n , wherein n is an integer and C n indicates binding between the n th binding agent and the polypeptide.
- a binding cycle tag C n may be added exogenously, for example, the binding cycle tag C n may be exogenous to the coding tag(s).
- the analyte can comprise a polypeptide.
- the binding moiety of the kit is capable of binding to one or more N-terminal, internal, or C-terminal amino acids of the polypeptide, or capable of binding to the one or more N-terminal, internal, or C-terminal amino acids modified by a functionalizing reagent.
- the kit can further comprise one or more of the functionalizing reagent.
- the kit can further comprise an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the one or more N-terminal, internal, or C-terminal amino acids of the polypeptide, or removing the functionalized N-terminal, internal, or C-terminal amino acid(s), optionally wherein the eliminating reagent comprises a carboxypeptidase or an aminopeptidase or variant, mutant, or modified protein thereof; a hydrolase or variant, mutant, or modified protein thereof; a mild Edman degradation reagent; an Edmanase enzyme; anhydrous TFA, a base; or any combination thereof.
- an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the one or more N-terminal, internal, or C-terminal amino acids of the polypeptide, or removing the functionalized N-terminal, internal, or C-terminal amino acid(s), optionally wherein the eliminating reagent comprises
- the one or more N-terminal, internal, or C-terminal amino acids can comprise: (i) an N-terminal amino acid (NTAA); (ii) an N-terminal dipeptide sequence; (iii) an N-terminal tripeptide sequence; (iv) an internal amino acid; (v) an internal dipeptide sequence; (vi) an internal tripeptide sequence; (vii) a C-terminal amino acid (CTAA); (viii) a C-terminal dipeptide sequence; or (ix) a C-terminal tripeptide sequence, or any combination thereof, optionally wherein any one or more of the amino acid residues in (i)-(ix) are modified or functionalized.
- kits comprising: at least (a) a first binding agent comprising (i) a first binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a first coding tag comprising identifying information regarding the first binding moiety, optionally (b) a recording tag configured to associate directly or indirectly with the polypeptide, and further optionally (c) a functionalizing reagent capable of modifying a first NTAA of the polypeptide to generate a first functionalized NTAA, wherein the recording tag and the first binding agent are configured to allow transfer of information between the first coding tag and the recording tag, upon binding between the first binding agent and the polypeptide.
- the kit further comprises one or more reagents for transferring information from the first coding tag to the recording tag, thereby generating a first order extended recording tag.
- the functionalizing reagent can comprise a chemical agent, an enzyme, and/or a biological agent, such as an isothiocyanate derivative, 2,4-dinitrobenzenesulfonic (DNBS), 4-sulfonyl-2-nitrofluorobenzene (SNFB) 1-fluoro-2,4-dinitrobenzene, dansyl chloride, 7-methoxycoumarin acetic acid, a thioacylation reagent, a thioacetylation reagent, or a thiobenzylation reagent.
- DNBS 2,4-dinitrobenzenesulfonic
- SNFB 4-sulfonyl-2-nitrofluorobenzene 1-fluoro-2,4-dinitrobenzene
- dansyl chloride 7-methoxycoumarin acetic acid
- a thioacylation reagent a thioacetylation reagent
- thioacetylation reagent a thio
- the kit can further comprise an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the first functionalized NTAA to expose the immediately adjacent amino acid residue, as a second NTAA.
- the second NTAA is capable of being functionalized by the same or a different functionalizing reagent to generate a second functionalized NTAA, which may be the same as or different from the first functionalized NTAA.
- the kit further comprises: (d) a second (or higher order) binding agent comprising (i) a second (or higher order) binding moiety capable of binding to the second functionalized NTAA, and (ii) a second (or higher order) coding tag comprising identifying information regarding the second (or higher order) binding moiety, wherein the first coding tag and the second (or higher order) coding tag can be the same or different.
- the first functionalized NTAA and the second functionalized NTAA are selected, independent from each other, from the group consisting of a functionalized N-terminal Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr), in any combination thereof.
- a or Ala Alanine
- C or Cys Cysteine
- Aspartic Acid D or Asp
- the kit can further comprise one or more reagents for transferring information from the second (or higher order) coding tag to the first order extended recording tag, thereby generating a second (or higher order) order extended recording tag.
- kits comprising: at least (a) one or more binding agents each comprising (i) a binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a coding tag comprising identifying information regarding the binding moiety, and/or (b) one or more recording tags configured to associate directly or indirectly with the polypeptide, wherein the one or more recording tags and the one or more binding agents are configured to allow transfer of information between the coding tags and the recording tags, upon binding between each binding agent and the polypeptide, and optionally (c) a functionalizing reagent capable of modifying a first NTAA of the polypeptide to generate a first functionalized NTAA.
- binding agents each comprising (i) a binding moiety capable of binding to an N-terminal amino acid (NTAA) or a functionalized NTAA of a polypeptide to be analyzed, and (ii) a coding tag comprising identifying information regarding the binding mo
- kit further comprises an eliminating reagent for removing (e.g., by chemical cleavage or enzymatic cleavage) the first functionalized NTAA to expose the immediately adjacent amino acid residue, as a second NTAA.
- the second NTAA is capable of being functionalized by the same or a different functionalizing reagent to generate a second functionalized NTAA, which may be the same as or different from the first functionalized NTAA.
- the first functionalized NTAA and the second functionalized NTAA are selected, independent from each other, from the group consisting of a functionalized N-terminal Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr), in any combination thereof.
- a or Ala Alanine
- C or Cys Cysteine
- Aspartic Acid D or Asp
- the kit can comprise: (i) one or more reagents for transferring information from a first coding tag of a first binding agent to a first recording tag to generate a first extended recording tag, upon binding between the first binding agent and the polypeptide, and/or (ii) one or more reagents for transferring information from a second coding tag of a second binding agent to a second recording tag to generate a second extended recording tag, upon binding between the second binding agent and the polypeptide, wherein the one or more reagents of (i) and the one or more reagents of (ii) can be the same or different.
- the kit further comprises: (iii) one or more reagents for transferring information from a third (or higher order) coding tag of a third (or higher order) binding agent to a third (or higher order) recording tag to generate a third (or higher order) extended recording tag, upon binding between the third (or higher order) binding agent and the polypeptide.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to associate directly or indirectly with the polypeptide.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to be immobilized on a support.
- the first recording tag, the second recording tag, and/or the third (or higher order) recording tag can be configured to co-localize with the polypeptide, for example, to allow transfer of information between the first, second, or third (or higher order) coding tag and the first, second, or third (or higher order) recording tag, respectively, upon binding between the first, second, or third (or higher order) binding agent and the polypeptide.
- the distance between or among the first recording tag, the second recording tag, and/or the third (or higher order) recording tag on the support can be equal to or greater than about 10 nm, equal to or greater than about 15 nm, equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, or equal to or greater than about 500 nm, while each recording tag and its corresponding analyte is configured to co-localize when both are immobilized to the support, or while the distance between each recording tag and its corresponding analyte is less than about 10 ⁇ 6 nm, about 10 ⁇ 6 nm, about
- each of the first coding tag, the second coding tag, and/or the third (or higher order) coding tag can comprise a binding cycle specific barcode, such as a binding cycle specific spacer sequence C n , and/or a coding tag specific spacer sequence C n , wherein n is an integer and C n indicates binding between the n th binding agent and the polypeptide.
- a binding cycle tag C n may be added exogenously, for example, the binding cycle tag C n may be exogenous to the coding tag(s).
- the analyte or the polypeptide can comprise a protein or a polypeptide chain or a fragment thereof, a lipid, a carbohydrate, or a macrocycle, or a combination or complex thereof.
- the analyte or the polypeptide can comprise a macromolecule or a complex thereof, such as a protein complex or subunit thereof.
- the recording tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA or RNA with one more protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the recording tag can comprise a universal priming site.
- the recording tag can comprise a priming site for amplification, sequencing, or both, for example, the universal priming site comprises a priming site for amplification, sequencing, or both.
- the recording tag and/or the coding tag can comprise a unique molecule identifier (UMI).
- UMI unique molecule identifier
- the recording tag and/or the coding tag can comprise a barcode and/or a nuclease site, such as a nicking endonuclease site (e.g., a dsDNA nicking endonuclease site).
- a nicking endonuclease site e.g., a dsDNA nicking endonuclease site
- the recording tag and/or the coding tag comprises a spacer at its 3′-terminus and/or at its 5′-terminus, for example, the recording tag comprises a spacer at its 3′-terminus.
- the recording tag and/or the coding tag can comprise one or more nuclease sites, such as an endonuclease site, a homing endonuclease site, a restriction enzyme digestion site, a nicking endonuclease site, or a combination thereof.
- a nuclease site can be provided in the coding tag, for example, within the spacer sequence or between the spacer sequence and the encoder sequence.
- a nuclease site can be provided in the recording tag, for example, between the universal primer sequence and the support (e.g., for cleaving the recording tag off the support).
- the kit can comprise a solid support, such as a rigid solid support, a flexible solid support, or a soft solid support, and including a porous support or a non-porous support.
- a solid support such as a rigid solid support, a flexible solid support, or a soft solid support, and including a porous support or a non-porous support.
- the kit can comprise a support which comprises a bead, a porous bead, a porous matrix, an array, a surface, a glass surface, a silicon surface, a plastic surface, a slide, a filter, nylon, a chip, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a well, a microtitre well, a plate, an ELISA plate, a disc, a spinning interferometry disc, a membrane, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle (e.g., comprising a metal such as magnetic nanoparticles (Fe 3 O 4 ), gold nanoparticles, and/or silver nanoparticles), quantum dots, a nanoshell, a nanocage, a microsphere, or any combination thereof.
- a support which comprises a bead, a porous bead, a porous matrix, an array, a surface, a glass surface
- the support comprises a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- the kit can comprise a support and/or can be used for analyzing a plurality of the analytes (such as polypeptides), in sequential reactions, in parallel reactions, or in a combination of sequential and parallel reactions.
- the analytes are spaced apart on the support at an average distance equal to or greater than about 10 nm, equal to or greater than about 15 nm, equal to or greater than about 20 nm, equal to or greater than about 50 nm, equal to or greater than about 100 nm, equal to or greater than about 150 nm, equal to or greater than about 200 nm, equal to or greater than about 250 nm, equal to or greater than about 300 nm, equal to or greater than about 350 nm, equal to or greater than about 400 nm, equal to or greater than about 450 nm, or equal to or greater than about 500 nm.
- the binding moiety can comprise a polypeptide or fragment thereof, a protein or polypeptide chain or fragment thereof, or a protein complex or subunit thereof, such as an antibody or antigen binding fragment thereof.
- the binding moiety can comprise a carboxypeptidase or an aminopeptidase or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof; a ClpS or variant, mutant, or modified protein thereof; a UBR box protein or variant, mutant, or modified protein thereof; a modified small molecule that binds amino acid(s), i.e.
- the binding moiety comprises a small molecule
- the coding tag comprises a polynucleotide that identifies the small molecule, whereby a plurality of the binding agents form an encoded small molecule library, such as a DNA-encoded small molecule library.
- the binding moiety can comprise a small molecule, a peptide or peptide mimetic, a peptidomimetic (e.g., a peptoid, a ⁇ -peptide, or a D-peptide peptidomimetic), a polysaccharide, or an aptamer (e.g., a nucleic acid aptamer, such as a DNA aptamer, or a peptide aptamer), and the coding tag comprises a polynucleotide that identifies the small molecule, peptide or peptide mimetic, peptidomimetic (e.g., peptoid, ⁇ -peptide, or D-peptide peptidomimetic), polysaccharide, or aptamer, whereby a plurality of the binding agents form an encoded small molecule library, a peptide and/or peptide mimetic library, a peptidomim
- the binding moiety can selectively and/or specifically bind to the analyte or the polypeptide.
- the coding tag can comprise a nucleic acid, an oligonucleotide, a modified oligonucleotide, a DNA molecule, a DNA with pseudo-complementary bases, a DNA or RNA with one more protected bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a morpholino, or a combination thereof.
- the coding tag can comprise a barcode sequence, such as an encoder sequence, e.g., one that identifies the binding moiety.
- the coding tag can comprise a spacer, a binding cycle specific sequence, a unique molecular identifier (UMI), a universal priming site, or any combination thereof.
- a binding cycle specific sequence is added to the recording tag after each binding cycle.
- the binding moiety and the coding tag can be joined by a linker or a binding pair.
- the binding moiety and the coding tag can be joined by a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties), a SpyTag/SpyCatcher, a SnoopTag/SnoopCatcher peptide-protein pair, a sortase, or a HaloTag/HaloTag ligand pair, or any combination thereof.
- a SpyTag-KTag/SpyLigase where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties
- a SpyTag/SpyCatcher a SnoopTag/SnoopCatcher peptide-protein pair
- sortase a sortase
- HaloTag/HaloTag ligand pair or any combination thereof.
- the kit can further comprise a reagent for transferring information between the coding tag and the recording tag in a templated or non-templated reaction, optionally wherein the reagent is (i) a chemical ligation reagent or a biological ligation reagent, for example, a ligase, such as a DNA ligase or RNA ligase for ligating single-stranded nucleic acid or double-stranded nucleic acid, or (ii) a reagent for primer extension of single-stranded nucleic acid or double-stranded nucleic acid, optionally wherein the kit further comprises a ligation reagent comprising at least two ligases or variants thereof (e.g., at least two DNA ligases, or at least two RNA ligases, or at least one DNA ligase and at least one RNA ligase), wherein the at least two ligases or variants thereof comprises an adenylated liga
- the kit can further comprise a polymerase, such as a DNA polymerase or RNA polymerase or a reverse transcriptase, for transferring information between the coding tag and the recording tag.
- a polymerase such as a DNA polymerase or RNA polymerase or a reverse transcriptase
- the kit can further comprise one or more reagents for nucleic acid sequence analysis.
- the nucleic acid sequence analysis comprises sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, pyrosequencing, single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy, or any combination thereof.
- the kit can further comprise one or more reagents for nucleic acid amplification, for example, for amplifying one or more extended recording tags, optionally wherein the nucleic acid amplification comprises an exponential amplification reaction (e.g., polymerase chain reaction (PCR), such as an emulsion PCR to reduce or eliminate template switching) and/or a linear amplification reaction (e.g., isothermal amplification by in vitro transcription, or Isothermal Chimeric primer-initiated Amplification of Nucleic acids (ICAN)).
- PCR polymerase chain reaction
- ICAN Isothermal Chimeric primer-initiated Amplification of Nucleic acids
- the kit can comprise one or more reagents for transferring coding tag information to the recording tag to form an extended recording tag, wherein the order and/or frequency of coding tag information on the extended recording tag indicates the order and/or frequency in which the binding agent binds to the analyte or the polypeptide.
- the kit can further comprise one or more reagents for target enrichment, for example, enrichment of one or more extended recording tags.
- the kit can further comprise one or more reagents for subtraction, for example, subtraction of one or more extended recording tags.
- the kit can further comprise one or more reagents for normalization, for example, to reduce highly abundant species such as one or more analytes or polypeptides.
- At least one binding agent of the kit can bind to a terminal amino acid residue, terminal di-amino-acid residues, or terminal triple-amino-acid residues.
- At least one binding agent of the kit can bind to a post-translationally modified amino acid.
- the kit can further comprise one or more reagents or means for partitioning a plurality of the analytes or polypeptides in a sample into a plurality of compartments, wherein each compartment comprises a plurality of compartment tags optionally joined to a support (e.g., a solid support), wherein the plurality of compartment tags are the same within an individual compartment and are different from the compartment tags of other compartments.
- the kit further comprises one or more reagents or means for fragmenting the plurality of the analytes or polypeptides (such as a plurality of protein complexes, proteins, and/or polypeptides) into a plurality of polypeptide fragments.
- the kit can further comprise one or more reagents or means for annealing or joining of the plurality of polypeptide fragments with the compartment tag within each of the plurality of compartments, thereby generating a plurality of compartment tagged polypeptide fragments.
- the plurality of compartments can comprise a microfluidic droplet, a microwell, or a separated region on a surface, or any combination thereof.
- each of the plurality of compartments can comprise on average a single cell.
- the kit can further comprise one or more universal DNA tags for labeling the plurality of the analytes or polypeptides in the sample.
- the kit can further comprise one or more reagents for labeling the plurality of the analytes or polypeptides in the sample with one or more universal DNA tags.
- the kit can further comprise one or more reagents for primer extension or ligation.
- the support can comprise a bead, such as a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- a bead such as a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead, or any combination thereof.
- the compartment tag can comprise a single stranded or double stranded nucleic acid molecule.
- the compartment tag can comprise a barcode and optionally a UMI.
- the support can be a bead and the compartment tag can comprise a barcode.
- the support can comprise a bead, and beads comprising the plurality of compartment tags joined thereto can be formed by split-and-pool synthesis, individual synthesis, or immobilization, or any combination thereof.
- the kit can further comprise one or more reagents for split-and-pool synthesis, individual synthesis, or immobilization, or any combination thereof.
- the compartment tag can be a component within a recording tag, wherein the recording tag optionally can further comprise a spacer, a barcode sequence, a unique molecular identifier, a universal priming site, or any combination thereof.
- the compartment tags can further comprise a functional moiety capable of reacting with an internal amino acid, the peptide backbone, or N-terminal amino acid on the plurality of analytes or polypeptides (such as protein complexes, proteins, or polypeptides).
- the functional moiety can comprise an aldehyde, an azide/alkyne, a malemide/thiol, an epoxy/nucleophile, an inverse Electron Demand Diels-Alder (iEDDA) group, a click reagent, or any combination thereof.
- the compartment tag can further comprise a peptide, such as a protein ligase recognition sequence, and optionally the protein ligase can be butelase I or a homolog thereof.
- the kit can further comprise a chemical or biological reagent, such as an enzyme, for example, a protease (e.g., a metalloprotease), for fragmenting the plurality of analytes or polypeptides.
- a chemical or biological reagent such as an enzyme, for example, a protease (e.g., a metalloprotease), for fragmenting the plurality of analytes or polypeptides.
- the kit can further comprise one or more reagents for releasing the compartment tags from the support.
- the kit can further comprise one or more reagents for forming an extended coding tag or a di-tag construct.
- the 3′-terminus of the recording tag is blocked to prevent extension of the recording tag by a polymerase.
- the coding tag can comprise an encoder sequence, a UMI, a universal priming site, a spacer at its 3′-terminus, a binding cycle specific sequence, or any combination thereof.
- the di-tag construct can be generated by gap fill, primer extension, or a combination thereof.
- the di-tag molecule can comprise a universal priming site derived from the recording tag, a compartment tag derived from the recording tag, a unique molecular identifier derived from the recording tag, an optional spacer derived from the recording tag, an encoder sequence derived from the coding tag, a unique molecular identifier derived from the coding tag, an optional spacer derived from the coding tag, and a universal priming site derived from the coding tag.
- the binding agent can be a polypeptide or protein.
- the binding agent can comprise an aminopeptidase or variant, mutant, or modified protein thereof; an aminoacyl tRNA synthetase or variant, mutant, or modified protein thereof; an anticalin or variant, mutant, or modified protein thereof, a ClpS or variant, mutant, or modified protein thereof; or a modified small molecule that binds amino acid(s), i.e. vancomycin or a variant, mutant, or modified molecule thereof; or an antibody or binding fragment thereof; or any combination thereof.
- the binding agent can bind to a single amino acid residue (e.g., an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue), a dipeptide (e.g., an N-terminal dipeptide, a C-terminal dipeptide, or an internal dipeptide), a tripeptide (e.g., an N-terminal tripeptide, a C-terminal tripeptide, or an internal tripeptide), or a post-translational modification of the analyte or polypeptide.
- a single amino acid residue e.g., an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue
- a dipeptide e.g., an N-terminal dipeptide, a C-terminal dipeptide, or an internal dipeptide
- a tripeptide e.g., an N-terminal tripeptide, a C-terminal tripeptide, or an internal tripeptid
- the binding agent can bind to an N-terminal polypeptide, a C-terminal polypeptide, or an internal polypeptide.
- the coding tag and/or the recording tag can comprise one or more error correcting codes, one or more encoder sequences, one or more barcodes, one or more UMIs, one or more compartment tags, one or more cycle specific sequences, or any combination thereof.
- the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- the coding tag and/or the recording tag can comprise a cycle label.
- the kit can further comprise a cycle label independent of the coding tag and/or the recording tag.
- the kit can further comprise: (a) a reagent for generating a cell lysate or a protein sample; (b) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (c) a protease, such as trypsin, LysN, or LysC; (d) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support; (e) a reagent for degradation-based polypeptide sequencing; and/or (f) a reagent for nucleic acid sequencing.
- a reagent for generating a cell lysate or a protein sample a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine
- a protease such as trypsin, LysN, or LysC
- the kit can comprise: (a) a reagent for generating a cell lysate or a protein sample; (b) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (c) a protease, such as trypsin, LysN, or LysC; (d) a reagent for immobilizing a polypeptide (such as a protein) to a support comprising immobilized recording tags; (e) a reagent for degradation-based polypeptide sequencing; and/or (f) a reagent for nucleic acid sequencing.
- a reagent for generating a cell lysate or a protein sample a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine
- a protease such as trypsin, LysN, or LysC
- a reagent for immobilizing a polypeptide such as a protein
- the kit can comprise: (a) a reagent for generating a cell lysate or a protein sample; (b) a denaturing reagent; (c) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (d) a universal DNA primer sequence; (e) a reagent for labeling a polypeptide with a universal DNA primer sequence; (f) a barcoded bead for annealing the labeled polypeptide via a primer; (g) a reagent for polymerase extension for writing the barcode from the bead to the labeled polypeptide; (h) a protease, such as trypsin, LysN, or LysC; (i) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support; (j) a reagent for degradation
- the kit can comprise: (a) a cross-linking reagent; (b) a reagent for generating a cell lysate or a protein sample; (c) a reagent for blocking an amino acid side chain, such as via alkylation of cysteine or blocking lysine; (d) a universal DNA primer sequence; (e) a reagent for labeling a polypeptide with a universal DNA primer sequence; (f) a barcoded bead for annealing the labeled polypeptide via a primer; (g) a reagent for polymerase extension for writing the barcode from the bead to the labeled polypeptide; (h) a protease, such as trypsin, LysN, or LysC; (i) a reagent for immobilizing a nucleic acid-labeled polypeptide (such as a DNA-labeled protein) to a support; (j) a reagent for
- one or more components can be provided in a solution or on a support, for example, a solid support.
- Kit components may also include any molecule, molecular complex or conjugate, reagent (e.g., chemical or biological), agent, structure (e.g., support, surface, particle, or bead), reaction intermediate, reaction product, binding complex, or any other article of manufacture disclosed and/or used in the following exemplary methods.
- the present kits can be used for analyzing any suitable analyte, e.g., a macromolecule or a polypeptide.
- the present kits can be used for highly-parallel, high throughput digital analysis (e.g., a macromolecule analysis), particularly polypeptide analysis.
- the present kits can be used in the following exemplary methods for analyzing an analyte, e.g., a macromolecule or a polypeptide.
- Example is a method for analyzing an analyte, e.g., a macromolecule or a polypeptide, comprising the steps of: (a) providing an analyte and an associated recording tag joined to a solid support; (b) contacting the an analyte with a first binding agent capable of binding to the analyte, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate a first order extended recording tag; (d) contacting the analyte with a second binding agent capable of binding to the analyte, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (e) transferring the information of the second coding tag to the first order extended recording tag to generate a second order extended recording tag; and (f) analyzing the second order extended recording tag.
- a first binding agent capable of binding to the analyte
- a second Example is the method of the first Example, wherein contacting steps (b) and (d) are performed in sequential order.
- a third Example is the method of the first Example, where wherein contacting steps (b) and (d) are performed at the same time.
- a fourth Example is the method of the first Example, further comprising, between steps (e) and (f), the following steps: (x) repeating steps (d) and (e) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the analyte, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the second (or higher order) extended recording tag to generate a third (or higher order) extended recording tag; and wherein the third (or higher order) extended recording tag is analyzed in step (f).
- Example 5 is a method for analyzing an analyte, e.g., a macromolecule or a polypeptide, comprising the steps of: (a) providing an analyte, an associated first recording tag and an associated second recording tag joined to a solid support; (b) contacting the analyte with a first binding agent capable of binding to the analyte, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the first recording tag to generate a first extended recording tag; (d) contacting the analyte with a second binding agent capable of binding to the analyte, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (e) transferring the information of the second coding tag to the second recording tag to generate a second extended recording tag; and (f) analyzing the first and second extended recording tags.
- a first binding agent capable of binding to the analyt
- a sixth Example is the method of fifth Example, wherein contacting steps (b) and (d) are performed in sequential order.
- a seventh Example is the method of the fifth Example, wherein contacting steps (b) and (d) are performed at the same time.
- step (a) further comprises providing an associated third (or higher order) recording tag joined to the solid support.
- a ninth Example is the method of the eighth Example, further comprising, between steps (e) and (f), the following steps: (x) repeating steps (d) and (e) one or more times by replacing the second binding agent with a third (or higher order) binding agent capable of binding to the analyte, wherein the third (or higher order) binding agent comprises a third (or higher order) coding tag with identifying information regarding the third (or higher order) bind agent; and (y) transferring the information of the third (or higher order) coding tag to the third (or higher order) recording tag to generate a third (or higher order) extended recording tag; and wherein the first, second and third (or higher order) extended recording tags are analyzed in step (f).
- a 10 th Example is the method of any one of the fifth to ninth Examples, wherein the first coding tag, second coding tag, and any higher order coding tags comprise a binding cycle specific spacer sequence.
- Example is a method for analyzing a peptide, comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) modifying the N-terminal amino acid (NTAA) of the peptide with a chemical agent; (c) contacting the peptide with a first binding agent capable of binding to the modified NTAA, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (d) transferring the information of the first coding tag to the recording tag to generate an extended recording tag; and (e) analyzing the extended recording tag.
- NTAA N-terminal amino acid
- step (c) further comprises contacting the peptide with a second (or higher order) binding agent comprising a second (or higher order) coding tag with identifying information regarding the second (or higher order) binding agent, wherein the second (or higher order) binding agent is capable of binding to a modified NTAA other than the modified NTAA of step (b).
- a 13 th Example is the method of the 12 th Example, wherein contacting the peptide with the second (or higher order) binding agent occurs in sequential order following the peptide being contacted with the first binding agent.
- Example 14 th Example is the method of 12 th Example, wherein contacting the peptide with the second (or higher order) binding agent occurs simultaneously with the peptide being contacted with the first binding agent.
- Example 15 th Example is the method of any one the 11 th -14 th Examples, wherein the chemical agent is an isothiocyanate derivative, 2,4-dinitrobenzenesulfonic (DNBS), 4-sulfonyl-2-nitrofluorobenzene (SNFB) 1-fluoro-2,4-dinitrobenzene, dansyl chloride, 7-methoxycoumarin acetic acid, a thioacylation reagent, a thioacetylation reagent, or a thiobenzylation reagent.
- DNBS 2,4-dinitrobenzenesulfonic
- SNFB 4-sulfonyl-2-nitrofluorobenzene 1-fluoro-2,4-dinitrobenzene
- dansyl chloride 7-methoxycoumarin acetic acid
- a thioacylation reagent a thioacetylation reagent
- thiobenzylation reagent a thio
- Example is a method for analyzing a peptide, comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) modifying the N-terminal amino acid (NTAA) of the peptide with a chemical agent to yield a modified NTAA; (c) contacting the peptide with a first binding agent capable of binding to the modified NTAA, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (d) transferring the information of the first coding tag to the recording tag to generate a first extended recording tag; (e) removing the modified NTAA to expose a new NTAA; (f) modifying the new NTAA of the peptide with a chemical agent to yield a newly modified NTAA; (g) contacting the peptide with a second binding agent capable of binding to the newly modified NTAA, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (
- Example is a method for analyzing a peptide, comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) contacting the peptide with a first binding agent capable of binding to the N-terminal amino acid (NTAA) of the peptide, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate an extended recording tag; and (d) analyzing the extended recording tag.
- NTAA N-terminal amino acid
- step (b) further comprises contacting the peptide with a second (or higher order) binding agent comprising a second (or higher order) coding tag with identifying information regarding the second (or higher order) binding agent, wherein the second (or higher order) binding agent is capable of binding to a NTAA other than the NTAA of the peptide.
- a 19 th Example is the method of the 18 th Example, wherein contacting the peptide with the second (or higher order) binding agent occurs in sequential order following the peptide being contacted with the first binding agent.
- a 20 th Example is the method of the 18 th Example, wherein contacting the peptide with the second (or higher order) binding agent occurs simultaneously with the peptide being contacted with the first binding agent.
- Example is a method for analyzing a peptide, comprising the steps of: (a) providing a peptide and an associated recording tag joined to a solid support; (b) contacting the peptide with a first binding agent capable of binding to the N-terminal amino acid (NTAA) of the peptide, wherein the first binding agent comprises a first coding tag with identifying information regarding the first binding agent; (c) transferring the information of the first coding tag to the recording tag to generate a first extended recording tag; (d) removing the NTAA to expose a new NTAA of the peptide; (e) contacting the peptide with a second binding agent capable of binding to the new NTAA, wherein the second binding agent comprises a second coding tag with identifying information regarding the second binding agent; (f) transferring the information of the second coding tag to the first extended recording tag to generate a second extended recording tag; and (g) analyzing the second extended recording tag.
- NTAA N-terminal amino acid
- Example 22 is the method of any one of the first-10 th Examples, wherein the analyte is a protein, polypeptide or peptide.
- Example 23 rd Example is the method of any one of the first-10 th Examples, wherein the analyte is a peptide.
- Example 24 th Example is the method of any one of the 11 th -23 rd Examples, wherein the peptide is obtained by fragmenting a protein from a biological sample.
- Example 25 th Example is the method of any one of the first-10 th Examples, wherein the analyte is a lipid, a carbohydrate, or a macrocycle.
- a 26 th Example is the method of any one of the first-25 th Examples, wherein the recording tag is a DNA molecule, DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a combination thereof.
- the recording tag is a DNA molecule, DNA with pseudo-complementary bases, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a combination thereof.
- a 27 th Example is the method of any one of the first-26 th Examples, wherein the recording tag comprises a universal priming site.
- a 28 th Example is the method of the 27 th Example, wherein the universal priming site comprises a priming site for amplification, sequencing, or both.
- a 29 th Example is the method of the first-28 th Examples, where the recording tag comprises a unique molecule identifier (UMI).
- UMI unique molecule identifier
- a 30 th Example is the method of any one of the first-29 th Examples, wherein the recording tag comprises a barcode.
- a 31 st Example is the method of any one of the first-30 th Examples, wherein the recording tag comprises a spacer at its 3′-terminus.
- a 32 nd Example is the method of any one of the first-31 st Examples, wherein the analyte and the associated recording tag are covalently joined to the solid support.
- a 33 rd Example is the method of any one of the first-32 nd Examples, wherein the solid support is a bead, a porous bead, a porous matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtitre well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle, or a microsphere.
- the solid support is a bead, a porous bead, a porous matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtitre well, an ELISA plate, a spinning interferometry disc,
- a 34 th Example is the method of the 33 rd Example, wherein the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- Example is the method of any one of the first-34 th Examples, wherein a plurality of analytes (e.g., molecules of the same analyte or of different analytes) and associated recording tags are joined to a solid support.
- analytes e.g., molecules of the same analyte or of different analytes
- a 36 th Example is the method of the 35 th Example, wherein the plurality of analytes (e.g., molecules of the same analyte or of different analytes) are spaced apart on the solid support at an average distance >50 nm.
- the plurality of analytes e.g., molecules of the same analyte or of different analytes
- Example 37 is the method of any one of first-36 th Examples, wherein the binding agent is a polypeptide or protein.
- a 38 th Example is the method of the 37 th Example, wherein the binding agent is a modified aminopeptidase, a modified amino acyl tRNA synthetase, a modified anticalin, or a modified ClpS.
- Example 39 th Example is the method of any one of the first-38 th Examples, wherein the binding agent is capable of selectively binding to the analyte.
- a 40 th Example is the method of any one of the first-39 th Examples, wherein the coding tag is DNA molecule, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a combination thereof.
- the coding tag is DNA molecule, an RNA molecule, a BNA molecule, an XNA molecule, a LNA molecule, a PNA molecule, a ⁇ PNA molecule, or a combination thereof.
- Example 41 is the method of any one of the first-40 th Examples, wherein the coding tag comprises an encoder sequence.
- a 42 nd Example is the method of any one of the first-41 st Examples, wherein the coding tag further comprises a spacer, a binding cycle specific sequence, a unique molecular identifier, a universal priming site, or any combination thereof.
- Example 43 rd Example is the method of any one of the first-42 nd Examples, wherein the binding agent and the coding tag are joined by a linker.
- a 44 th Example is the method of any one of the first-42 nd Examples, wherein the binding agent and the coding tag are joined by a SpyTag-KTag/SpyLigase (where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties), a sortase, a SpyTag/SpyCatcher or SnoopTag/SnoopCatcher peptide-protein pair.
- a SpyTag-KTag/SpyLigase where two moieties to be joined have the SpyTag/KTag pair, and the SpyLigase joins SpyTag to KTag, thus joining the two moieties
- a sortase a SpyTag/SpyCatcher or SnoopTag/SnoopCatcher peptide-protein pair.
- Example is the method of any one of the first-44 th Examples, wherein transferring the information of the coding tag to the recording tag is mediated by a DNA ligase.
- a 46 th Example is the method of any one of the first-44 th Examples, wherein transferring the information of the coding tag to the recording tag is mediated by a DNA polymerase.
- Example 47 th Example is the method of any one of the first-44 th Examples, wherein transferring the information of the coding tag to the recording tag is mediated by chemical ligation.
- a 48 th Example is the method of any one of the first-47 th Examples, wherein analyzing the extended recording tag comprises a nucleic acid sequencing method.
- a 49 th Example is the method of the 48th Example, wherein the nucleic acid sequencing method is sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, or pyrosequencing.
- a 50 th Example is the method of the 48 th Example, wherein the nucleic acid sequencing method is single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy.
- a 51 st Example is the method of any one of the first-50 th Examples, wherein the extended recording tag is amplified prior to analysis.
- a 52 nd Example is the method of any one of the first-51 st Examples, wherein the order of coding tag information contained on the extended recording tag provides information regarding the order of binding by the binding agents to the analyte.
- a 53 rd Example is the method of any one of the first-52 nd Examples, wherein frequency of the coding tag information contained on the extended recording tag provides information regarding the frequency of binding by the binding agents to the analyte.
- a 54 th Example is the method of any one of the first-53 rd Examples, wherein a plurality of extended recording tags representing a plurality of analytes (e.g., molecules of the same analyte or of different analytes) are analyzed in parallel.
- a plurality of extended recording tags representing a plurality of analytes e.g., molecules of the same analyte or of different analytes
- a 55 th Example is the method of the 54 th Example, wherein the plurality of extended recording tags representing a plurality of analytes (e.g., molecules of the same analyte or of different analytes) are analyzed in a multiplexed assay.
- the plurality of extended recording tags representing a plurality of analytes e.g., molecules of the same analyte or of different analytes
- a 56 th Example is the method of any one of the first-55 th Examples, wherein the plurality of extended recording tags undergoes a target enrichment assay prior to analysis.
- Example is the method of any one of the first-56 th Examples, wherein the plurality of extended recording tags undergoes a subtraction assay prior to analysis.
- a 58 th Example is the method of any one of the first-57 th Examples, wherein the plurality of extended recording tags undergoes a normalization assay to reduce highly abundant species prior to analysis.
- Example is the method of any one of the first-58 th Examples, wherein the NTAA is removed by a modified aminopeptidase, a modified amino acid tRNA synthetase, mild Edman degradation, Edmanase enzyme, or anhydrous TFA.
- a 60 th Example is the method of any one of the first-59 th Examples, wherein at least one binding agent binds to a terminal amino acid residue.
- a 61 st Example is the method of any one of the first-60 th Examples, wherein at least one binding agent binds to a post-translationally modified amino acid.
- Example is a method for analyzing one or more peptides from a sample comprising a plurality of protein complexes, proteins, or polypeptides, the method comprising: (a) partitioning the plurality of protein complexes, proteins, or polypeptides within the sample into a plurality of compartments, wherein each compartment comprises a plurality of compartment tags optionally joined to a solid support, wherein the plurality of compartment tags are the same within an individual compartment and are different from the compartment tags of other compartments; (b) fragmenting the plurality of protein complexes, proteins, and/or polypeptides into a plurality of peptides; (c) contacting the plurality of peptides to the plurality of compartment tags under conditions sufficient to permit annealing or joining of the plurality of peptides with the plurality of compartment tags within the plurality of compartments, thereby generating a plurality of compartment tagged peptides; (d) collecting the compartment tagged peptides from the plurality of
- a 63 rd Example is the method of the 62 nd Example, wherein the compartment is a microfluidic droplet.
- a 64 th Example is the method of the 62 nd Example, wherein the compartment is a microwell.
- a 65 th Example is the method of the 62 nd Example, wherein the compartment is a separated region on a surface.
- a 66 th Example is the method of any one of the 62 nd -65 th Examples, wherein each compartment comprises on average a single cell.
- Example is a method for analyzing one or more peptides from a sample comprising a plurality of protein complexes, proteins, or polypeptides, the method comprising: (a) labeling of the plurality of protein complexes, proteins, or polypeptides with a plurality of universal DNA tags; (b) partitioning the plurality of labeled protein complexes, proteins, or polypeptides within the sample into a plurality of compartments, wherein each compartment comprises a plurality of compartment tags, wherein the plurality of compartment tags are the same within an individual compartment and are different from the compartment tags of other compartments; (c) contacting the plurality of protein complexes, proteins, or polypeptides to the plurality of compartment tags under conditions sufficient to permit annealing or joining of the plurality of protein complexes, proteins, or polypeptides with the plurality of compartment tags within the plurality of compartments, thereby generating a plurality of compartment tagged protein complexes, proteins or polypeptides; (a) labeling of the
- a 68 th Example is the method of any one of the 62 nd -67 th Examples, wherein compartment tag information is transferred to a recording tag associated with a peptide via primer extension or ligation.
- a 69 th Example is the method of any one of the 62 nd -68 th Examples, wherein the solid support comprises a bead.
- a 70 th Example is the method of the 69 th Example, wherein the bead is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- the bead is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- a 71 st Example is the method of any one of the 62nd-70 th Examples, wherein the compartment tag comprises a single stranded or double stranded nucleic acid molecule.
- a 72 nd Example is the method of any one of the 62 nd -71 st Examples, wherein the compartment tag comprises a barcode and optionally a UMI.
- a 73 rd Example is the method of the 72 nd Example, wherein the solid support is a bead and the compartment tag comprises a barcode, further wherein beads comprising the plurality of compartment tags joined thereto are formed by split-and-pool synthesis.
- a 74 th Example is the method of the 72 nd Example, wherein the solid support is a bead and the compartment tag comprises a barcode, further wherein beads comprising a plurality of compartment tags joined thereto are formed by individual synthesis or immobilization.
- a 75 th Example is the method of any one of the 62 nd -74 th Examples, wherein the compartment tag is a component within a recording tag, wherein the recording tag optionally further comprises a spacer, a unique molecular identifier, a universal priming site, or any combination thereof.
- a 76 th Example is the method of any one of the 62 nd -75 th Examples, wherein the compartment tags further comprise a functional moiety capable of reacting with an internal amino acid or N-terminal amino acid on the plurality of protein complexes, proteins, or polypeptides.
- a 77 th Example is the method of the 76 th Example, wherein the functional moiety is an NHS group.
- a 78 th Example is the method of the 76 th Example, wherein the functional moiety is an aldehyde group.
- Example is the method of any one of the 62 nd -78 th Examples, wherein the plurality of compartment tags is formed by: printing, spotting, ink-jetting the compartment tags into the compartment, or a combination thereof.
- Example 80 th Example is the method of any one of the 62 nd -79 th Examples, wherein the compartment tag further comprises a peptide.
- an 81 st Example is the method of the 80 th Example, wherein the compartment tag peptide comprises a protein ligase recognition sequence.
- an 82 nd Example is the method of the 81 st Example, wherein the protein ligase is butelase I or a homolog thereof.
- Example is the method of any one of the 62 nd -82 nd Examples, wherein the plurality of polypeptides is fragmented with a protease.
- an 84 th Example is the method of the 83 rd Example, wherein the protease is a metalloprotease.
- an 85 th Example is the method of the 84 th Example, wherein the activity of the metalloprotease is modulated by photo-activated release of metallic cations.
- Example is the method of any one of the 62 nd -85 th Examples, further comprising subtraction of one or more abundant proteins from the sample prior to partitioning the plurality of polypeptides into the plurality of compartments.
- Example is the method of any one of the 62 nd -86 th Examples, further comprising releasing the compartment tags from the solid support prior to joining of the plurality of peptides with the compartment tags.
- an 88 th Example is the method of the 62 nd Example, further comprising following step (d), joining the compartment tagged peptides to a solid support in association with recording tags.
- an 89 th Example is the method of the 88 th Example, further comprising transferring information of the compartment tag on the compartment tagged peptide to the associated recording tag.
- a 90 th Example is the method of the 89 th Example, further comprising removing the compartment tags from the compartment tagged peptides prior to step (e).
- Example is the method of any one of the 62 nd -90 th Examples, further comprising determining the identity of the single cell from which the analyzed peptide derived based on the analyzed peptide's compartment tag sequence.
- a 92 nd Example is the method of any one of the 62 nd -90 th Examples, further comprising determining the identity of the protein or protein complex from which the analyzed peptide derived based on the analyzed peptide's compartment tag sequence.
- Example is a method for analyzing a plurality of analytes (e.g., molecules of the same analyte or of different analytes), comprising the steps of: (a) providing a plurality of analytes and associated recording tags joined to a solid support; (b) contacting the plurality of analytes with a plurality of binding agents capable of binding to the plurality of analytes, wherein each binding agent comprises a coding tag with identifying information regarding the binding agent; (c) (i) transferring the information of the analyte associated recording tags to the coding tags of the binding agents that are bound to the analytes to generate extended coding tags; or (ii) transferring the information of analyte associated recording tags and coding tags of the binding agents that are bound to the analytes to a di-tag construct; (d) collecting the extended coding tags or di-tag constructs; (e) optionally repeating steps (b)-(d) for one or more
- Example 94 th Example is the method of the 93 rd Example, wherein the analyte is a protein.
- Example 95 th Example is the method of the 93 rd Example, wherein the analyte is a peptide.
- a 96 th Example is the method of the 95 th Example, wherein the peptide is obtained by fragmenting a protein from a biological sample.
- a 97 th Example is the method of any one of the 93 rd -96 th Examples, wherein the recording tag is a DNA molecule, an RNA molecule, a PNA molecule, a BNA molecule, an XNA, molecule, an LNA molecule, a ⁇ PNA molecule, or a combination thereof.
- the recording tag is a DNA molecule, an RNA molecule, a PNA molecule, a BNA molecule, an XNA, molecule, an LNA molecule, a ⁇ PNA molecule, or a combination thereof.
- a 98 th Example is the method of any one of the 93 rd -97 th Examples, wherein the recording tag comprises a unique molecular identifier (UMI).
- UMI unique molecular identifier
- Example is the method of Examples 93-98, wherein the recording tag comprises a compartment tag.
- Example is the method of any one of Examples 93-99, wherein the recording tag comprises a universal priming site.
- Example is the method of any one of Examples 93-100, wherein the recording tag comprises a spacer at its 3′-terminus.
- Example is the method of any one of Examples 93-101, wherein the 3′-terminus of the recording tag is blocked to prevent extension of the recording tag by a polymerase and the information of analyte associated recording tag and coding tag of the binding agent that is bound to the analyte is transferred to a di-tag construct.
- Example is the method of any one of Examples 93-102, wherein the coding tag comprises an encoder sequence.
- Example is the method of any one of Examples 93-103, wherein the coding tag comprises a UMI.
- Example is the method of any one of Examples 93-104, wherein the coding tag comprises a universal priming site.
- Example is the method of any one of Examples 93-105, wherein the coding tag comprises a spacer at its 3′-terminus.
- Example is the method of any one of Examples 93-106, wherein the coding tag comprises a binding cycle specific sequence.
- Example is the method of any one of Examples 93-107, wherein the binding agent and the coding tag are joined by a linker.
- Example is the method of any one of Examples 93-108, wherein transferring information of the recording tag to the coding tag is effected by primer extension.
- Example 110 is the method of any one of Examples 93-108, wherein transferring information of the recording tag to the coding tag is effected by ligation.
- Example is the method of any one of Examples 93-108, wherein the di-tag construct is generated by gap fill, primer extension, or both.
- Example is the method of any one of Examples 93-97, 107, 108, and 111, wherein the di-tag molecule comprises a universal priming site derived from the recording tag, a compartment tag derived from the recording tag, a unique molecular identifier derived from the recording tag, an optional spacer derived from the recording tag, an encoder sequence derived from the coding tag, a unique molecular identifier derived from the coding tag, an optional spacer derived from the coding tag, and a universal priming site derived from the coding tag.
- the di-tag molecule comprises a universal priming site derived from the recording tag, a compartment tag derived from the recording tag, a unique molecular identifier derived from the recording tag, an optional spacer derived from the recording tag, an encoder sequence derived from the coding tag, a unique molecular identifier derived from the coding tag, an optional spacer derived from the coding tag, and a universal priming site derived from the coding
- Example is the method of any one of Examples 93-112, wherein the analyte and the associated recording tag are covalently joined to the solid support.
- Example is the method of Example 113, wherein the solid support is a bead, a porous bead, a porous matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtitre well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle, or a microsphere.
- Example is the method of Example 114, wherein the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- Example is the method of any one of Examples 93-115, wherein the binding agent is a polypeptide or protein.
- Example is the method of Example 116, wherein the binding agent is a modified aminopeptidase, a modified amino acyl tRNA synthetase, a modified anticalin, or an antibody or binding fragment thereof.
- the binding agent is a modified aminopeptidase, a modified amino acyl tRNA synthetase, a modified anticalin, or an antibody or binding fragment thereof.
- Example is the method of any one of Example 95-117 wherein the binding agent binds to a single amino acid residue, a dipeptide, a tripeptide or a post-translational modification of the peptide.
- Example is the method of Example 118, wherein the binding agent binds to an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue.
- Example 120 is the method of Example 118, wherein the binding agent binds to an N-terminal peptide, a C-terminal peptide, or an internal peptide.
- Example is method of Example 119, wherein the binding agent binds to the N-terminal amino acid residue and the N-terminal amino acid residue is cleaved after each binding cycle.
- Example 122 nd Example is the method of Example 119, wherein the binding agent binds to the C-terminal amino acid residue and the C-terminal amino acid residue is cleaved after each binding cycle.
- Example 123 The method of Example 121, wherein the N-terminal amino acid residue is cleaved via Edman degradation.
- Example 124 The method of Example 93, wherein the binding agent is a site-specific covalent label of an amino acid or post-translational modification.
- Example 125 The method of any one of Examples 93-124, wherein following step (b), complexes comprising the analyte and associated binding agents are dissociated from the solid support and partitioned into an emulsion of droplets or microfluidic droplets.
- Example 126 The method of Example 125, wherein each microfluidic droplet, on average, comprises one complex comprising the analyte and the binding agents.
- Example 127 The method of Example 125 or 126, wherein the recording tag is amplified prior to generating an extended coding tag or di-tag construct.
- Example 128 The method of any one of Examples 125-127, wherein emulsion fusion PCR is used to transfer the recording tag information to the coding tag or to create a population of di-tag constructs.
- Example 129 The method of any one of Examples 93-128, wherein the collection of extended coding tags or di-tag constructs are amplified prior to analysis.
- Example 130 The method of any one of Examples 93-129, wherein analyzing the collection of extended coding tags or di-tag constructs comprises a nucleic acid sequencing method.
- Example 132 The method of Example 130, wherein the nucleic acid sequencing method is single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy.
- Example 133 The method of Example 130, wherein a partial composition of the analyte is determined by analysis of a plurality of extended coding tags or di-tag constructs using unique compartment tags and optionally UMIs.
- Example 134 The method of any one of Examples 1-133, wherein the analysis step is performed with a sequencing method having a per base error rate of >5%, >10%, >15%, >20%, >25%, or >30%.
- Example 135. The method of any one of Examples 1-134, wherein the identifying components of a coding tag, recording tag, or both comprise error correcting codes.
- Example 136 The method of Example 135, wherein the identifying components are selected from an encoder sequence, barcode, UMI, compartment tag, cycle specific sequence, or any combination thereof.
- Example 137 The method of Example 135 or 136, wherein the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- the error correcting code is selected from Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- Example 138 The method of any one of Examples 1-134, wherein the identifying components of a coding tag, recording tag, or both are capable of generating a unique current or ionic flux or optical signature, wherein the analysis step comprises detection of the unique current or ionic flux or optical signature in order to identify the identifying components.
- Example 139 The method of Example 138, wherein the identifying components are selected from an encoder sequence, barcode, UMI, compartment tag, cycle specific sequence, or any combination thereof.
- Example 140 A method for analyzing a plurality of analytes (e.g., molecules of the same analyte or of different analytes), comprising the steps of: (a) providing a plurality of analytes and associated recording tags joined to a solid support; (b) contacting the plurality of analytes with a plurality of binding agents capable of binding to cognate analytes, wherein each binding agent comprises a coding tag with identifying information regarding the binding agent; (c) transferring the information of a first coding tag of a first binding agent to a first recording tag associated with the first analyte to generate a first order extended recording tag, wherein the first binding agent binds to the first analyte; (d) contacting the plurality of analytes with the plurality of binding agents capable of binding to cognate analytes; (e) transferring the information of a second coding tag of a second binding agent to the first order extended recording tag to generate a second order extended recording tag, wherein
- Example 141 The method of Example 140, wherein a plurality of n th order extended recording tags that represent a plurality of analytes are generated and analyzed.
- Example 142 The method of Example 140 or 141, wherein the analyte is a protein.
- Example 143 The method of Example 142, wherein the analyte is a peptide.
- Example 144 The method of Example 143, wherein the peptide is obtained by fragmenting proteins from a biological sample.
- Example 145 The method of any one of Examples 140-144, wherein the plurality of analytes comprises analytes (e.g., macromolecules such as polypeptides, proteins, protein complexes) from multiple, pooled samples.
- analytes e.g., macromolecules such as polypeptides, proteins, protein complexes
- Example 146 The method of any one of Examples 140-145, wherein the recording tag is a DNA molecule, an RNA molecule, a PNA molecule, a BNA molecule, an XNA, molecule, an LNA molecule, a ⁇ PNA molecule, or a combination thereof.
- Example 147 The method of any one of Examples 140-146, wherein the recording tag comprises a unique molecular identifier (UMI).
- UMI unique molecular identifier
- Example 148 The method of Examples 140-147, wherein the recording tag comprises a compartment tag.
- Example 149 The method of any one of Examples 140-148, wherein the recording tag comprises a universal priming site.
- Example 150 The method of any one of Examples 140-149, wherein the recording tag comprises a spacer at its 3′-terminus.
- Example 151 The method of any one of Examples 140-150, wherein the coding tag comprises an encoder sequence.
- Example 152 The method of any one of Examples 140-151, wherein the coding tag comprises a UMI.
- Example 153 The method of any one of Examples 140-152, wherein the coding tag comprises a universal priming site.
- Example 155 The method of any one of Examples 140-154, wherein the coding tag comprises a binding cycle specific sequence.
- Example 156 The method of any one of Examples 140-155, wherein the coding tag comprises a unique molecular identifier.
- Example 157 The method of any one of Examples 140-156, wherein the binding agent and the coding tag are joined by a linker.
- Example 158 The method of any one of Examples 140-157, wherein transferring information of the recording tag to the coding tag is mediated by primer extension.
- Example 159 The method of any one of Examples 140-158, wherein transferring information of the recording tag to the coding tag is mediated by ligation.
- Example 160 The method of any one of Examples 140-159, wherein the plurality of analytes, the associated recording tags, or both are covalently joined to the solid support.
- Example 161 The method of any one of Examples 140-160, wherein the solid support is a bead, a porous bead, a porous matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtitre well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle, or a microsphere.
- the solid support is a bead, a porous bead, a porous matrix, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow through chip, a biochip including signal transducing electronics, a microtitre well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane,
- Example 162 The method of Example 161, wherein the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- the solid support is a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- Example 163 The method of any one of Examples 140-162, wherein the binding agent is a polypeptide or protein.
- Example 164 The method of Example 163, wherein the binding agent is a modified aminopeptidase, a modified amino acyl tRNA synthetase, a modified anticalin, or an antibody or binding fragment thereof.
- Example 165 The method of any one of Examples 142-164 wherein the binding agent binds to a single amino acid residue, a dipeptide, a tripeptide or a post-translational modification of the peptide.
- Example 166 The method of Example 165, wherein the binding agent binds to an N-terminal amino acid residue, a C-terminal amino acid residue, or an internal amino acid residue.
- Example 168 The method of any one of Examples 142-164, wherein the binding agent binds to a chemical label of a modified N-terminal amino acid residue, a modified C-terminal amino acid residue, or a modified internal amino acid residue.
- Example 169 The method of Example 166 or 168, wherein the binding agent binds to the N-terminal amino acid residue or the chemical label of the modified N-terminal amino acid residue, and the N-terminal amino acid residue is cleaved after each binding cycle.
- Example 170 The method of Example 166 or 168, wherein the binding agent binds to the C-terminal amino acid residue or the chemical label of the modified C-terminal amino acid residue, and the C-terminal amino acid residue is cleaved after each binding cycle.
- Example 171 The method of Example 169, wherein the N-terminal amino acid residue is cleaved via Edman degradation, Edmanase, a modified aminopeptidase, or a modified acylpeptide hydrolase.
- Example 173 The method of any one of Examples 140-172, wherein the plurality of n th order extended recording tags are amplified prior to analysis.
- Example 175. The method of Example 174, wherein a plurality of n th order extended recording tags representing a plurality of analytes are analyzed in parallel.
- Example 176 The method of Example 174 or 175, wherein the nucleic acid sequencing method is sequencing by synthesis, sequencing by ligation, sequencing by hybridization, polony sequencing, ion semiconductor sequencing, or pyrosequencing.
- Example 177 The method of Example 174 or 175, wherein the nucleic acid sequencing method is single molecule real-time sequencing, nanopore-based sequencing, or direct imaging of DNA using advanced microscopy.
- kit components any of the above-mentioned kit components, and any molecule, molecular complex or conjugate, reagent (e.g., chemical or biological reagents), agent, structure (e.g., support, surface, particle, or bead), reaction intermediate, reaction product, binding complex, or any other article of manufacture disclosed and/or used in the exemplary kits and methods, may be provided separately or in any suitable combination in order to form a kit.
- the kit may optionally comprise instruction for use, for example, in highly-parallel, high throughput digital analysis (such as macromolecule analysis), particularly polypeptide analysis.
- a macromolecule (e.g., protein, polypeptide, peptide) analyzed according the kits and methods disclosed herein may be obtained from a suitable source or sample, including but not limited to: biological samples, such as cells (both primary cells and cultured cell lines), cell lysates or extracts, cell organelles or vesicles, including exosomes, tissues and tissue extracts; biopsy; fecal matter; bodily fluids (such as blood, whole blood, serum, plasma, urine, lymph, bile, cerebrospinal fluid, interstitial fluid, aqueous or vitreous humor, colostrum, sputum, amniotic fluid, saliva, anal and vaginal secretions, perspiration and semen, a transudate, an exudate (e.g., fluid obtained from an abscess or any other site of infection or inflammation) or fluid obtained from a joint (normal joint or a joint affected by disease such as rheumatoid arthritis, osteoarthritis, gout or s
- a macromolecule is a protein, a protein complex, a polypeptide, or peptide.
- Amino acid sequence information and post-translational modifications of a peptide, polypeptide, or protein are transduced into a nucleic acid encoded library that can be analyzed via next generation sequencing methods.
- a peptide may comprise L-amino acids, D-amino acids, or both.
- a peptide, polypeptide, protein, or protein complex may comprise a standard, naturally occurring amino acid, a modified amino acid (e.g., post-translational modification), an amino acid analog, an amino acid mimetic, or any combination thereof.
- a peptide, polypeptide, or protein is naturally occurring, synthetically produced, or recombinantly expressed.
- a peptide, polypeptide, protein, or protein complex may further comprise a post-translational modification.
- Standard, naturally occurring amino acids include Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr).
- Non-standard amino acids include selenocysteine, pyrrolysine, and N-formylmethionine, ⁇ -amino acids, Homo-amino acids, Proline and Pyruvic acid derivatives, 3-substituted Alanine derivatives, Glycine derivatives, Ring-substituted Phenylalanine and Tyrosine Derivatives, Linear core amino acids, and N-methyl amino acids.
- a post-translational modification (PTM) of a peptide, polypeptide, or protein may be a covalent modification or enzymatic modification.
- post-translation modifications include, but are not limited to, acylation, acetylation, alkylation (including methylation), biotinylation, butyrylation, carbamylation, carbonylation, deamidation, deiminiation, diphthamide formation, disulfide bridge formation, eliminylation, flavin attachment, formylation, gamma-carboxylation, glutamylation, glycylation, glycosylation (e.g., N-linked, O-linked, C-linked, phosphoglycosylation), glypiation, heme C attachment, hydroxylation, hypusine formation, iodination, isoprenylation, lipidation, lipoylation, malonylation, methylation, myristolylation, oxidation, palmitoylation, pegylation, phosphop
- a post-translational modification includes modifications of the amino terminus and/or the carboxyl terminus of a peptide, polypeptide, or protein.
- Modifications of the terminal amino group include, but are not limited to, des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
- Modifications of the terminal carboxy group include, but are not limited to, amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications (e.g., wherein lower alkyl is C1-C4 alkyl).
- a post-translational modification also includes modifications, such as but not limited to those described above, of amino acids falling between the amino and carboxy termini of a peptide, polypeptide, or protein.
- Post-translational modification can regulate a protein's “biology” within a cell, e.g., its activity, structure, stability, or localization. Phosphorylation is the most common post-translational modification and plays an important role in regulation of protein, particularly in cell signaling (Prabakaran et al., 2012, Wiley Interdiscip Rev Syst Biol Med 4: 565-583).
- the addition of sugars to proteins, such as glycosylation has been shown to promote protein folding, improve stability, and modify regulatory function. The attachment of lipids to proteins enables targeting to the cell membrane.
- a post-translational modification can also include peptide, polypeptide, or protein modifications to include one or more detectable labels.
- a peptide, polypeptide, or protein can be fragmented.
- the fragmented peptide can be obtained by fragmenting a protein from a sample, such as a biological sample.
- the peptide, polypeptide, or protein can be fragmented by any means known in the art, including fragmentation by a protease or endopeptidase.
- fragmentation of a peptide, polypeptide, or protein is targeted by use of a specific protease or endopeptidase.
- a specific protease or endopeptidase binds and cleaves at a specific consensus sequence (e.g., TEV protease which is specific for ENLYFQ ⁇ S consensus sequence).
- fragmentation of a peptide, polypeptide, or protein is non-targeted or random by use of a non-specific protease or endopeptidase.
- a non-specific protease may bind and cleave at a specific amino acid residue rather than a consensus sequence (e.g., proteinase K is a non-specific serine protease).
- Proteinases and endopeptidases are well known in the art, and examples of such that can be used to cleave a protein or polypeptide into smaller peptide fragments include proteinase K, trypsin, chymotrypsin, pepsin, thermolysin, thrombin, Factor Xa, furin, endopeptidase, papain, pepsin, subtilisin, elastase, enterokinase, GenenaseTM I, Endoproteinase LysC, Endoproteinase AspN, Endoproteinase GluC, etc. (Granvogl et al., 2007, Anal Bioanal Chem 389: 991-1002).
- a peptide, polypeptide, or protein is fragmented by proteinase K, or optionally, a thermolabile version of proteinase K to enable rapid inactivation.
- Proteinase K is quite stable in denaturing reagents, such as urea and SDS, enabling digestion of completely denatured proteins. Protein and polypeptide fragmentation into peptides can be performed before or after attachment of a DNA tag or DNA recording tag.
- Chemical reagents can also be used to digest proteins into peptide fragments.
- a chemical reagent may cleave at a specific amino acid residue (e.g., cyanogen bromide hydrolyzes peptide bonds at the C-terminus of methionine residues).
- Chemical reagents for fragmenting polypeptides or proteins into smaller peptides include cyanogen bromide (CNBr), hydroxylamine, hydrazine, formic acid, BNPS-skatole [2-(2-nitrophenylsulfenyl)-3-methylindole], iodosobenzoic acid, ⁇ NTCB+Ni (2-nitro-5-thiocyanobenzoic acid), etc.
- the resulting peptide fragments are approximately the same desired length, e.g., from about 10 amino acids to about 70 amino acids, from about 10 amino acids to about 60 amino acids, from about 10 amino acids to about 50 amino acids, about 10 to about 40 amino acids, from about 10 to about 30 amino acids, from about 20 amino acids to about 70 amino acids, from about 20 amino acids to about 60 amino acids, from about 20 amino acids to about 50 amino acids, about 20 to about 40 amino acids, from about 20 to about 30 amino acids, from about 30 amino acids to about 70 amino acids, from about 30 amino acids to about 60 amino acids, from about 30 amino acids to about 50 amino acids, or from about 30 amino acids to about 40 amino acids.
- a cleavage reaction may be monitored, for example in real time, by spiking the protein or polypeptide sample with a short test FRET (fluorescence resonance energy transfer) peptide comprising a peptide sequence containing a proteinase or endopeptidase cleavage site.
- FRET fluorescence resonance energy transfer
- a fluorescent group and a quencher group are attached to either end of the peptide sequence containing the cleavage site, and fluorescence resonance energy transfer between the quencher and the fluorophore leads to low fluorescence.
- the quencher and fluorophore are separated giving a large increase in fluorescence.
- a cleavage reaction can be stopped when a certain fluorescence intensity is achieved, allowing a reproducible cleavage end point to be achieved.
- a sample of macromolecules can undergo protein fractionation methods prior to attachment to a solid support, where proteins or peptides are separated by one or more properties such as cellular location, molecular weight, hydrophobicity, or isoelectric point, or protein enrichment methods.
- protein enrichment methods may be used to select for a specific protein or peptide (see, e.g., Whiteaker et al., 2007, Anal. Biochem. 362:44-54, incorporated by reference in its entirety) or to select for a particular post translational modification (see, e.g., Huang et al., 2014. J. Chromatogr.
- a particular class or classes of proteins such as immunoglobulins, or immunoglobulin (Ig) isotypes such as IgG, can be affinity enriched or selected for analysis.
- immunoglobulin molecules analysis of the sequence and abundance or frequency of hypervariable sequences involved in affinity binding are of particular interest, particularly as they vary in response to disease progression or correlate with healthy, immune, and/or or disease phenotypes.
- Overly abundant proteins can also be subtracted from the sample using standard immunoaffinity methods. Depletion of abundant proteins can be useful for plasma samples where over 80% of the protein constituent is albumin and immunoglobulins.
- Several commercial products are available for depletion of plasma samples of overly abundant proteins, such as PROTIA and PROT20 (Sigma-Aldrich).
- the macromolecule is comprised of a protein or polypeptide.
- the protein or polypeptide is labeled with DNA recording tags through standard amine coupling chemistries (see, e.g., FIGS. 2B, 2C, 28, 29, 31, 40 ).
- the ⁇ -amino group (e.g., of lysine residues) and the N-terminal amino group are particularly susceptible to labeling with amine-reactive coupling agents, depending on the pH of the reaction (Mendoza and Vachet 2009).
- the recording tag is comprised of a reactive moiety (e.g., for conjugation to a solid surface, a multifunctional linker, or a macromolecule), a linker, a universal priming sequence, a barcode (e.g., compartment tag, partition barcode, sample barcode, fraction barcode, or any combination thereof), an optional UMI, and a spacer (Sp) sequence for facilitating information transfer to/from a coding tag.
- a reactive moiety e.g., for conjugation to a solid surface, a multifunctional linker, or a macromolecule
- a linker e.g., a universal priming sequence
- a barcode e.g., compartment tag, partition barcode, sample barcode, fraction barcode, or any combination thereof
- UMI optional UMI
- Sp spacer
- the protein can be first labeled with a universal DNA tag, and the barcode-Sp sequence (representing a sample, a compartment, a physical location on a slide, etc.) are attached to the protein later through and enzymatic or chemical coupling step (see, e.g., FIGS. 20, 30, 31, 40 ).
- a universal DNA tag comprises a short sequence of nucleotides that are used to label a protein or polypeptide macromolecule and can be used as point of attachment for a barcode (e.g., compartment tag, recording tag, etc.).
- a recording tag may comprise at its terminus a sequence complementary to the universal DNA tag.
- a universal DNA tag is a universal priming sequence.
- the annealed universal DNA tag may be extended via primer extension, transferring the recording tag information to the DNA tagged protein.
- the protein is labeled with a universal DNA tag prior to proteinase digestion into peptides.
- the universal DNA tags on the labeled peptides from the digest can then be converted into an informative and effective recording tag.
- a protein macromolecule can be immobilized to a solid support by an affinity capture reagent (and optionally covalently crosslinked), wherein the recording tag is associated with the affinity capture reagent directly, or alternatively, the protein can be directly immobilized to the solid support with a recording tag (see, e.g., FIG. 2C ).
- Macromolecules of the present disclosure are joined to a surface of a solid support (also referred to as “substrate surface”).
- the solid support can be any porous or non-porous support surface including, but not limited to, a bead, a microbead, an array, a glass surface, a silicon surface, a plastic surface, a filter, a membrane, nylon, a silicon wafer chip, a flow cell, a flow through chip, a biochip including signal transducing electronics, a microtiter well, an ELISA plate, a spinning interferometry disc, a nitrocellulose membrane, a nitrocellulose-based polymer surface, a nanoparticle, or a microsphere.
- Materials for a solid support include but are not limited to acrylamide, agarose, cellulose, nitrocellulose, glass, gold, quartz, polystyrene, polyethylene vinyl acetate, polypropylene, polymethacrylate, polyethylene, polyethylene oxide, polysilicates, polycarbonates, Teflon, fluorocarbons, nylon, silicon rubber, polyanhydrides, polyglycolic acid, polyactic acid, polyorthoesters, functionalized silane, polypropylfumerate, collagen, glycosaminoglycans, polyamino acids, or any combination thereof.
- Solid supports further include thin film, membrane, bottles, dishes, fibers, woven fibers, shaped polymers such as tubes, particles, beads, microparticles, or any combination thereof.
- the bead can include, but is not limited to, a polystyrene bead, a polymer bead, an agarose bead, an acrylamide bead, a solid core bead, a porous bead, a paramagnetic bead, glass bead, or a controlled pore bead.
- a solid support is a flow cell.
- Flow cell configurations may vary among different next generation sequencing platforms.
- the Illumina flow cell is a planar optically transparent surface similar to a microscope slide, which contains a lawn of oligonucleotide anchors bound to its surface.
- Template DNA comprise adapters ligated to the ends that are complimentary to oligonucleotides on the flow cell surface.
- Adapted single-stranded DNAs are bound to the flow cell and amplified by solid-phase “bridge” PCR prior to sequencing.
- the 454 flow cell (454 Life Sciences) supports a “picotiter” plate, a fiber optic slide with about 1.6 million 75-picoliter wells.
- Each individual molecule of sheared template DNA is captured on a separate bead, and each bead is compartmentalized in a private droplet of aqueous PCR reaction mixture within an oil emulsion.
- Template is clonally amplified on the bead surface by PCR, and the template-loaded beads are then distributed into the wells of the picotiter plate for the sequencing reaction, ideally with one or fewer beads per well.
- a flow cell may also be a simple filter frit, such as a TWISTTM DNA synthesis column (Glen Research).
- a solid support is a bead, which may refer to an individual bead or a plurality of beads.
- the bead is compatible with a selected next generation sequencing platform that will be used for downstream analysis (e.g., SOLiD or 454).
- a solid support is an agarose bead, a paramagnetic bead, a polystyrene bead, a polymer bead, an acrylamide bead, a solid core bead, a porous bead, a glass bead, or a controlled pore bead.
- a bead may be coated with a binding functionality (e.g., amine group, affinity ligand such as streptavidin for binding to biotin labeled macromolecule, antibody) to facilitate binding to a macromolecule.
- a binding functionality e.g., amine group, affinity ligand such as streptavidin for binding to biotin labeled macromolecule, antibody
- Proteins, polypeptides, or peptides can be joined to the solid support, directly or indirectly, by any means known in the art, including covalent and non-covalent interactions, or any combination thereof (see, e.g., Chan et al., 2007, PLoS One 2:e1164; Cazalis et al., Bioconj. Chem. 15:1005-1009; Soellner et al., 2003, J. Am. Chem. Soc. 125:11790-11791; Sun et al., 2006, Bioconjug. Chem. 17-52-57; Decreau et al., 2007, J. Org. Chem. 72:2794-2802; Camarero et al., 2004, J.
- the peptide may be joined to the solid support by a ligation reaction.
- the solid support can include an agent or coating to facilitate joining, either direct or indirectly, the peptide to the solid support.
- agent Any suitable molecule or materials may be employed for this purpose, including proteins, nucleic acids, carbohydrates and small molecules.
- the agent is an affinity molecule.
- the agent is an azide group, which group can react with an alkynyl group in another molecule to facilitate association or binding between the solid support and the other molecule.
- Proteins, polypeptides, or peptides can be joined to the solid support using methods referred to as “click chemistry.” For this purpose any reaction which is rapid and substantially irreversible can be used to attach proteins, polypeptides, or peptides to the solid support.
- Exemplary reactions include the copper catalyzed reaction of an azide and alkyne to form a triazole (Huisgen 1, 3-dipolar cycloaddition), strain-promoted azide alkyne cycloaddition (SPAAC), reaction of a diene and dienophile (Diels-Alder), strain-promoted alkyne-nitrone cycloaddition, reaction of a strained alkene with an azide, tetrazine or tetrazole, alkene and azide [3+2] cycloaddition, alkene and tetrazine inverse electron demand Diels-Alder (iEDDA) reaction (e.g., m-tetrazine (mTet) and trans-cyclooctene (TCO)), alkene and tetrazole photoreaction, Staudinger ligation of azides and phosphines, and various displacement reactions, such as displacement
- the macromolecule and solid support are joined by a functional group capable of formation by reaction of two complementary reactive groups, for example a functional group which is the product of one of the foregoing “click” reactions.
- functional group can be formed by reaction of an aldehyde, oxime, hydrazone, hydrazide, alkyne, amine, azide, acylazide, acylhalide, nitrile, nitrone, sulfhydryl, disulfide, sulfonyl halide, isothiocyanate, imidoester, activated ester (e.g., N-hydroxysuccinimide ester, pentynoic acid STP ester), ketone, ⁇ , ⁇ -unsaturated carbonyl, alkene, maleimide, ⁇ -haloimide, epoxide, aziridine, tetrazine, tetrazole, phosphine, biotin or
- the functional group comprises an alkene, ester, amide, thioester, disulfide, carbocyclic, heterocyclic or heteroaryl group. In further embodiments, the functional group comprises an alkene, ester, amide, thioester, thiourea, disulfide, carbocyclic, heterocyclic or heteroaryl group. In other embodiments, the functional group comprises an amide or thiourea. In some more specific embodiments, functional group is a triazolyl functional group, an amide, or thiourea functional group.
- iEDDA click chemistry is used for immobilizing macromolecules (e.g., proteins, polypeptides, peptides) to a solid support since it is rapid and delivers high yields at low input concentrations.
- macromolecules e.g., proteins, polypeptides, peptides
- m-tetrazine rather than tetrazine is used in an iEDDA click chemistry reaction, as m-tetrazine has improved bond stability.
- the substrate surface is functionalized with TCO, and the recording tag-labeled protein, polypeptide, peptide is immobilized to the TCO coated substrate surface via an attached m-tetrazine moiety (see, e.g., FIG. 34 ).
- Proteins, polypeptides, or peptides can be immobilized to a surface of a solid support by its C-terminus, N-terminus, or an internal amino acid, for example, via an amine, carboxyl, or sulfydryl group.
- Standard activated supports used in coupling to amine groups include CNBr-activated, NHS-activated, aldehyde-activated, azlactone-activated, and CDI-activated supports.
- Standard activated supports used in carboxyl coupling include carbodiimide-activated carboxyl moieties coupling to amine supports. Cysteine coupling can employ maleimide, idoacetyl, and pyridyl disulfide activated supports.
- An alternative mode of peptide carboxy terminal immobilization uses anhydrotrypsin, a catalytically inert derivative of trypsin that binds peptides containing lysine or arginine residues at their C-termini without cleaving them.
- a protein, polypeptide, or peptide is immobilized to a solid support via covalent attachment of a solid surface bound linker to a lysine group of the protein, polypeptide, or peptide.
- Recording tags can be attached to the protein, polypeptide, or peptides pre- or post-immobilization to the solid support.
- proteins, polypeptides, or peptides can be first labeled with recording tags and then immobilized to a solid surface via a recording tag comprising at two functional moieties for coupling (see, e.g., FIG. 28 ).
- One functional moiety of the recording tag couples to the protein, and the other functional moiety immobilizes the recording tag-labeled protein to a solid support.
- proteins, polypeptides, or peptides are immobilized to a solid support prior to labeling of the proteins, polypeptides or peptides with recording tags.
- proteins can first be derivitized with reactive groups such as click chemistry moieties. The activated protein molecules can then be attached to a suitable solid support and then labeled with recording tags using the complementary click chemistry moiety.
- proteins derivatized with alkyne and mTet moieties may be immobilized to beads derivatized with azide and TCO and attached to recording tags labeled with azide and TCO.
- macromolecules e.g., proteins, polypeptides, or peptides
- methods provided herein for attaching macromolecules (e.g., proteins, polypeptides, or peptides) to the solid support may also be used to attach recording tags to the solid support or attach recording tags to macromolecules (e.g., proteins polypeptides, or peptides).
- the surface of a solid support is passivated (blocked) to minimize non-specific absorption to binding agents.
- a “passivated” surface refers to a surface that has been treated with outer layer of material to minimize non-specific binding of a binding agent.
- Methods of passivating surfaces include standard methods from the fluorescent single molecule analysis literature, including passivating surfaces with polymer like polyethylene glycol (PEG) (Pan et al., 2015, Phys. Biol. 12:045006), polysiloxane (e.g., Pluronic F-127), star polymers (e.g., star PEG) (Groll et al., 2010, Methods Enzymol.
- density of proteins, polypeptide, or peptides can be titrated on the surface or within the volume of a solid substrate by spiking a competitor or “dummy” reactive molecule when immobilizing the proteins, polypeptides or peptides to the solid substrate (see, e.g., FIG. 36A ).
- the macromolecules can be spaced appropriately to reduce the occurrence of or prevent a cross-binding or inter-molecular event, e.g., where a binding agent binds to a first macromolecule and its coding tag information is transferred to a recording tag associated with a neighboring macromolecule rather than the recording tag associated with the first macromolecule.
- a binding agent binds to a first macromolecule and its coding tag information is transferred to a recording tag associated with a neighboring macromolecule rather than the recording tag associated with the first macromolecule.
- the density of functional coupling groups e.g., TCO
- TCO functional coupling groups
- multiple macromolecules are spaced apart on the surface or within the volume (e.g., porous supports) of a solid support at a distance of about 50 nm to about 500 nm, or about 50 nm to about 400 nm, or about 50 nm to about 300 nm, or about 50 nm to about 200 nm, or about 50 nm to about 100 nm.
- multiple macromolecules are spaced apart on the surface of a solid support with an average distance of at least 50 nm, at least 60 nm, at least 70 nm, at least 80 nm, at least 90 nm, at least 100 nm, at least 150 nm, at least 200 nm, at least 250 nm, at least 300 nm, at least 350 nm, at least 400 nm, at least 450 nm, or at least 500 nm. In some embodiments, multiple macromolecules are spaced apart on the surface of a solid support with an average distance of at least 50 nm.
- macromolecules are spaced apart on the surface or within the volume of a solid support such that, empirically, the relative frequency of inter- to intra-molecular events is ⁇ 1:10; ⁇ 1:100; ⁇ 1:1,000; or ⁇ 1:10,000.
- a suitable spacing frequency can be determined empirically using a functional assay (see, Example 23), and can be accomplished by dilution and/or by spiking a “dummy” spacer molecule that competes for attachments sites on the substrate surface.
- PEG-5000 (MW ⁇ 5000) is used to block the interstitial space between peptides on the substrate surface (e.g., bead surface).
- the peptide is coupled to a functional moiety that is also attached to a PEG-5000 molecule.
- this is accomplished by coupling a mixture of NHS-PEG-5000-TCO+NHS-PEG-5000-Methyl to amine-derivitized beads (see, e.g., FIG. 34 ).
- TCO stoichiometric ratio between the two PEGs
- the methyl is titrated to generate an appropriate density of functional coupling moieties (TCO groups) on the substrate surface; the methyl-PEG is inert to coupling.
- the effective spacing between TCO groups can be calculated by measuring the density of TCO groups on the surface.
- the mean spacing between coupling moieties (e.g., TCO) on the solid surface is at least 50 nm, at least 100 nm, at least 250 nm, or at least 500 nm.
- a reactive anhydride e.g., acetic or succinic anhydride
- the analyte molecules and/or the recording tags are immobilized on a substrate or support at a density such that the interaction between (i) a coding agent bound to a first analyte (particularly, the coding tag in that bound coding agent), and (ii) a second analyte and/or its recording tag, is reduced, minimized, or completely eliminated. Therefore, false positive assay signals resulting from “intermolecular” engagement can be reduced, minimized, or eliminated.
- the density of the analyte molecules and/or the recording tags on a substrate is determined for each type of analyte. For example, the longer a denatured polypeptide chain is, the lower the density should be in order to prevent “intermolecular” interactions. In certain aspects, increasing the spacing between the analyte molecules and/or the recording tags (i.e., lowering the density) increases the signal to background ratio of the presently disclosed assays.
- the analyte molecules and/or the recording tags are deposited or immobilized on a substrate at an average density of about 0.0001 molecule/ ⁇ m 2 , 0.001 molecule/ ⁇ m 2 , 0.01 molecule/ ⁇ m 2 , 0.1 molecule/ ⁇ m 2 , 1 molecule/ ⁇ m 2 , about 2 molecules/ ⁇ m 2 , about 3 molecules/ ⁇ m 2 , about 4 molecules/ ⁇ m 2 , about 5 molecules/ ⁇ m 2 , about 6 molecules/ ⁇ m 2 , about 7 molecules/ ⁇ m 2 , about 8 molecules/ ⁇ m 2 , about 9 molecules/ ⁇ m 2 , or about 10 molecules/ ⁇ m 2 .
- the analyte molecules and/or the recording tags are deposited or immobilized at an average density of about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 65, about 70, about 75, about 80, about 85, about 90, about 95, about 100, about 105, about 110, about 115, about 120, about 125, about 130, about 135, about 140, about 145, about 150, about 155, about 160, about 165, about 170, about 175, about 180, about 185, about 190, about 195, about 200, or about 200 molecules/ ⁇ m 2 on a substrate.
- the analyte molecules and/or the recording tags are deposited or immobilized at an average density of about 1 molecule/mm 2 , about 10 molecules/mm 2 , about 50 molecules/mm2 about 100 molecules/mm 2 , about 150 molecules/mm 2 , about 200 molecules/mm 2 , about 250 molecules/mm 2 , about 300 molecules/mm 2 , about 350 molecules/mm 2 , 400 molecules/mm 2 , about 450 molecules/mm 2 , about 500 molecules/mm 2 , about 550 molecules/mm 2 , about 600 molecules/mm 2 , about 650 molecules/mm 2 , about 700 molecules/mm 2 , about 750 molecules/mm 2 , about 800 molecules/mm 2 , about 850 molecules/mm 2 , about 900 molecules/mm 2 , about 950 molecules/mm 2 , or about 1000 molecules/mm 2 .
- the analyte molecules and/or the recording tags are deposited or immobilized on a substrate at an average density between about 1 ⁇ 10 3 and about 0.5 ⁇ 10 4 molecules/mm 2 , between about 0.5 ⁇ 10 4 and about 1 ⁇ 10 4 molecules/mm 2 , between about 1 ⁇ 10 4 and about 0.5 ⁇ 10 5 molecules/mm 2 , between about 0.5 ⁇ 10 5 and about 1 ⁇ 10 5 molecules/mm 2 , between about 1 ⁇ 10 5 and about 0.5 ⁇ 10 6 molecules/mm 2 , or between about 0.5 ⁇ 10 6 and about 1 ⁇ 10 6 molecules/mm 2 .
- the average density of the analyte molecules and/or the recording tags deposited or immobilized on a substrate can be, for example, between about 1 molecule/cm 2 and about 5 molecules/cm 2 , between about 5 and about 10 molecules/cm 2 , between about 10 and about 50 molecules/cm 2 , between about 50 and about 100 molecules/cm 2 , between about 100 and about 0.5 ⁇ 10 3 molecules/cm 2 , between about 0.5 ⁇ 10 3 and about 1 ⁇ 10 3 molecules/cm 2 , 1 ⁇ 10 3 and about 0.5 ⁇ 10 4 molecules/cm 2 , between about 0.5 ⁇ 10 4 and about 1 ⁇ 10 4 molecules/cm 2 , between about 1 ⁇ 10 4 and about 0.5 ⁇ 10 5 molecules/cm 2 , between about 0.5 ⁇ 10 5 and about 1 ⁇ 10 5 molecules/cm 2 , between about 1 ⁇ 10 5 and about 0.5 ⁇ 10 6 molecules/cm 2 , or between about 0.5 ⁇ 10 6 and about 1 ⁇ 10 6 molecules/cm 2 .
- the concentration of the binding agents in a solution is controlled to reduce background and/or false positive results of the assay.
- the concentration of a binding agent is about 0.0001 nM, about 0.001 nM, about 0.01 nM, about 0.1 nM, about 1 nM, about 2 nM, about 5 nM, about 10 nM, about 20 nM, about 50 nM, about 100 nM, about 200 nM, about 500 nM, or about 1000 nM.
- the concentration of a soluble conjugate used in the assay is between about 0.0001 nM and about 0.001 nM, between about 0.001 nM and about 0.01 nM, between about 0.01 nM and about 0.1 nM, between about 0.1 nM and about 1 nM, between about 1 nM and about 2 nM, between about 2 nM and about 5 nM, between about 5 nM and about 10 nM, between about 10 nM and about 20 nM, between about 20 nM and about 50 nM, between about 50 nM and about 100 nM, between about 100 nM and about 200 nM, between about 200 nM and about 500 nM, between about 500 nM and about 1000 nM, or more than about 1000 nM.
- the ratio between the soluble binding agent molecules and the immobilized analyte molecules and/or the recording tags is about 0.00001:1, about 0.0001:1, about 0.001:1, about 0.01:1, about 0.1:1, about 1:1, about 2:1, about 5:1, about 10:1, about 15:1, about 20:1, about 25:1, about 30:1, about 35:1, about 40:1, about 45:1, about 50:1, about 55:1, about 60:1, about 65:1, about 70:1, about 75:1, about 80:1, about 85:1, about 90:1, about 95:1, about 100:1, about 10 4 :1, about 10 5 :1, about 10 6 :1, or higher, or any ratio in between the above listed ratios.
- Higher ratios between the soluble binding agent molecules and the immobilized analyte molecules and/or the recording tags can be used to drive the binding and/or the coding tag/recoding tag information transfer to completion. This may be particularly useful for detecting and/or analyzing low abundance protein analytes in a sample.
- At least one recording tag is associated or co-localized directly or indirectly with the macromolecule and joined to the solid support (see, e.g., FIG. 5 ).
- a recording tag may comprise DNA, RNA, PNA, ⁇ PNA, GNA, BNA, XNA, TNA, polynucleotide analogs, or a combination thereof.
- a recording tag may be single stranded, or partially or completely double stranded.
- a recording tag may have a blunt end or overhanging end.
- identifying information of the binding agent's coding tag is transferred to the recording tag to generate an extended recording tag. Further extensions to the extended recording tag can be made in subsequent binding cycles.
- a recording tag can be joined to the solid support, directly or indirectly (e.g., via a linker), by any means known in the art, including covalent and non-covalent interactions, or any combination thereof.
- the recording tag may be joined to the solid support by a ligation reaction.
- the solid support can include an agent or coating to facilitate joining, either direct or indirectly, of the recording tag, to the solid support.
- the co-localization of a macromolecule (e.g., peptide) and associated recording tag is achieved by conjugating macromolecule and recording tag to a bifunctional linker attached directly to the solid support surface Steinberg et al. (2004, Biopolymers 73:597-605).
- a trifunctional moiety is used to derivitize the solid support (e.g., beads), and the resulting bifunctional moiety is coupled to both the macromolecule and recording tag.
- Methods and reagents such as those described for attachment of macromolecules and solid supports, may also be used for attachment of recording tags.
- a single recording tag is attached to a macromolecule (e.g., peptide), for example via the attachment to a de-blocked N- or C-terminal amino acid.
- multiple recording tags are attached to the macromolecule (e.g., protein, polypeptide, or peptide), for example to the lysine residues or peptide backbone.
- a macromolecule (e.g., protein or polypeptide) labeled with multiple recording tags is fragmented or digested into smaller peptides, with each peptide labeled on average with one recording tag.
- a recording tag comprises an optional, unique molecular identifier (UMI), which provides a unique identifier tag for each macromolecule (e.g., protein, polypeptide, peptide) to which the UMI is associated with.
- UMI can be about 3 to about 40 bases, about 3 to about 30 bases, about 3 to about 20 bases, or about 3 to about 10 bases, or about 3 to about 8 bases.
- a UMI is about 3 bases, 4 bases, 5 bases, 6 bases, 7 bases, 8 bases, 9 bases, 10 bases, 11 bases, 12 bases, 13 bases, 14 bases, 15 bases, 16 bases, 17 bases, 18 bases, 19 bases, 20 bases, 25 bases, 30 bases, 35 bases, or 40 bases in length.
- a UMI can be used to de-convolute sequencing data from a plurality of extended recording tags to identify sequence reads from individual macromolecules.
- each macromolecule is associated with a single recording tag, with each recording tag comprising a unique UMI.
- multiple copies of a recording tag are associated with a single macromolecule, with each copy of the recording tag comprising the same UMI.
- a UMI has a different base sequence than the spacer or encoder sequences within the binding agents' coding tags to facilitate distinguishing these components during sequence analysis.
- a recording tag comprises a barcode, e.g., other than the UMI if present.
- a barcode is a nucleic acid molecule of about 3 to about 30 bases, about 3 to about 25 bases, about 3 to about 20 bases, about 3 to about 10 bases, about 3 to about 10 bases, about 3 to about 8 bases in length.
- a barcode is about 3 bases, 4 bases, 5 bases, 6 bases, 7 bases, 8 bases, 9 bases, 10 bases, 11 bases, 12 bases, 13 bases, 14 bases, 15 bases, 20 bases, 25 bases, or 30 bases in length.
- a barcode allows for multiplex sequencing of a plurality of samples or libraries.
- a barcode may be used to identify a partition, a fraction, a compartment, a sample, a spatial location, or library from which the macromolecule (e.g., peptide) derived. Barcodes can be used to de-convolute multiplexed sequence data and identify sequence reads from an individual sample or library. For example, a barcoded bead is useful for methods involving emulsions and partitioning of samples, e.g., for purposes of partitioning the proteome.
- a barcode can represent a compartment tag in which a compartment, such as a droplet, microwell, physical region on a solid support, etc. is assigned a unique barcode.
- the association of a compartment with a specific barcode can be achieved in any number of ways such as by encapsulating a single barcoded bead in a compartment, e.g., by direct merging or adding a barcoded droplet to a compartment, by directly printing or injecting a barcode reagents to a compartment, etc.
- the barcode reagents within a compartment are used to add compartment-specific barcodes to the macromolecule or fragments thereof within the compartment.
- the barcodes can be used to map analysed peptides back to their originating protein molecules in the compartment. This can greatly facilitate protein identification. Compartment barcodes can also be used to identify protein complexes.
- multiple compartments that represent a subset of a population of compartments may be assigned a unique barcode representing the subset.
- a barcode may be a sample identifying barcode.
- a sample barcode is useful in the multiplexed analysis of a set of samples in a single reaction vessel or immobilized to a single solid substrate or collection of solid substrates (e.g., a planar slide, population of beads contained in a single tube or vessel, etc.). Macromolecules from many different samples can be labeled with recording tags with sample-specific barcodes, and then all the samples pooled together prior to immobilization to a solid support, cyclic binding, and recording tag analysis. Alternatively, the samples can be kept separate until after creation of a DNA-encoded library, and sample barcodes attached during PCR amplification of the DNA-encoded library, and then mixed together prior to sequencing.
- This approach could be useful when assaying analytes (e.g., proteins) of different abundance classes.
- the sample can be split and barcoded, and one portion processed using binding agents to low abundance analytes, and the other portion processed using binding agents to higher abundance analytes.
- this approach helps to adjust the dynamic range of a particular protein analyte assay to lie within the “sweet spot” of standard expression levels of the protein analyte.
- peptides, polypeptides, or proteins from multiple different samples are labeled with recording tags containing sample-specific barcodes.
- the multi-sample barcoded peptides, polypeptides, or proteins can be mixed together prior to a cyclic binding reaction.
- RPPA digital reverse phase protein array
- a recording tag comprises a universal priming site, e.g., a forward or 5′ universal priming site.
- a universal priming site is a nucleic acid sequence that may be used for priming a library amplification reaction and/or for sequencing.
- a universal priming site may include, but is not limited to, a priming site for PCR amplification, flow cell adaptor sequences that anneal to complementary oligonucleotides on flow cell surfaces (e.g., Illumina next generation sequencing), a sequencing priming site, or a combination thereof.
- a universal priming site can be about 10 bases to about 60 bases.
- a universal priming site comprises an
- Illumina P5 primer (5′-AATGATACGGCGACCACCGA-3′ - SEQ ID NO: 133) or an Illumina P7 primer (5′-CAAGCAGAAGACGGCATACGAGAT - 3′ - SEQ ID NO: 134).
- a recording tag comprises a spacer at its terminus, e.g., 3′ end.
- a spacer sequence in the context of a recording tag includes a spacer sequence that is identical to the spacer sequence associated with its cognate binding agent, or a spacer sequence that is complementary to the spacer sequence associated with its cognate binding agent.
- the terminal, e.g., 3′, spacer on the recording tag permits transfer of identifying information of a cognate binding agent from its coding tag to the recording tag during the first binding cycle (e.g., via annealing of complementary spacer sequences for primer extension or sticky end ligation).
- the spacer sequence is about 1-20 bases in length, about 2-12 bases in length, or 5-10 bases in length.
- the length of the spacer may depend on factors such as the temperature and reaction conditions of the primer extension reaction for transferring coding tag information to the recording tag.
- the spacer sequence in the recording is designed to have minimal complementarity to other regions in the recording tag; likewise the spacer sequence in the coding tag should have minimal complementarity to other regions in the coding tag.
- the spacer sequence of the recording tags and coding tags should have minimal sequence complementarity to components such unique molecular identifiers, barcodes (e.g., compartment, partition, sample, spatial location), universal primer sequences, encoder sequences, cycle specific sequences, etc. present in the recording tags or coding tags.
- the recording tags associated with a library of macromolecules share a common spacer sequence.
- the recording tags associated with a library of macromolecules have binding cycle specific spacer sequences that are complementary to the binding cycle specific spacer sequences of their cognate binding agents, which can be useful when using non-concatenated extended recording tags (see, e.g., FIG. 10 ).
- the collection of extended recording tags can be concatenated after the fact (see, e.g., FIG. 10 ).
- the bead solid supports, each bead comprising on average one or fewer than one macromolecule per bead, each macromolecule having a collection of extended recording tags that are co-localized at the site of the macromolecule are placed in an emulsion.
- the emulsion is formed such that each droplet, on average, is occupied by at most 1 bead.
- An optional assembly PCR reaction is performed in-emulsion to amplify the extended recording tags co-localized with the macromolecule on the bead and assemble them in co-linear order by priming between the different cycle specific sequences on the separate extended recording tags (Xiong, Peng et al. 2008). Afterwards the emulsion is broken and the assembled extended recording tags are sequenced.
- the DNA recording tag is comprised of a universal priming sequence (U1), one or more barcode sequences (BCs), and a spacer sequence (Sp1) specific to the first binding cycle.
- binding agents employ DNA coding tags comprised of an Sp1 complementary spacer, an encoder barcode, and optional cycle barcode, and a second spacer element (Sp2).
- the utility of using at least two different spacer elements is that the first binding cycle selects one of potentially several DNA recording tags and a single DNA recording tag is extended resulting in a new Sp2 spacer element at the end of the extended DNA recording tag.
- binding agents contain just the Sp2′ spacer rather than Sp1′. In this way, only the single extended recording tag from the first cycle is extended in subsequent cycles.
- the second and subsequent cycles can employ binding agent specific spacers.
- a recording tag comprises from 5′ to 3′ direction: a universal forward (or 5′) priming sequence, a UMI, and a spacer sequence.
- a recording tag comprises from 5′ to 3′ direction: a universal forward (or 5′) priming sequence, an optional UMI, a barcode (e.g., sample barcode, partition barcode, compartment barcode, spatial barcode, or any combination thereof), and a spacer sequence.
- a recording tag comprises from 5′ to 3′ direction: a universal forward (or 5′) priming sequence, a barcode (e.g., sample barcode, partition barcode, compartment barcode, spatial barcode, or any combination thereof), an optional UMI, and a spacer sequence.
- a UMI may be constructed by “chemical ligating” together sets of short word sequences (4-15mers), which have been designed to be orthogonal to each other (Spiropulos and Heemstra 2012).
- a DNA template is used to direct the chemical ligation of the “word” polymers.
- the DNA template is constructed with hybridizing arms that enable assembly of a combinatorial template structure simply by mixing the sub-components together in solution (see, e.g., FIG. 12C ).
- the size of the word space can vary from 10's of words to 10,000's or more words.
- the words are chosen such that they differ from one another to not cross hybridize, yet possess relatively uniform hybridization conditions.
- the diversity of UMIs exceeds the number of molecules of macromolecules to which the UMIs are attached. In this way, the UMI uniquely identifies the macromolecule of interest.
- the use of combinatorial word UMI's facilitates readout on high error rate sequencers, (e.g. nanopore sequencers, nanogap tunneling sequencing, etc.) since single base resolution is not required to read words of multiple bases in length.
- Combinatorial word approaches can also be used to generate other identity-informative components of recording tags or coding tags, such as compartment tags, partition barcodes, spatial barcodes, sample barcodes, encoder sequences, cycle specific sequences, and barcodes.
- an extended recording tag, an extended coding tag, or a di-tag construct in any of the embodiments described herein is comprised of identifying components (e.g., UMI, encoder sequence, barcode, compartment tag, cycle specific sequence, etc.) that are error correcting codes.
- the error correcting code is selected from: Hamming code, Lee distance code, asymmetric Lee distance code, Reed-Solomon code, and Levenshtein-Tenengolts code.
- the current or ionic flux profiles and asymmetric base calling errors are intrinsic to the type of nanopore and biochemistry employed, and this information can be used to design more robust DNA codes using the aforementioned error correcting approaches.
- An alternative to employing robust DNA nanopore sequencing barcodes one can directly use the current or ionic flux signatures of barcode sequences (U.S. Pat. No.
- the identifying components of a coding tag, recording tag, or both are capable of generating a unique current or ionic flux or optical signature, wherein the analysis step of any of the methods provided herein comprises detection of the unique current or ionic flux or optical signature in order to identify the identifying components.
- the identifying components are selected from an encoder sequence, barcode, UMI, compartment tag, cycle specific sequence, or any combination thereof.
- all or substantially amount of the macromolecules e.g., proteins, polypeptides, or peptides
- a recording tag e.g., at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%
- Labeling of the macromolecules may occur before or after immobilization of the macromolecules to a solid support.
- a subset of macromolecules within a sample are labeled with recording tags.
- a subset of macromolecules from a sample undergo targeted (analyte specific) labeling with recording tags.
- Targeted recording tag labeling of proteins may be achieved using target protein-specific binding agents (e.g., antibodies, aptamers, etc.) that are linked a short target-specific DNA capture probe, e.g., analyte-specific barcode, which anneal to complementary target-specific bait sequence, e.g., analyte-specific barcode, in recording tags (see, e.g., FIG. 28A ).
- the recording tags comprise a reactive moiety for a cognate reactive moiety present on the target protein (e.g., click chemistry labeling, photoaffinity labeling).
- recording tags may comprise an azide moiety for interacting with alkyne-derivatized proteins, or recording tags may comprise a benzophenone for interacting with native proteins, etc. (see, e.g., FIGS. 28A-B ).
- the recording tag and target protein are coupled via their corresponding reactive moieties (see, e.g., FIG. 28B-C ).
- the target-protein specific binding agent may be removed by digestion of the DNA capture probe linked to the target-protein specific binding agent.
- the DNA capture probe may be designed to contain uracil bases, which are then targeted for digestion with a uracil-specific excision reagent (e.g., USERTM), and the target-protein specific binding agent may be dissociated from the target protein.
- a uracil-specific excision reagent e.g., USERTM
- antibodies specific for a set of target proteins can be labeled with a DNA capture probe (e.g., analyte barcode BC A in FIG. 28 ) that hybridizes with recording tags designed with complementary bait sequence (e.g., analyte barcode BC A ′ in FIG. 28 ).
- a DNA capture probe e.g., analyte barcode BC A in FIG. 28
- complementary bait sequence e.g., analyte barcode BC A ′ in FIG. 28
- Sample-specific labeling of proteins can be achieved by employing DNA-capture probe labeled antibodies hybridizing with complementary bait sequence on recording tags comprising of sample-specific barcodes.
- target protein-specific aptamers are used for targeted recording tag labeling of a subset of proteins within a sample.
- a target specific-aptamer is linked to a DNA capture probe that anneals with complementary bait sequence in a recording tag.
- the recording tag comprises a reactive chemical or photo-reactive chemical probes (e.g. benzophenone (BP)) for coupling to the target protein having a corresponding reactive moiety.
- BP benzophenone
- the aptamer binds to its target protein molecule, bringing the recording tag into close proximity to the target protein, resulting in the coupling of the recording tag to the target protein.
- Photoaffinity (PA) protein labeling using photo-reactive chemical probes attached to small molecule protein affinity ligands has been previously described (Park, Koh et al. 2016).
- Typical photo-reactive chemical probes include probes based on benzophenone (reactive diradical, 365 nm), phenyldiazirine (reactive carbon, 365 nm), and phenylazide (reactive nitrene free radical, 260 nm), activated under irradiation wavelengths as previously described (Smith and Collins 2015).
- target proteins within a protein sample are labeled with recording tags comprising sample barcodes using the method disclosed by Li et al., in which a bait sequence in a benzophenone labeled recording tag is hybridized to a DNA capture probe attached to a cognate binding agent, e.g., nucleic acid aptamer (see, e.g., FIG. 28 ) (Li, Liu et al. 2013).
- a cognate binding agent e.g., nucleic acid aptamer
- the use of DNA/RNA aptamers as target protein-specific binding agents are preferred over antibodies since the photoaffinity moiety can self-label the antibody rather than the target protein.
- photoaffinity labeling is less efficient for nucleic acids than proteins, making aptamers a better vehicle for DNA-directed chemical or photo-labeling. Similar to photo-affinity labeling, one can also employ DNA-directed chemical labeling of reactive lysine's (or other moieties) in the proximity of the aptamer binding site in a manner similar to that described by Rosen et al. (Rosen, Kodal et al. 2014, Kodal, Rosen et al. 2016).
- linkages besides hybridization can be used to link the target specific binding agent and the recording tag (see, e.g., FIG. 28A ).
- the two moieties can be covalently linked, using a linker that is designed to be cleaved and release the binding agent once the captured target protein (or other macromolecule) is covalently linked to the recording tag as shown in FIG. 28B .
- a suitable linker can be attached to various positions of the recording tag, such as the 3′ end, or within the linker attached to the 5′ end of the recording tag.
- kits described herein comprise a binding agent capable of binding to an analyte, e.g., a macromolecule.
- a binding agent can be any molecule (e.g., peptide, polypeptide, protein, nucleic acid, carbohydrate, small molecule, and the like) capable of binding to a component or feature of a macromolecule.
- a binding agent can be a naturally occurring, synthetically produced, or recombinantly expressed molecule.
- a binding agent may bind to a single monomer or subunit of a macromolecule (e.g., a single amino acid of a peptide) or bind to multiple linked subunits of a macromolecule (e.g., dipeptide, tripeptide, or higher order peptide of a longer peptide molecule).
- a binding agent may be designed to bind covalently.
- Covalent binding can be designed to be conditional or favored upon binding to the correct moiety.
- an NTAA and its cognate NTAA-specific binding agent may each be modified with a reactive group such that once the NTAA-specific binding agent is bound to the cognate NTAA, a coupling reaction is carried out to create a covalent linkage between the two. Non-specific binding of the binding agent to other locations that lack the cognate reactive group would not result in covalent attachment.
- Covalent binding between a binding agent and its target allows for more stringent washing to be used to remove binding agents that are non-specifically bound, thus increasing the specificity of the assay.
- a binding agent may be a selective binding agent.
- selective binding refers to the ability of the binding agent to preferentially bind to a specific ligand (e.g., amino acid or class of amino acids) relative to binding to a different ligand (e.g., amino acid or class of amino acids).
- Selectivity is commonly referred to as the equilibrium constant for the reaction of displacement of one ligand by another ligand in a complex with a binding agent.
- selectivity is associated with the spatial geometry of the ligand and/or the manner and degree by which the ligand binds to a binding agent, such as by hydrogen bonding or Van der Waals forces (non-covalent interactions) or by reversible or non-reversible covalent attachment to the binding agent. It should also be understood that selectivity may be relative, and as opposed to absolute, and that different factors can affect the same, including ligand concentration.
- a binding agent selectively binds one of the twenty standard amino acids.
- a binding agent may bind to two or more of the twenty standard amino acids.
- the ability of a binding agent to selectively bind a feature or component of a macromolecule need only be sufficient to allow transfer of its coding tag information to the recording tag associated with the macromolecule, transfer of the recording tag information to the coding tag, or transferring of the coding tag information and recording tag information to a di-tag molecule.
- selectively need only be relative to the other binding agents to which the macromolecule is exposed.
- selectivity of a binding agent need not be absolute to a specific amino acid, but could be selective to a class of amino acids, such as amino acids with nonpolar or non-polar side chains, or with electrically (positively or negatively) charged side chains, or with aromatic side chains, or some specific class or size of side chains, and the like.
- the binding agent has a high affinity and high selectivity for the macromolecule of interest. In particular, a high binding affinity with a low off-rate is efficacious for information transfer between the coding tag and recording tag.
- a binding agent has a K d of or less than about 50 nM, of or less than about 10 nM, of or less than about 5 nM, of or less than about 1 nM, of or less than about 0.5 nM, or of or less than about 0.1 nM.
- the binding agent is added to the macromolecule at a concentration >10 ⁇ , >100 ⁇ , or >1000 ⁇ its K d to drive binding to completion.
- the NTAA may be modified with an “immunogenic” hapten, such as dinitrophenol (DNP).
- DNP dinitrophenol
- This can be implemented in a cyclic sequencing approach using Sanger's reagent, dinitrofluorobenzene (DNFB), which attaches a DNP group to the amine group of the NTAA.
- DNFB dinitrofluorobenzene
- Commercial anti-DNP antibodies have affinities in the low nM range ( ⁇ 8 nM, LO-DNP-2) (Bilgicer, Thomas et al.
- an NTAA may be modified with sulfonyl nitrophenol (SNP) using 4-sulfonyl-2-nitrofluorobenzene (SNFB).
- SNP sulfonyl nitrophenol
- SNFB 4-sulfonyl-2-nitrofluorobenzene
- Similar affinity enhancements may also be achieved with alternative NTAA modifiers, such as an acetyl group or an amidinyl (guanidinyl) group.
- a binding agent may bind to an NTAA, a CTAA, an intervening amino acid, dipeptide (sequence of two amino acids), tripeptide (sequence of three amino acids), or higher order peptide of a peptide molecule.
- each binding agent in a library of binding agents selectively binds to a particular amino acid, for example one of the twenty standard naturally occurring amino acids.
- the standard, naturally-occurring amino acids include Alanine (A or Ala), Cysteine (C or Cys), Aspartic Acid (D or Asp), Glutamic Acid (E or Glu), Phenylalanine (F or Phe), Glycine (G or Gly), Histidine (H or His), Isoleucine (I or Ile), Lysine (K or Lys), Leucine (L or Leu), Methionine (M or Met), Asparagine (N or Asn), Proline (P or Pro), Glutamine (Q or Gln), Arginine (R or Arg), Serine (S or Ser), Threonine (T or Thr), Valine (V or Val), Tryptophan (W or Trp), and Tyrosine (Y or Tyr).
- a binding agent may bind to a post-translational modification of an amino acid.
- a peptide comprises one or more post-translational modifications, which may be the same of different.
- the NTAA, CTAA, an intervening amino acid, or a combination thereof of a peptide may be post-translationally modified.
- Post-translational modifications to amino acids include acylation, acetylation, alkylation (including methylation), biotinylation, butyrylation, carbamylation, carbonylation, deamidation, deiminiation, diphthamide formation, disulfide bridge formation, eliminylation, flavin attachment, formylation, gamma-carboxylation, glutamylation, glycylation, glycosylation, glypiation, heme C attachment, hydroxylation, hypusine formation, iodination, isoprenylation, lipidation, lipoylation, malonylation, methylation, myristolylation, oxidation, palmitoylation, pegylation, phosphopantetheinylation, phosphorylation, prenylation, propionylation, retinylidene Schiff base formation, S-glutathionylation, S-nitrosylation, S-sulfenylation, selenation, succinylation,
- a lectin is used as a binding agent for detecting the glycosylation state of a protein, polypeptide, or peptide.
- Lectins are carbohydrate-binding proteins that can selectively recognize glycan epitopes of free carbohydrates or glycoproteins.
- a list of lectins recognizing various glycosylation states include: A, AAA, AAL, ABA, ACA, ACG, ACL, AOL, ASA, BanLec, BC2L-A, BC2LCN, BPA, BPL, Calsepa, CGL2, CNL, Con, ConA, DBA, Discoidin, DSA, ECA, EEL, F17AG, Gal1, Gal1-S, Gal2, Gal3, Gal3C-S, Gal7-S, Gal9, GNA, GRFT, GS-I, GS-II, GSL-I, GSL-II, HHL, HIHA, HPA, I, II, Jacalin, LBA, LCA, LEA, LEL, Lentil, Lotus, LSL-N, LTL, MAA, MAH, MAL
- a binding agent may bind to a modified or labeled NTAA.
- a modified or labeled NTAA can be one that is labeled with PITC, 1-fluoro-2,4-dinitrobenzene (Sanger's reagent, DNFB), dansyl chloride (DNS-Cl, or 1-dimethylaminonaphthalene-5-sulfonyl chloride), 4-sulfonyl-2-nitrofluorobenzene (SNFB), an acetylating reagent, a guanidinylation reagent, a thioacylation reagent, a thioacetylation reagent, or a thiobenzylation reagent.
- a binding agent can be an aptamer (e.g., peptide aptamer, DNA aptamer, or RNA aptamer), an antibody, an anticalin, an ATP-dependent Clp protease adaptor protein (ClpS), an antibody binding fragment, an antibody mimetic, a peptide, a peptidomimetic, a protein, or a polynucleotide (e.g., DNA, RNA, peptide nucleic acid (PNA), a ⁇ PNA, bridged nucleic acid (BNA), xeno nucleic acid (XNA), glycerol nucleic acid (GNA), or threose nucleic acid (TNA), or a variant thereof).
- aptamer e.g., peptide aptamer, DNA aptamer, or RNA aptamer
- an antibody e.g., an anticalin, an ATP-dependent Clp protease adaptor protein
- antibody and antibodies are used in a broad sense, to include not only intact antibody molecules, for example but not limited to immunoglobulin A, immunoglobulin G, immunoglobulin D, immunoglobulin E, and immunoglobulin M, but also any immunoreactivity component(s) of an antibody molecule that immuno-specifically bind to at least one epitope.
- An antibody may be naturally occurring, synthetically produced, or recombinantly expressed.
- An antibody may be a fusion protein.
- An antibody may be an antibody mimetic.
- antibodies include but are not limited to, Fab fragments, Fab′ fragments, F(ab′)2 fragments, single chain antibody fragments (scFv), miniantibodies, diabodies, crosslinked antibody fragments, AffibodyTM, nanobodies, single domain antibodies, DVD-Ig molecules, alphabodies, affimers, affitins, cyclotides, molecules, and the like.
- Immunoreactive products derived using antibody engineering or protein engineering techniques are also expressly within the meaning of the term antibodies.
- Detailed descriptions of antibody and/or protein engineering, including relevant protocols, can be found in, among other places, J. Maynard and G. Georgiou, 2000, Ann. Rev. Biomed. Eng. 2:339-76; Antibody Engineering, R. Kontermann and S. Dubel, eds., Springer Lab Manual, Springer Verlag (2001); U.S. Pat. No. 5,831,012; and S. Paul, Antibody Engineering Protocols, Humana Press (1995).
- nucleic acid and peptide aptamers that specifically recognize a peptide can be produced using known methods.
- Aptamers bind target molecules in a highly specific, conformation-dependent manner, typically with very high affinity, although aptamers with lower binding affinity can be selected if desired.
- Aptamers have been shown to distinguish between targets based on very small structural differences such as the presence or absence of a methyl or hydroxyl group and certain aptamers can distinguish between D- and L-enantiomers.
- Aptamers have been obtained that bind small molecular targets, including drugs, metal ions, and organic dyes, peptides, biotin, and proteins, including but not limited to streptavidin, VEGF, and viral proteins.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Analytical Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Physics & Mathematics (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Biophysics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Plant Pathology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/760,032 US20210355483A1 (en) | 2017-10-31 | 2018-10-31 | Methods and kits using nucleic acid encoding and/or label |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762579840P | 2017-10-31 | 2017-10-31 | |
| US201762582916P | 2017-11-07 | 2017-11-07 | |
| PCT/US2018/058583 WO2019089851A1 (en) | 2017-10-31 | 2018-10-31 | Methods and kits using nucleic acid encoding and/or label |
| US16/760,032 US20210355483A1 (en) | 2017-10-31 | 2018-10-31 | Methods and kits using nucleic acid encoding and/or label |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/058583 A-371-Of-International WO2019089851A1 (en) | 2017-10-31 | 2018-10-31 | Methods and kits using nucleic acid encoding and/or label |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/125,075 Continuation US12129463B2 (en) | 2017-10-31 | 2023-03-22 | Methods and kits using nucleic acid encoding and/or label |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20210355483A1 true US20210355483A1 (en) | 2021-11-18 |
Family
ID=66332291
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/760,032 Abandoned US20210355483A1 (en) | 2017-10-31 | 2018-10-31 | Methods and kits using nucleic acid encoding and/or label |
| US18/125,075 Active US12129463B2 (en) | 2017-10-31 | 2023-03-22 | Methods and kits using nucleic acid encoding and/or label |
| US18/799,749 Active US12467049B2 (en) | 2017-10-31 | 2024-08-09 | Methods and kits using nucleic acid encoding and/or label |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/125,075 Active US12129463B2 (en) | 2017-10-31 | 2023-03-22 | Methods and kits using nucleic acid encoding and/or label |
| US18/799,749 Active US12467049B2 (en) | 2017-10-31 | 2024-08-09 | Methods and kits using nucleic acid encoding and/or label |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US20210355483A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3704246A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7253833B2 (cg-RX-API-DMAC7.html) |
| AU (1) | AU2018358247A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3081451A1 (cg-RX-API-DMAC7.html) |
| SG (1) | SG11202003923PA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2019089851A1 (cg-RX-API-DMAC7.html) |
Cited By (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210239705A1 (en) * | 2018-06-06 | 2021-08-05 | Nautilus Biotechnology, Inc. | Methods and applications of protein identification |
| US11282586B2 (en) | 2017-12-29 | 2022-03-22 | Nautilus Biotechnology, Inc. | Decoding approaches for protein identification |
| US11448647B2 (en) | 2016-12-01 | 2022-09-20 | Nautilus Biotechnology, Inc. | Methods of assaying proteins |
| US11513126B2 (en) | 2017-10-31 | 2022-11-29 | Encodia, Inc. | Kits for analysis using nucleic acid encoding and/or label |
| US11603383B2 (en) | 2018-04-04 | 2023-03-14 | Nautilus Biotechnology, Inc. | Methods of generating nanoarrays and microarrays |
| US11634709B2 (en) | 2019-04-30 | 2023-04-25 | Encodia, Inc. | Methods for preparing analytes and related kits |
| US20230146476A1 (en) * | 2020-02-29 | 2023-05-11 | President And Fellows Of Harvard College | Nanoswitch caliper trains for high-throughput, high-resolution structural analysis of biomolecules |
| WO2023096675A1 (en) * | 2021-11-23 | 2023-06-01 | Pleno, Inc. | Encoded endonuclease assays |
| WO2023122698A1 (en) * | 2021-12-21 | 2023-06-29 | Encodia, Inc. | Methods for balancing encoding signals of analytes |
| US11692217B2 (en) | 2020-11-11 | 2023-07-04 | Nautilus Subsidiary, Inc. | Affinity reagents having enhanced binding and detection characteristics |
| US20230416828A1 (en) * | 2021-11-24 | 2023-12-28 | Alida Biosciences, Inc. | Rna and dna analysis using engineered surfaces |
| WO2024030919A1 (en) * | 2022-08-02 | 2024-02-08 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| US20240110222A1 (en) * | 2020-11-25 | 2024-04-04 | Alida Biosciences Inc. | Multiplexed profiling of rna and dna modifications |
| US11959922B2 (en) | 2016-05-02 | 2024-04-16 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US11993865B2 (en) | 2018-11-20 | 2024-05-28 | Nautilus Subsidiary, Inc. | Selection of affinity reagents |
| WO2024123807A1 (en) * | 2022-12-06 | 2024-06-13 | Shifeng Li | Methods and apparatus for protein and peptide sequencing |
| WO2024138170A1 (en) * | 2022-12-23 | 2024-06-27 | Illumina, Inc. | Spatial mrna/protein co-assays using aptamers |
| US12043862B2 (en) | 2021-12-28 | 2024-07-23 | Encodia, Inc. | High-throughput serotyping and antibody profiling assays |
| US12129463B2 (en) | 2017-10-31 | 2024-10-29 | Encodia, Inc. | Methods and kits using nucleic acid encoding and/or label |
| WO2024206599A3 (en) * | 2023-03-31 | 2024-10-31 | Shifeng Li | Methods for detection and analysis of proteins |
| WO2025085861A1 (en) * | 2023-10-20 | 2025-04-24 | Spectral Therapeutics, Inc. | Composite particles for use in generating spectrally encoded libraries of chemical compounds, and methods of making and using the same |
| US12306093B2 (en) | 2019-04-29 | 2025-05-20 | Nautilus Subsidiary, Inc. | Methods and systems for integrated on-chip single-molecule detection |
| WO2025144972A1 (en) * | 2023-12-29 | 2025-07-03 | Illumina, Inc. | Materials and methods for preparation of a spatial transcriptomics library |
| US12377635B2 (en) | 2019-10-30 | 2025-08-05 | Nautilus Subsidiary, Inc. | Flow cell systems and methods |
| US12467081B2 (en) | 2020-11-23 | 2025-11-11 | Pleno, Inc. | Encoded endonuclease assays |
| US12474346B2 (en) | 2021-11-05 | 2025-11-18 | Encodia, Inc. | Methods and kits for multicycle encoding assay |
| US12612621B2 (en) | 2017-08-18 | 2026-04-28 | Nautilus Subsidiary, Inc. | Methods of selecting binding reagents |
| US12612656B2 (en) | 2021-11-30 | 2026-04-28 | Nautilus Subsidiary, Inc. | Particle-based isolation of proteins and other analytes |
Families Citing this family (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11435358B2 (en) | 2011-06-23 | 2022-09-06 | Board Of Regents, The University Of Texas System | Single molecule peptide sequencing |
| CA2839702C (en) | 2011-06-23 | 2021-04-20 | Board Of Regents, The University Of Texas System | Identifying peptides at the single molecule level |
| CA3208970A1 (en) | 2014-09-15 | 2016-05-06 | Board Of Regents, The University Of Texas System | Improved single molecule peptide sequencing |
| CA3110800A1 (en) | 2018-07-12 | 2020-01-16 | Board Of Regents, The University Of Texas System | Molecular neighborhood detection by oligonucleotides |
| EP3847253A4 (en) * | 2018-09-04 | 2022-05-18 | Encodia, Inc. | Proximity interaction analysis |
| CA3117476A1 (en) | 2018-10-05 | 2020-04-09 | Board Of Regents, The University Of Texas System | Solid-phase n-terminal peptide capture and release |
| CN114126476B (zh) | 2019-04-23 | 2025-09-09 | Encodia公司 | 用于蛋白质的空间分析的方法及相关试剂盒 |
| JP7578294B2 (ja) * | 2019-05-20 | 2024-11-06 | エンコディア, インコーポレイテッド | 空間分析のための方法および関連キット |
| CA3144528A1 (en) * | 2019-12-23 | 2021-07-01 | Illumina, Inc. | Nanoparticle with single site for template polynucleotide attachment |
| WO2021141922A1 (en) * | 2020-01-07 | 2021-07-15 | Encodia, Inc. | Methods for information transfer and related kits |
| EP4073263A4 (en) | 2020-01-07 | 2023-11-08 | Encodia, Inc. | METHOD FOR STABLE COMPLEX FORMATION AND CORRESPONDING KITS |
| WO2021141924A1 (en) | 2020-01-07 | 2021-07-15 | Encodia, Inc. | Methods for stable complex formation and related kits |
| US20230081062A1 (en) * | 2020-02-12 | 2023-03-16 | Universal Sequencing Technology Corporation | Methods for intracellular barcoding and spatial barcoding |
| EP4196581B1 (en) | 2020-08-19 | 2026-02-25 | Encodia, Inc. | Sequential encoding methods and related kits |
| US20230357834A1 (en) * | 2020-09-26 | 2023-11-09 | The Regents Of The University Of California | Hybrid protocols and barcoding schemes for multiple sequencing technologies |
| US20230220589A1 (en) * | 2020-09-30 | 2023-07-13 | Encodia, Inc. | Polypeptide terminal binders and uses thereof |
| CN117813506A (zh) * | 2021-05-26 | 2024-04-02 | 德克萨斯大学系统董事会 | 缀合的生物分子条形码的组合物、方法和效用 |
| CN113908589B (zh) * | 2021-10-08 | 2022-09-27 | 天津工业大学 | 一种表面印迹抗体的疏水电荷诱导模式膜层析介质及其制备方法 |
| EP4453244A4 (en) * | 2021-12-23 | 2025-12-24 | Takara Bio Usa Inc | METHODS AND COMPOSITIONS FOR THE PRODUCTION OF IDENTIFIABLE NUCLEIC ACID COLLECTIONS FROM CELLULAR SOURCES |
| WO2024040236A2 (en) | 2022-08-19 | 2024-02-22 | Abrus Bio, Inc. | Determination of protein information by recoding amino acid polymers into dna polymers |
| WO2024050553A1 (en) * | 2022-09-01 | 2024-03-07 | The Johns Hopkins University | Methods for measuring telomere length |
| CN115881218B (zh) * | 2022-12-15 | 2023-06-09 | 哈尔滨星云医学检验所有限公司 | 用于全基因组关联分析的基因自动选择方法 |
| US20250154584A1 (en) * | 2023-11-09 | 2025-05-15 | Encodia, Inc. | Methods for identifying polypeptides |
Family Cites Families (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5573905A (en) * | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US6875851B1 (en) | 1999-03-05 | 2005-04-05 | University Of Georgia Research Foundation, Inc. | Prolyl tripeptidyl peptidases nucleic acid of Porphyromonas gingivalis |
| WO2000057183A1 (en) | 1999-03-23 | 2000-09-28 | Biovation Limited | Protein isolation and analysis |
| US7306904B2 (en) | 2000-02-18 | 2007-12-11 | Olink Ab | Methods and kits for proximity probing |
| US6511809B2 (en) | 2000-06-13 | 2003-01-28 | E. I. Du Pont De Nemours And Company | Method for the detection of an analyte by means of a nucleic acid reporter |
| US6800453B2 (en) | 2001-01-23 | 2004-10-05 | President And Fellows Of Harvard College | Nucleic-acid programmable protein arrays |
| EP1401850A1 (en) | 2001-06-20 | 2004-03-31 | Nuevolution A/S | Nucleoside derivatives for library preparation |
| JP2005509444A (ja) | 2001-11-23 | 2005-04-14 | シモン・フレデリックソン | 多価近接プローブにより近接プロービングするための方法およびキット |
| MX282672B (es) | 2002-10-10 | 2011-01-10 | Diversa Corp | Proteasas, acidos nucleicos que los codifican, y metodos de hacer y usar los mismos. |
| WO2005015239A2 (en) | 2003-08-07 | 2005-02-17 | Cornell Research Foundation, Inc. | Method for n-terminal labeling of proteins |
| US7198900B2 (en) | 2003-08-29 | 2007-04-03 | Applera Corporation | Multiplex detection compositions, methods, and kits |
| US11118215B2 (en) * | 2003-09-18 | 2021-09-14 | Nuevolution A/S | Method for obtaining structural information concerning an encoded molecule and method for selecting compounds |
| US7579165B2 (en) | 2003-10-16 | 2009-08-25 | Shimadzu Corporation | Methods for derivatizing protein or peptide with sulfonic acid groups |
| EP1694693A2 (en) | 2003-12-17 | 2006-08-30 | Praecis Pharmaceuticals Inc. | Methods for synthesis of encoded libraries |
| DE602005017370D1 (de) | 2004-03-22 | 2009-12-10 | Nuevolution As | Ligationscodierung unter verwendung von oligonukleotidbausteinen |
| AU2005241003B2 (en) | 2004-04-14 | 2011-05-19 | President And Fellows Of Harvard College | Nucleic-acid programmable protein arrays |
| US20060199279A1 (en) | 2005-03-07 | 2006-09-07 | Viorica Lopez-Avila | Methods for identifying post-translationally modified polypeptides |
| US7883848B2 (en) | 2005-07-08 | 2011-02-08 | Olink Ab | Regulation analysis by cis reactivity, RACR |
| PT3305900T (pt) * | 2005-12-01 | 2021-10-27 | Nuevolution As | Métodos de codificação enzimática para síntese eficaz de bibliotecas grandes |
| US20100311114A1 (en) | 2007-10-19 | 2010-12-09 | Pronota N.V. | Preparation of samples for proteome analysis |
| CA2745197A1 (en) | 2008-12-01 | 2010-06-10 | Research Triangle Institute | Concurrent identification of multitudes of polypeptides |
| US9085798B2 (en) | 2009-04-30 | 2015-07-21 | Prognosys Biosciences, Inc. | Nucleic acid constructs and methods of use |
| WO2011056185A2 (en) | 2009-11-04 | 2011-05-12 | President And Fellows Of Harvard College | Reactivity-dependent and interaction-dependent pcr |
| WO2011071943A1 (en) | 2009-12-07 | 2011-06-16 | Prognosys Biosciences, Inc. | Peptide display arrays |
| WO2011127006A1 (en) | 2010-04-05 | 2011-10-13 | Prognosys Biosciences, Inc. | Co-localization affinity assays |
| GB201101621D0 (en) | 2011-01-31 | 2011-03-16 | Olink Ab | Method and product |
| EP2694709B1 (en) | 2011-04-08 | 2016-09-14 | Prognosys Biosciences, Inc. | Peptide constructs and assay systems |
| US20130052665A1 (en) | 2011-08-25 | 2013-02-28 | Bruce Xuefeng Ling | Methods for diagnosis of systemic juvenile idiopathic arthritis |
| US9335292B2 (en) | 2011-10-13 | 2016-05-10 | Auburn University | Electrochemical proximity assay |
| US9435810B2 (en) | 2013-03-15 | 2016-09-06 | Washington University | Molecules and methods for iterative polypeptide analysis and processing |
| US10053725B2 (en) | 2013-04-23 | 2018-08-21 | President And Fellows Of Harvard College | In situ interaction determination |
| US10288608B2 (en) * | 2013-11-08 | 2019-05-14 | Prognosys Biosciences, Inc. | Polynucleotide conjugates and methods for analyte detection |
| US9834814B2 (en) * | 2013-11-22 | 2017-12-05 | Agilent Technologies, Inc. | Spatial molecular barcoding of in situ nucleic acids |
| US10858698B2 (en) | 2014-03-25 | 2020-12-08 | President And Fellows Of Harvard College | Barcoded protein array for multiplex single-molecule interaction profiling |
| WO2015176034A1 (en) | 2014-05-15 | 2015-11-19 | Two Pore Guys, Inc. | Scaffold data storage and target detection in a sample using a nanopore |
| WO2015200893A2 (en) | 2014-06-26 | 2015-12-30 | 10X Genomics, Inc. | Methods of analyzing nucleic acids from individual cells or cell populations |
| US20170212101A1 (en) | 2014-07-18 | 2017-07-27 | Cdi Laboratories, Inc. | Methods and compositions to identify, quantify, and characterize target analytes and binding moieties |
| US10526641B2 (en) | 2014-08-01 | 2020-01-07 | Dovetail Genomics, Llc | Tagging nucleic acids for sequence assembly |
| CA3208970A1 (en) | 2014-09-15 | 2016-05-06 | Board Of Regents, The University Of Texas System | Improved single molecule peptide sequencing |
| ES2965764T3 (es) | 2015-02-24 | 2024-04-16 | Hope City | Plataformas de cribado de bibliotecas abordadas espacialmente codificadas químicamente |
| WO2016138496A1 (en) | 2015-02-27 | 2016-09-01 | Cellular Research, Inc. | Spatially addressable molecular barcoding |
| WO2016145416A2 (en) | 2015-03-11 | 2016-09-15 | The Broad Institute, Inc. | Proteomic analysis with nucleic acid identifiers |
| EP3452591B1 (en) * | 2016-05-02 | 2023-08-16 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| WO2018005720A1 (en) | 2016-06-30 | 2018-01-04 | President And Fellows Of Harvard College | Method of determining the molecular binding between libraries of molecules |
| CN118853848A (zh) | 2016-08-31 | 2024-10-29 | 哈佛学院董事及会员团体 | 将生物分子的检测组合到使用荧光原位测序的单个试验的方法 |
| EP4029939B1 (en) | 2017-01-30 | 2023-06-28 | 10X Genomics, Inc. | Methods and systems for droplet-based single cell barcoding |
| CN117887804A (zh) | 2017-02-02 | 2024-04-16 | 纽约基因组研究中心公司 | 用于识别或量化在生物样品中的靶标的方法和组合物 |
| CA3081446A1 (en) | 2017-10-31 | 2019-05-09 | Encodia, Inc. | Methods and compositions for polypeptide analysis |
| JP7390027B2 (ja) | 2017-10-31 | 2023-12-01 | エンコディア, インコーポレイテッド | 核酸エンコーディングおよび/または標識を使用する解析のためのキット |
| SG11202003923PA (en) | 2017-10-31 | 2020-05-28 | Encodia Inc | Methods and kits using nucleic acid encoding and/or label |
| KR20250152680A (ko) | 2017-12-29 | 2025-10-23 | 노틸러스 서브시디어리, 인크. | 단백질 식별을 위한 디코딩 접근법 |
-
2018
- 2018-10-31 SG SG11202003923PA patent/SG11202003923PA/en unknown
- 2018-10-31 WO PCT/US2018/058583 patent/WO2019089851A1/en not_active Ceased
- 2018-10-31 JP JP2020524113A patent/JP7253833B2/ja active Active
- 2018-10-31 US US16/760,032 patent/US20210355483A1/en not_active Abandoned
- 2018-10-31 EP EP18872456.1A patent/EP3704246A4/en active Pending
- 2018-10-31 CA CA3081451A patent/CA3081451A1/en active Pending
- 2018-10-31 AU AU2018358247A patent/AU2018358247A1/en not_active Abandoned
-
2023
- 2023-03-22 US US18/125,075 patent/US12129463B2/en active Active
-
2024
- 2024-08-09 US US18/799,749 patent/US12467049B2/en active Active
Cited By (57)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12235276B2 (en) | 2016-05-02 | 2025-02-25 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US11959922B2 (en) | 2016-05-02 | 2024-04-16 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US12517133B2 (en) | 2016-05-02 | 2026-01-06 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US12019077B2 (en) | 2016-05-02 | 2024-06-25 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US12320813B2 (en) | 2016-05-02 | 2025-06-03 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US12019078B2 (en) | 2016-05-02 | 2024-06-25 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US12123878B2 (en) | 2016-05-02 | 2024-10-22 | Encodia, Inc. | Macromolecule analysis employing nucleic acid encoding |
| US11448647B2 (en) | 2016-12-01 | 2022-09-20 | Nautilus Biotechnology, Inc. | Methods of assaying proteins |
| US11579144B2 (en) | 2016-12-01 | 2023-02-14 | Nautilus Biotechnology, Inc. | Methods of assaying proteins |
| US11549942B2 (en) | 2016-12-01 | 2023-01-10 | Nautilus Biotechnology, Inc. | Methods of assaying proteins |
| US11754559B2 (en) | 2016-12-01 | 2023-09-12 | Nautilus Subsidiary, Inc. | Methods of assaying proteins |
| US11768201B1 (en) | 2016-12-01 | 2023-09-26 | Nautilus Subsidiary, Inc. | Methods of assaying proteins |
| US12612621B2 (en) | 2017-08-18 | 2026-04-28 | Nautilus Subsidiary, Inc. | Methods of selecting binding reagents |
| US12130291B2 (en) | 2017-10-31 | 2024-10-29 | Encodia, Inc. | Kits for analysis using nucleic acid encoding and/or label |
| US12129463B2 (en) | 2017-10-31 | 2024-10-29 | Encodia, Inc. | Methods and kits using nucleic acid encoding and/or label |
| US11782062B2 (en) | 2017-10-31 | 2023-10-10 | Encodia, Inc. | Kits for analysis using nucleic acid encoding and/or label |
| US12467049B2 (en) | 2017-10-31 | 2025-11-11 | Encodia, Inc. | Methods and kits using nucleic acid encoding and/or label |
| US12467928B2 (en) | 2017-10-31 | 2025-11-11 | Encodia, Inc. | N-terminal modifier agents and binders for treating and analyzing peptides |
| US11513126B2 (en) | 2017-10-31 | 2022-11-29 | Encodia, Inc. | Kits for analysis using nucleic acid encoding and/or label |
| US12292446B2 (en) | 2017-10-31 | 2025-05-06 | Encodia, Inc. | Kits for analysis using nucleic acid encoding and/or label |
| US11282586B2 (en) | 2017-12-29 | 2022-03-22 | Nautilus Biotechnology, Inc. | Decoding approaches for protein identification |
| US11282585B2 (en) | 2017-12-29 | 2022-03-22 | Nautilus Biotechnology, Inc. | Decoding approaches for protein identification |
| US12148509B2 (en) | 2017-12-29 | 2024-11-19 | Nautilus Subsidiary, Inc. | Decoding approaches for protein identification |
| US11603383B2 (en) | 2018-04-04 | 2023-03-14 | Nautilus Biotechnology, Inc. | Methods of generating nanoarrays and microarrays |
| US20210239705A1 (en) * | 2018-06-06 | 2021-08-05 | Nautilus Biotechnology, Inc. | Methods and applications of protein identification |
| US11993865B2 (en) | 2018-11-20 | 2024-05-28 | Nautilus Subsidiary, Inc. | Selection of affinity reagents |
| US12306093B2 (en) | 2019-04-29 | 2025-05-20 | Nautilus Subsidiary, Inc. | Methods and systems for integrated on-chip single-molecule detection |
| US11634709B2 (en) | 2019-04-30 | 2023-04-25 | Encodia, Inc. | Methods for preparing analytes and related kits |
| US12377635B2 (en) | 2019-10-30 | 2025-08-05 | Nautilus Subsidiary, Inc. | Flow cell systems and methods |
| US12571802B2 (en) * | 2020-02-29 | 2026-03-10 | President And Fellows Of Harvard College | Nanoswitch caliper trains for high-throughput, high-resolution structural analysis of biomolecules |
| US20230146476A1 (en) * | 2020-02-29 | 2023-05-11 | President And Fellows Of Harvard College | Nanoswitch caliper trains for high-throughput, high-resolution structural analysis of biomolecules |
| US12577608B2 (en) | 2020-11-11 | 2026-03-17 | Nautilus Subsidiary, Inc. | Affinity reagents having enhanced binding and detection characteristics |
| US11692217B2 (en) | 2020-11-11 | 2023-07-04 | Nautilus Subsidiary, Inc. | Affinity reagents having enhanced binding and detection characteristics |
| US11993807B2 (en) | 2020-11-11 | 2024-05-28 | Nautilus Subsidiary, Inc. | Affinity reagents having enhanced binding and detection characteristics |
| US12497651B2 (en) | 2020-11-23 | 2025-12-16 | Pleno, Inc. | Encoded dual-probe endonuclease assays |
| US12467081B2 (en) | 2020-11-23 | 2025-11-11 | Pleno, Inc. | Encoded endonuclease assays |
| US12503720B2 (en) | 2020-11-25 | 2025-12-23 | Alida Biosciences Inc. | Multiplexed profiling of RNA and DNA modifications |
| US20240110222A1 (en) * | 2020-11-25 | 2024-04-04 | Alida Biosciences Inc. | Multiplexed profiling of rna and dna modifications |
| US12338485B2 (en) * | 2020-11-25 | 2025-06-24 | Alida Biosciences Inc. | Multiplexed profiling of RNA and DNA modifications |
| US12474346B2 (en) | 2021-11-05 | 2025-11-18 | Encodia, Inc. | Methods and kits for multicycle encoding assay |
| WO2023096675A1 (en) * | 2021-11-23 | 2023-06-01 | Pleno, Inc. | Encoded endonuclease assays |
| US12281360B2 (en) | 2021-11-24 | 2025-04-22 | Alida Biosciences, Inc. | RNA and DNA analysis using engineered surfaces |
| US12258631B2 (en) * | 2021-11-24 | 2025-03-25 | Alida Biosciences Inc. | RNA and DNA analysis using engineered surfaces |
| US20230416828A1 (en) * | 2021-11-24 | 2023-12-28 | Alida Biosciences, Inc. | Rna and dna analysis using engineered surfaces |
| US12612656B2 (en) | 2021-11-30 | 2026-04-28 | Nautilus Subsidiary, Inc. | Particle-based isolation of proteins and other analytes |
| WO2023122698A1 (en) * | 2021-12-21 | 2023-06-29 | Encodia, Inc. | Methods for balancing encoding signals of analytes |
| US12043862B2 (en) | 2021-12-28 | 2024-07-23 | Encodia, Inc. | High-throughput serotyping and antibody profiling assays |
| US12259393B2 (en) | 2022-08-02 | 2025-03-25 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| US12399180B2 (en) | 2022-08-02 | 2025-08-26 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| US12399181B2 (en) | 2022-08-02 | 2025-08-26 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| US12259394B2 (en) | 2022-08-02 | 2025-03-25 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| WO2024030919A1 (en) * | 2022-08-02 | 2024-02-08 | Glyphic Biotechnologies, Inc. | Protein sequencing via coupling of polymerizable molecules |
| WO2024123807A1 (en) * | 2022-12-06 | 2024-06-13 | Shifeng Li | Methods and apparatus for protein and peptide sequencing |
| WO2024138170A1 (en) * | 2022-12-23 | 2024-06-27 | Illumina, Inc. | Spatial mrna/protein co-assays using aptamers |
| WO2024206599A3 (en) * | 2023-03-31 | 2024-10-31 | Shifeng Li | Methods for detection and analysis of proteins |
| WO2025085861A1 (en) * | 2023-10-20 | 2025-04-24 | Spectral Therapeutics, Inc. | Composite particles for use in generating spectrally encoded libraries of chemical compounds, and methods of making and using the same |
| WO2025144972A1 (en) * | 2023-12-29 | 2025-07-03 | Illumina, Inc. | Materials and methods for preparation of a spatial transcriptomics library |
Also Published As
| Publication number | Publication date |
|---|---|
| SG11202003923PA (en) | 2020-05-28 |
| AU2018358247A1 (en) | 2020-05-21 |
| WO2019089851A8 (en) | 2020-05-28 |
| EP3704246A4 (en) | 2021-08-11 |
| WO2019089851A1 (en) | 2019-05-09 |
| JP2021501576A (ja) | 2021-01-21 |
| US12467049B2 (en) | 2025-11-11 |
| JP7253833B2 (ja) | 2023-04-07 |
| US12129463B2 (en) | 2024-10-29 |
| US20230340458A1 (en) | 2023-10-26 |
| US20250051756A1 (en) | 2025-02-13 |
| CA3081451A1 (en) | 2019-05-09 |
| EP3704246A1 (en) | 2020-09-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12467049B2 (en) | Methods and kits using nucleic acid encoding and/or label | |
| US12292446B2 (en) | Kits for analysis using nucleic acid encoding and/or label | |
| US12517133B2 (en) | Macromolecule analysis employing nucleic acid encoding | |
| US20200348307A1 (en) | Methods and compositions for polypeptide analysis | |
| US20250102513A1 (en) | Kits for analysis using nucleic acid encoding and/or label | |
| HK1261449B (en) | Macromolecule analysis employing nucleic acid encoding | |
| HK1261449A1 (en) | Macromolecule analysis employing nucleic acid encoding |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| AS | Assignment |
Owner name: ENCODIA, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CHEE, MARK S.;GUNDERSON, KEVIN L.;WEINER, MICHAEL PHILLIP;AND OTHERS;SIGNING DATES FROM 20220802 TO 20220804;REEL/FRAME:060775/0721 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
| AS | Assignment |
Owner name: FIRST-CITIZENS BANK & TRUST COMPANY, CALIFORNIA Free format text: SECURITY INTEREST;ASSIGNOR:ENCODIA, INC.;REEL/FRAME:073175/0335 Effective date: 20251016 |